Symbol:
Asf1b
Name:
anti-silencing function 1B histone chaperone
RGD ID:
1304918
Description:
Predicted to enable histone binding activity and histone chaperone activity. Predicted to act upstream of or within blastocyst hatching and nucleosome assembly. Predicted to be located in chromatin and nucleoplasm. Predicted to be part of protein-containing complex. Orthologous to human ASF1B (anti-silencing function 1B histone chaperone); PARTICIPATES IN histone modification pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
ASF1 anti-silencing function 1 homolog B; ASF1 anti-silencing function 1 homolog B (S. cerevisiae); histone chaperone ASF1B; LOC304648
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 41,085,786 - 41,100,352 (-) NCBI GRCr8 mRatBN7.2 19 24,181,024 - 24,195,604 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 24,181,028 - 24,195,549 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 31,002,160 - 31,016,725 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 31,656,566 - 31,671,131 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 33,879,281 - 33,893,844 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 25,077,918 - 25,092,491 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 25,077,918 - 25,092,491 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 36,055,967 - 36,070,506 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 25,867,384 - 25,881,909 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 25,872,530 - 25,887,149 (-) NCBI Celera 19 23,729,321 - 23,743,692 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Asf1b Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of ASF1B mRNA CTD PMID:30723492 Asf1b Rat 17alpha-ethynylestradiol affects expression ISO Asf1b (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of ASF1B mRNA CTD PMID:17555576 Asf1b Rat 17alpha-ethynylestradiol multiple interactions ISO Asf1b (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ASF1B mRNA CTD PMID:17942748 Asf1b Rat 17alpha-ethynylestradiol increases expression ISO Asf1b (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ASF1B mRNA CTD PMID:17942748 Asf1b Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of ASF1B mRNA CTD PMID:32145629 Asf1b Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Asf1b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Asf1b Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Asf1b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Asf1b Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Asf1b (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Asf1b Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Asf1b (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ASF1B mRNA CTD PMID:17942748 Asf1b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ASF1B mRNA CTD PMID:33387578 Asf1b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ASF1B mRNA CTD PMID:34747641 Asf1b Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Asf1b (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ASF1B mRNA CTD PMID:26290441 Asf1b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO ASF1B (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of ASF1B mRNA CTD PMID:22574217 Asf1b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Asf1b (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ASF1B mRNA CTD PMID:21570461 Asf1b Rat 2,4-diaminotoluene increases expression ISO Asf1b (Mus musculus) 6480464 2 and 4-diaminotoluene results in increased expression of ASF1B mRNA CTD PMID:20713471 Asf1b Rat 3-methylcholanthrene increases expression ISO Asf1b (Mus musculus) 6480464 Methylcholanthrene results in increased expression of ASF1B mRNA CTD PMID:20713471 Asf1b Rat 4,4'-sulfonyldiphenol increases expression ISO Asf1b (Mus musculus) 6480464 bisphenol S results in increased expression of ASF1B mRNA CTD PMID:30951980 Asf1b Rat 4-hydroxynon-2-enal increases expression ISO Asf1b (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of ASF1B mRNA CTD PMID:19191707 Asf1b Rat 4-hydroxynon-2-enal decreases expression ISO Asf1b (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of ASF1B mRNA CTD PMID:19191707 Asf1b Rat 4-hydroxyphenyl retinamide decreases expression ISO Asf1b (Mus musculus) 6480464 Fenretinide results in decreased expression of ASF1B mRNA CTD PMID:28973697 Asf1b Rat 4-hydroxyphenyl retinamide increases expression ISO Asf1b (Mus musculus) 6480464 Fenretinide results in increased expression of ASF1B mRNA CTD PMID:28973697 Asf1b Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ASF1B mRNA CTD PMID:24780913 and PMID:30047161 Asf1b Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ASF1B