Symbol:
Jam3
Name:
junctional adhesion molecule 3
RGD ID:
1303248
Description:
Predicted to enable cell-cell adhesion mediator activity; identical protein binding activity; and integrin binding activity. Involved in axon regeneration. Predicted to be located in several cellular components, including Schmidt-Lanterman incisure; bicellular tight junction; and paranodal junction. Predicted to be part of filamentous actin and protein complex involved in cell adhesion. Predicted to be active in cell-cell contact zone and plasma membrane. Biomarker of sciatic neuropathy. Orthologous to human JAM3 (junctional adhesion molecule 3); INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 3,3',4,4',5-pentachlorobiphenyl.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
JAM-3; JAM-C; junctional adhesion molecule C; MGC94974
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
JAM3 (junctional adhesion molecule 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Jam3 (junction adhesion molecule 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Jam3 (junctional adhesion molecule 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
JAM3 (junctional adhesion molecule 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
JAM3 