mRNA CTD PMID:31881176 Asf1b Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of ASF1B mRNA CTD PMID:28959563 Asf1b Rat acrylamide decreases expression ISO ASF1B (Homo sapiens) 6480464 Acrylamide results in decreased expression of ASF1B mRNA CTD PMID:32763439 Asf1b Rat aflatoxin B1 affects expression ISO ASF1B (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of ASF1B protein CTD PMID:20106945 Asf1b Rat aflatoxin B1 increases methylation ISO ASF1B (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of ASF1B gene and Aflatoxin B1 results in increased methylation of ASF1B intron CTD PMID:27153756 and PMID:30157460 Asf1b Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of ASF1B mRNA CTD PMID:23630614 and PMID:25378103 Asf1b Rat aflatoxin B1 increases expression ISO Asf1b (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of ASF1B mRNA CTD PMID:19770486 Asf1b Rat Aflatoxin B2 alpha increases methylation ISO ASF1B (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of ASF1B intron CTD PMID:30157460 Asf1b Rat all-trans-retinoic acid decreases expression ISO ASF1B (Homo sapiens) 6480464 Tretinoin results in decreased expression of ASF1B mRNA CTD PMID:16249480 and PMID:33167477 Asf1b Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of ASF1B mRNA CTD PMID:30047161 Asf1b Rat aristolochic acid A increases expression ISO ASF1B (Homo sapiens) 6480464 aristolochic acid I results in increased expression of ASF1B mRNA CTD PMID:33212167 Asf1b Rat arsane multiple interactions ISO ASF1B (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ASF1B mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ASF1B mRNA CTD PMID:39836092 Asf1b Rat arsenic atom multiple interactions ISO ASF1B (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ASF1B mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ASF1B mRNA CTD PMID:39836092 Asf1b Rat arsenite(3-) decreases expression ISO Asf1b (Mus musculus) 6480464 arsenite results in decreased expression of ASF1B mRNA CTD PMID:18929588 Asf1b Rat arsenite(3-) multiple interactions ISO ASF1B (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to ASF1B mRNA] CTD PMID:32406909 Asf1b Rat azoxystrobin decreases expression ISO ASF1B (Homo sapiens) 6480464 azoxystrobin results in decreased expression of ASF1B mRNA CTD PMID:33512557 Asf1b Rat benzo[a]pyrene increases expression ISO Asf1b (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ASF1B mRNA CTD PMID:20504355 Asf1b Rat benzo[a]pyrene increases expression ISO ASF1B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of ASF1B mRNA CTD PMID:32234424 Asf1b Rat benzo[a]pyrene affects methylation ISO ASF1B (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ASF1B intron CTD PMID:30157460 Asf1b Rat benzo[a]pyrene diol epoxide I decreases expression ISO ASF1B (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Asf1b Rat benzo[b]fluoranthene increases expression ISO Asf1b (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of ASF1B mRNA CTD PMID:26377693 Asf1b Rat benzo[e]pyrene decreases methylation ISO ASF1B (Homo sapiens) 6480464 benzo(e)pyrene results in decreased methylation of ASF1B intron CTD PMID:30157460 Asf1b Rat bisphenol A increases expression ISO Asf1b (Mus musculus) 6480464 bisphenol A results in increased expression of ASF1B mRNA CTD PMID:20739668 and PMID:30951980 Asf1b Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ASF1B mRNA CTD PMID:32145629 Asf1b Rat bisphenol A decreases expression ISO ASF1B (Homo sapiens) 6480464 bisphenol A results in decreased expression of ASF1B mRNA CTD PMID:29275510 Asf1b Rat bisphenol A affects expression ISO ASF1B (Homo sapiens) 6480464 bisphenol A affects the expression of ASF1B mRNA CTD PMID:30903817 Asf1b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ASF1B mRNA CTD PMID:25181051 Asf1b Rat bisphenol A decreases expression ISO Asf1b (Mus musculus) 6480464 bisphenol A results in decreased expression of ASF1B mRNA CTD PMID:26063408 Asf1b Rat bisphenol F increases expression ISO Asf1b (Mus musculus) 6480464 bisphenol F results in increased expression of ASF1B mRNA CTD PMID:30951980 Asf1b Rat cadmium dichloride increases expression ISO ASF1B (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of ASF1B mRNA CTD PMID:26472689 Asf1b Rat calcitriol decreases expression ISO ASF1B (Homo sapiens) 6480464 Calcitriol results in decreased expression of ASF1B mRNA CTD PMID:21592394 Asf1b Rat calcitriol multiple interactions ISO ASF1B (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of ASF1B mRNA CTD PMID:21592394 Asf1b Rat carbamazepine affects expression ISO ASF1B (Homo sapiens) 6480464 Carbamazepine affects the expression of ASF1B mRNA CTD PMID:25979313 Asf1b Rat carbon nanotube increases expression ISO Asf1b (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Asf1b Rat cefaloridine increases expression EXP 6480464 Cephaloridine results in increased expression of ASF1B mRNA CTD PMID:18500788 Asf1b Rat CGP 52608 multiple interactions ISO ASF1B (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to ASF1B gene] CTD PMID:28238834 Asf1b Rat choline multiple interactions ISO Asf1b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of ASF1B more ... CTD PMID:20938992 Asf1b Rat chromium(6+) multiple interactions ISO ASF1B (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of ASF1B mRNA CTD PMID:38479592 Asf1b Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of ASF1B mRNA CTD PMID:22023808 Asf1b Rat cisplatin increases expression ISO ASF1B (Homo sapiens) 6480464 Cisplatin results in increased expression of ASF1B mRNA CTD PMID:27594783 and PMID:38498338 Asf1b Rat clofibrate multiple interactions ISO Asf1b (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ASF1B mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ASF1B mRNA] CTD PMID:17585979 Asf1b Rat cobalt dichloride decreases expression ISO ASF1B (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ASF1B mRNA CTD PMID:19320972 and PMID:19376846 Asf1b Rat cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of ASF1B mRNA CTD PMID:24386269 Asf1b Rat copper atom multiple interactions ISO ASF1B (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of ASF1B mRNA CTD PMID:20971185 Asf1b Rat copper(0) multiple interactions ISO ASF1B (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of ASF1B mRNA CTD PMID:20971185 Asf1b Rat coumestrol increases expression ISO ASF1B (Homo sapiens) 6480464 Coumestrol results in increased expression of ASF1B mRNA CTD PMID:19167446 Asf1b Rat coumestrol multiple interactions ISO ASF1B (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Asf1b Rat cyclosporin A decreases expression ISO ASF1B (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ASF1B mRNA CTD PMID:19159671 more ... Asf1b Rat DDE increases expression ISO ASF1B (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of ASF1B mRNA CTD PMID:38568856 Asf1b Rat deguelin decreases expression ISO ASF1B (Homo sapiens) 6480464 deguelin results in decreased expression of ASF1B mRNA CTD PMID:33512557 Asf1b Rat dibenz[a,h]anthracene increases expression ISO Asf1b (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Asf1b Rat dibutyl phthalate decreases expression ISO Asf1b (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of ASF1B mRNA CTD PMID:17361019 and PMID:21266533 Asf1b Rat dibutyl phthalate increases expression ISO ASF1B (Homo sapiens) 6480464 Dibutyl Phthalate results in increased expression of ASF1B mRNA CTD PMID:36828243 Asf1b Rat dibutyl phthalate multiple interactions ISO ASF1B (Homo sapiens) 6480464 N-methyl-delta-3 more ... CTD PMID:36828243 Asf1b Rat diethyl malate increases expression ISO ASF1B (Homo sapiens) 6480464 diethyl malate results in increased expression of ASF1B mRNA CTD PMID:38498338 Asf1b Rat diethyl maleate increases expression EXP 6480464 diethyl maleate results in increased expression of ASF1B mRNA CTD PMID:21161181 Asf1b Rat dioxygen decreases expression ISO ASF1B (Homo sapiens) 6480464 Oxygen deficiency results in decreased expression of ASF1B mRNA CTD PMID:26516004 Asf1b Rat doxorubicin decreases expression ISO ASF1B (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ASF1B mRNA CTD PMID:30031762 Asf1b Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of ASF1B mRNA CTD PMID:29391264 Asf1b Rat Enterolactone multiple interactions ISO ASF1B (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of ASF1B mRNA CTD PMID:19167446 Asf1b Rat epoxiconazole increases expression ISO Asf1b (Mus musculus) 6480464 epoxiconazole results in increased expression of ASF1B mRNA CTD PMID:35436446 Asf1b Rat flusilazole affects expression ISO Asf1b (Mus musculus) 6480464 flusilazole affects the expression of ASF1B mRNA CTD PMID:21195148 Asf1b Rat folic acid multiple interactions ISO Asf1b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of ASF1B more ... CTD PMID:20938992 Asf1b Rat folic acid decreases expression ISO Asf1b (Mus musculus) 6480464 Folic Acid results in decreased expression of ASF1B mRNA CTD PMID:25629700 Asf1b Rat folic acid multiple interactions ISO ASF1B (Homo sapiens) 6480464 [Folic Acid deficiency co-treated with Methotrexate] results in decreased expression of ASF1B mRNA CTD PMID:24657277 Asf1b Rat furan increases expression EXP 6480464 furan results in increased expression of ASF1B mRNA CTD PMID:25539665 Asf1b Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of ASF1B mRNA CTD PMID:33387578 Asf1b Rat hexaconazole affects expression ISO Asf1b (Mus musculus) 6480464 hexaconazole affects the expression of ASF1B mRNA CTD PMID:21195148 Asf1b Rat ivermectin decreases expression ISO ASF1B (Homo sapiens) 6480464 Ivermectin results in decreased expression of ASF1B protein CTD PMID:32959892 Asf1b Rat L-methionine multiple interactions ISO Asf1b (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of and results in increased expression of ASF1B more ... CTD PMID:20938992 Asf1b Rat leflunomide decreases expression ISO ASF1B (Homo sapiens) 6480464 leflunomide results in decreased expression of ASF1B mRNA CTD PMID:28988120 Asf1b Rat manganese atom multiple interactions ISO ASF1B (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ASF1B mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ASF1B mRNA CTD PMID:39836092 Asf1b Rat manganese(0) multiple interactions ISO ASF1B (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ASF1B mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ASF1B mRNA CTD PMID:39836092 Asf1b Rat manganese(II) chloride multiple interactions ISO ASF1B (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ASF1B mRNA and [manganese chloride results in increased abundance of Manganese] which results in decreased expression of ASF1B mRNA CTD PMID:39836092 Asf1b Rat methapyrilene decreases methylation ISO ASF1B (Homo sapiens) 6480464 Methapyrilene results in decreased methylation of ASF1B intron CTD PMID:30157460 Asf1b Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of ASF1B mRNA CTD PMID:30047161 Asf1b Rat methotrexate decreases expression ISO ASF1B (Homo sapiens) 6480464 Methotrexate results in decreased expression of ASF1B mRNA CTD PMID:24657277 Asf1b Rat methotrexate multiple interactions ISO ASF1B (Homo sapiens) 6480464 [Folic Acid deficiency co-treated with Methotrexate] results in decreased expression of ASF1B mRNA CTD PMID:24657277 Asf1b Rat N-methyl-4-phenylpyridinium decreases expression ISO ASF1B (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of ASF1B mRNA CTD PMID:24810058 Asf1b Rat N-nitrosodiethylamine increases expression ISO Asf1b (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of ASF1B mRNA CTD PMID:17854601 Asf1b Rat N-nitrosodiethylamine multiple interactions ISO Asf1b (Mus musculus) 6480464 RB1 protein inhibits the reaction [Diethylnitrosamine results in increased expression of ASF1B mRNA] CTD PMID:17854601 Asf1b Rat nickel atom increases expression ISO ASF1B (Homo sapiens) 6480464 Nickel results in increased expression of ASF1B mRNA CTD PMID:25583101 Asf1b Rat niclosamide decreases expression ISO ASF1B (Homo sapiens) 6480464 Niclosamide results in decreased expression of ASF1B mRNA CTD PMID:28284560 Asf1b Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of ASF1B mRNA CTD PMID:25729387 Asf1b Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ASF1B mRNA CTD PMID:25729387 Asf1b Rat ozone multiple interactions ISO Asf1b (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of ASF1B mRNA more ... CTD PMID:19555225 more ... Asf1b Rat palbociclib decreases expression ISO ASF1B (Homo sapiens) 6480464 palbociclib results in decreased expression of ASF1B mRNA CTD PMID:22869556 Asf1b Rat paracetamol multiple interactions ISO Asf1b (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of ASF1B mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of ASF1B mRNA] CTD PMID:17585979 Asf1b Rat paracetamol increases expression ISO ASF1B (Homo sapiens) 6480464 Acetaminophen results in increased expression of ASF1B mRNA CTD PMID:22230336 Asf1b Rat paraquat decreases expression ISO ASF1B (Homo sapiens) 6480464 Paraquat results in decreased expression of ASF1B mRNA CTD PMID:35182771 Asf1b Rat PCB138 multiple interactions ISO Asf1b (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Asf1b Rat perfluorooctanoic acid decreases expression ISO ASF1B (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of ASF1B mRNA CTD PMID:36326898 Asf1b Rat phenobarbital multiple interactions ISO Asf1b (Mus musculus) 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of ASF1B mRNA] CTD PMID:19482888 Asf1b Rat phenobarbital increases expression ISO Asf1b (Mus musculus) 6480464 Phenobarbital results in increased expression of ASF1B mRNA CTD PMID:19482888 more ... Asf1b Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of ASF1B mRNA CTD PMID:12832660 Asf1b Rat pirinixic acid multiple interactions ISO Asf1b (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in increased expression of ASF1B mRNA] CTD PMID:17950772 Asf1b Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of ASF1B mRNA CTD PMID:12832660 and PMID:19162173 Asf1b Rat pirinixic acid increases expression ISO Asf1b (Mus musculus) 6480464 pirinixic acid results in increased expression of ASF1B mRNA CTD PMID:17950772 and PMID:18301758 Asf1b Rat potassium dichromate increases expression ISO ASF1B (Homo sapiens) 6480464 Potassium Dichromate results in increased expression of ASF1B protein CTD PMID:23718831 Asf1b Rat pregnenolone 16alpha-carbonitrile increases expression ISO Asf1b (Mus musculus) 6480464 Pregnenolone Carbonitrile results in increased expression of ASF1B mRNA CTD PMID:22698814 Asf1b Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of ASF1B mRNA CTD PMID:30047161 Asf1b Rat propanal decreases expression ISO ASF1B (Homo sapiens) 6480464 propionaldehyde results in decreased expression of ASF1B mRNA CTD PMID:26079696 Asf1b Rat propiconazole increases expression EXP 6480464 propiconazole results in increased expression of ASF1B mRNA CTD PMID:30047161 Asf1b Rat quercetin increases expression ISO ASF1B (Homo sapiens) 6480464 Quercetin results in increased expression of ASF1B mRNA CTD PMID:21632981 Asf1b Rat resveratrol multiple interactions ISO ASF1B (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of ASF1B mRNA CTD PMID:19167446 Asf1b Rat rotenone decreases expression ISO ASF1B (Homo sapiens) 6480464 Rotenone results in decreased expression of ASF1B mRNA CTD PMID:33512557 Asf1b Rat silicon dioxide increases expression ISO Asf1b (Mus musculus) 6480464 Silicon Dioxide results in increased expression of ASF1B mRNA CTD PMID:29341224 Asf1b Rat sodium arsenite increases expression ISO ASF1B (Homo sapiens) 6480464 sodium arsenite results in increased expression of ASF1B mRNA CTD PMID:28595984 and PMID:29301061 Asf1b Rat sodium arsenite multiple interactions ISO ASF1B (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ASF1B mRNA more ... CTD PMID:33939924 and PMID:39836092 Asf1b Rat sodium arsenite affects expression ISO ASF1B (Homo sapiens) 6480464 sodium arsenite affects the expression of ASF1B mRNA CTD PMID:34032870 Asf1b Rat sodium arsenite decreases expression ISO ASF1B (Homo sapiens) 6480464 sodium arsenite results in decreased expression of ASF1B mRNA CTD PMID:38568856 Asf1b Rat sodium dichromate affects expression EXP 6480464 sodium bichromate affects the expression of ASF1B mRNA CTD PMID:22110744 Asf1b Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of ASF1B mRNA CTD PMID:30047161 Asf1b Rat sunitinib decreases expression ISO ASF1B (Homo sapiens) 6480464 Sunitinib results in decreased expression of ASF1B mRNA CTD PMID:31533062 Asf1b Rat tamoxifen affects expression ISO Asf1b (Mus musculus) 6480464 Tamoxifen affects the expression of ASF1B mRNA CTD PMID:17555576 Asf1b Rat tert-butyl hydroperoxide decreases expression ISO ASF1B (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of ASF1B mRNA CTD PMID:15336504 Asf1b Rat testosterone multiple interactions ISO ASF1B (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of ASF1B mRNA CTD PMID:21592394 Asf1b Rat testosterone decreases expression ISO ASF1B (Homo sapiens) 6480464 Testosterone results in decreased expression of ASF1B mRNA CTD PMID:21592394 Asf1b Rat tetrachloromethane increases expression ISO Asf1b (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of ASF1B mRNA CTD PMID:17484886 and PMID:31919559 Asf1b Rat thapsigargin decreases expression ISO ASF1B (Homo sapiens) 6480464 Thapsigargin results in decreased expression of ASF1B mRNA CTD PMID:22378314 Asf1b Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ASF1B mRNA CTD PMID:34492290 Asf1b Rat thiram decreases expression ISO ASF1B (Homo sapiens) 6480464 Thiram results in decreased expression of ASF1B mRNA CTD PMID:38568856 Asf1b Rat titanium dioxide increases expression ISO Asf1b (Mus musculus) 6480464 titanium dioxide results in increased expression of ASF1B mRNA CTD PMID:23557971 Asf1b Rat titanium dioxide decreases methylation ISO Asf1b (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ASF1B gene and titanium dioxide results in decreased methylation of ASF1B promoter CTD PMID:35295148 Asf1b Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of ASF1B mRNA CTD PMID:30012374 Asf1b Rat topotecan decreases expression EXP 6480464 Topotecan results in decreased expression of ASF1B mRNA CTD PMID:25729387 Asf1b Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of ASF1B mRNA CTD PMID:25729387 Asf1b Rat triadimefon affects expression ISO Asf1b (Mus musculus) 6480464 triadimefon affects the expression of ASF1B mRNA CTD PMID:21195148 Asf1b Rat trichloroethene increases expression ISO Asf1b (Mus musculus) 6480464 Trichloroethylene results in increased expression of ASF1B mRNA CTD PMID:25549359 Asf1b Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of ASF1B gene CTD PMID:27618143 Asf1b Rat trichostatin A affects expression ISO ASF1B (Homo sapiens) 6480464 trichostatin A affects the expression of ASF1B mRNA CTD PMID:28542535 Asf1b Rat triclosan decreases expression ISO ASF1B (Homo sapiens) 6480464 Triclosan results in decreased expression of ASF1B mRNA CTD PMID:30510588 Asf1b Rat trimellitic anhydride increases expression ISO Asf1b (Mus musculus) 6480464 trimellitic anhydride results in increased expression of ASF1B mRNA CTD PMID:19042947 Asf1b Rat triphenyl phosphate affects expression ISO ASF1B (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ASF1B mRNA CTD PMID:37042841 Asf1b Rat triptonide increases expression ISO Asf1b (Mus musculus) 6480464 triptonide results in increased expression of ASF1B mRNA CTD PMID:33045310 Asf1b Rat troglitazone increases expression ISO Asf1b (Mus musculus) 6480464 troglitazone results in increased expression of ASF1B mRNA CTD PMID:28973697 Asf1b Rat trovafloxacin decreases expression ISO Asf1b (Mus musculus) 6480464 trovafloxacin results in decreased expression of ASF1B mRNA CTD PMID:35537566 Asf1b Rat tunicamycin decreases expression ISO ASF1B (Homo sapiens) 6480464 Tunicamycin results in decreased expression of ASF1B mRNA CTD PMID:22378314 Asf1b Rat urethane increases expression ISO ASF1B (Homo sapiens) 6480464 Urethane results in increased expression of ASF1B mRNA CTD PMID:28818685 Asf1b Rat valproic acid decreases expression ISO Asf1b (Mus musculus) 6480464 Valproic Acid results in decreased expression of ASF1B mRNA CTD PMID:21427059 Asf1b Rat valproic acid increases expression ISO Asf1b (Mus musculus) 6480464 Valproic Acid results in increased expression of ASF1B mRNA CTD PMID:19136453 and PMID:21427059 Asf1b Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of ASF1B mRNA CTD PMID:23555832
1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-diaminotoluene (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP,ISO) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) benzo[b]fluoranthene (ISO) benzo[e]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbamazepine (ISO) carbon nanotube (ISO) cefaloridine (EXP) CGP 52608 (ISO) choline (ISO) chromium(6+) (ISO) cisplatin (EXP,ISO) clofibrate (ISO) cobalt dichloride (EXP,ISO) copper atom (ISO) copper(0) (ISO) coumestrol (ISO) cyclosporin A (ISO) DDE (ISO) deguelin (ISO) dibenz[a,h]anthracene (ISO) dibutyl phthalate (ISO) diethyl malate (ISO) diethyl maleate (EXP) dioxygen (ISO) doxorubicin (ISO) endosulfan (EXP) Enterolactone (ISO) epoxiconazole (ISO) flusilazole (ISO) folic acid (ISO) furan (EXP) gentamycin (EXP) hexaconazole (ISO) ivermectin (ISO) L-methionine (ISO) leflunomide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methapyrilene (ISO) methimazole (EXP) methotrexate (ISO) N-methyl-4-phenylpyridinium (ISO) N-nitrosodiethylamine (ISO) nickel atom (ISO) niclosamide (ISO) oxaliplatin (EXP) ozone (ISO) palbociclib (ISO) paracetamol (ISO) paraquat (ISO) PCB138 (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP,ISO) pirinixic acid (EXP,ISO) potassium dichromate (ISO) pregnenolone 16alpha-carbonitrile (EXP,ISO) propanal (ISO) propiconazole (EXP) quercetin (ISO) resveratrol (ISO) rotenone (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (EXP) sulfadimethoxine (EXP) sunitinib (ISO) tamoxifen (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (EXP,ISO) topotecan (EXP) triadimefon (ISO) trichloroethene (EXP,ISO) trichostatin A (ISO) triclosan (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) troglitazone (ISO) trovafloxacin (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
Asf1b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 19 41,085,786 - 41,100,352 (-) NCBI GRCr8 mRatBN7.2 19 24,181,024 - 24,195,604 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 19 24,181,028 - 24,195,549 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 19 31,002,160 - 31,016,725 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 19 31,656,566 - 31,671,131 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 19 33,879,281 - 33,893,844 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 19 25,077,918 - 25,092,491 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 19 25,077,918 - 25,092,491 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 19 36,055,967 - 36,070,506 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 19 25,867,384 - 25,881,909 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 19 25,872,530 - 25,887,149 (-) NCBI Celera 19 23,729,321 - 23,743,692 (-) NCBI Celera Cytogenetic Map 19 q11 NCBI
ASF1B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 14,119,512 - 14,136,589 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 14,119,512 - 14,136,613 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 14,230,324 - 14,247,401 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 14,091,321 - 14,108,440 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 14,091,342 - 14,108,429 NCBI Celera 19 14,124,596 - 14,141,712 (-) NCBI Celera Cytogenetic Map 19 p13.12 NCBI HuRef 19 13,801,888 - 13,818,881 (-) NCBI HuRef CHM1_1 19 14,230,740 - 14,247,871 (-) NCBI CHM1_1 T2T-CHM13v2.0 19 14,246,124 - 14,263,201 (-) NCBI T2T-CHM13v2.0
Asf1b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 84,682,323 - 84,696,824 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 84,682,136 - 84,696,826 (+) Ensembl GRCm39 Ensembl GRCm38 8 83,955,694 - 83,970,195 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 83,955,507 - 83,970,197 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 86,479,593 - 86,494,094 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 86,845,799 - 86,860,300 (+) NCBI MGSCv36 mm8 Celera 8 88,249,392 - 88,263,700 (+) NCBI Celera Cytogenetic Map 8 C2 NCBI cM Map 8 40.22 NCBI
Asf1b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 32,817,547 - 32,828,651 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 32,818,592 - 32,828,651 (-) NCBI ChiLan1.0 ChiLan1.0
ASF1B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 19,051,940 - 19,069,654 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 18,053,309 - 18,071,364 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 13,685,617 - 13,702,367 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 14,411,127 - 14,428,508 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 19 14,411,127 - 14,428,917 (-) Ensembl panpan1.1 panPan2
ASF1B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 48,398,615 - 48,406,889 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 48,272,803 - 48,281,403 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 48,916,074 - 48,924,671 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 48,916,420 - 48,924,670 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 48,127,279 - 48,135,878 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 48,553,848 - 48,562,442 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 48,796,639 - 48,805,239 (+) NCBI UU_Cfam_GSD_1.0
Asf1b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 207,571,966 - 207,582,396 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936659 2,770,900 - 2,782,748 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936659 2,772,310 - 2,782,687 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ASF1B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 65,062,766 - 65,072,679 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 65,063,186 - 65,072,681 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 65,338,722 - 65,348,216 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ASF1B
Asf1b
.
Predicted Target Of
Count of predictions: 113 Count of miRNA genes: 83 Interacting mature miRNAs: 103 Transcripts: ENSRNOT00000006964 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1549847 Bss8 Bone structure and strength QTL 8 4 lumbar vertebra strength trait (VT:0010574) vertebra ultimate force (CMO:0001678) 19 1 31963836 Rat 61447 Tcas1 Tongue tumor susceptibility QTL 1 6.08 tongue integrity trait (VT:0010553) squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875) 19 2316121 47316121 Rat 631681 Cm12 Cardiac mass QTL 12 3.33 0.00053 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 19 1 28982497 Rat 9590298 Uminl5 Urine mineral level QTL 5 3.59 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 19 1 36824771 Rat 1331737 Uae29 Urinary albumin excretion QTL 29 5.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 4096155 55283277 Rat 2298478 Eau8 Experimental allergic uveoretinitis QTL 8 0.0163 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 19 17154433 57337602 Rat 1578764 Stresp19 Stress response QTL 19 3.6 0.001 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 19 15630201 57337602 Rat 1558656 Prcs1 Prostate cancer susceptibility QTL 1 5 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 19 15114598 34521833 Rat 9590090 Insglur8 Insulin/glucose ratio QTL 8 10.81 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 19 1 36824771 Rat 1331788 Rf45 Renal function QTL 45 2.818 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 19 15605023 46559041 Rat 724566 Uae12 Urinary albumin excretion QTL 12 5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 19 2187927 56457239 Rat 724565 Tcas5 Tongue tumor susceptibility QTL 5 10.04 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 19 9977753 39654489 Rat 61407 Scl12 Serum cholesterol level QTL 12 0.001 blood HDL cholesterol amount (VT:0000184) serum high density lipoprotein cholesterol level (CMO:0000361) 19 13926401 30303727 Rat 8552935 Pigfal10 Plasma insulin-like growth factor 1 level QTL 10 5.7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 19 1 36824771 Rat 61350 Bp32 Blood pressure QTL 32 0.012 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 19 20483575 57337602 Rat 7411549 Bw130 Body weight QTL 130 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 15455860 57337602 Rat 10054132 Srcrt9 Stress Responsive Cort QTL 9 2.87 0.0017 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 27355345 Rat 724518 Uae19 Urinary albumin excretion QTL 19 5.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 7457249 42983518 Rat 8694186 Bw152 Body weight QTL 152 3.34 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 19 569374 45569374 Rat 61423 Cia14 Collagen induced arthritis QTL 14 3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 19 10827970 43544039 Rat 7411590 Foco7 Food consumption QTL 7 6.8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 19 1 24688055 Rat 631678 Cm9 Cardiac mass QTL 9 4.27 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 19 1 28982497 Rat 9590250 Scort11 Serum corticosterone level QTL 11 23.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 19 1 36824771 Rat 2317848 Alcrsp21 Alcohol response QTL 21 1.899999976158142 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 19 3204777 48204777 Rat 9589102 Slep13 Serum leptin concentration QTL 13 4.63 0.001 blood leptin amount (VT:0005667) plasma leptin level (CMO:0000781) 19 569374 45569374 Rat 7247442 Uae39 Urinary albumin excretion QTL 39 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 19 2187927 46708701 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
90
89
58
25
58
6
217
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000006964 ⟹ ENSRNOP00000006964
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 24,181,028 - 24,195,541 (-) Ensembl Rnor_6.0 Ensembl 19 25,077,918 - 25,092,491 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000115185 ⟹ ENSRNOP00000082301
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 19 24,181,028 - 24,195,549 (-) Ensembl
RefSeq Acc Id:
NM_001107160 ⟹ NP_001100630
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 41,085,788 - 41,100,352 (-) NCBI mRatBN7.2 19 24,181,028 - 24,195,594 (-) NCBI Rnor_6.0 19 25,077,918 - 25,092,491 (+) NCBI Rnor_5.0 19 36,055,967 - 36,070,506 (+) NCBI RGSC_v3.4 19 25,867,384 - 25,881,909 (-) RGD Celera 19 23,729,321 - 23,743,692 (-) RGD
Sequence:
TGGAGGGCGGAGCCGGCTATTTGAAGGGAGCGCGCTTACGGGAGAAGCTCTTCGGAAAGAAGAGTTGGGAATCAGTGCGAGCTTTCTGTCCTGCCGACCCCCTTCTTCTCTGTAGCAAGTCACGGAAG
hide sequence
RefSeq Acc Id:
XM_039097681 ⟹ XP_038953609
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 19 41,085,786 - 41,100,202 (-) NCBI mRatBN7.2 19 24,181,024 - 24,195,594 (-) NCBI
RefSeq Acc Id:
NP_001100630 ⟸ NM_001107160
- UniProtKB:
B0BN69 (UniProtKB/TrEMBL), A6IYC4 (UniProtKB/TrEMBL), F7EWU6 (UniProtKB/TrEMBL), A0A8I5ZUP3 (UniProtKB/TrEMBL)
- Sequence:
MAKVSVLNVAVLENPSPFHSPFRFEISFECSEALSDDLEWKIIYVGSAESEEFDQILDSVLVGPVPAGRHMFVFQADAPNPSLIPETDAVGVTVVLITCTYHGQEFIRVGYYVNNEYPDPELRENPPP
hide sequence
Ensembl Acc Id:
ENSRNOP00000006964 ⟸ ENSRNOT00000006964
RefSeq Acc Id:
XP_038953609 ⟸ XM_039097681
- Peptide Label:
isoform X1
Ensembl Acc Id:
ENSRNOP00000082301 ⟸ ENSRNOT00000115185
RGD ID: 13701006 Promoter ID: EPDNEW_R11530 Type: initiation region Name: Asf1b_1 Description: anti-silencing function 1B histone chaperone SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 19 25,077,971 - 25,078,031 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-09-12
Asf1b
anti-silencing function 1B histone chaperone
Asf1b
ASF1 anti-silencing function 1 homolog B (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Asf1b
ASF1 anti-silencing function 1 homolog B (S. cerevisiae)
Asf1b_predicted
ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Asf1b_predicted
ASF1 anti-silencing function 1 homolog B (S. cerevisiae) (predicted)
Symbol and Name status set to approved
70820 APPROVED
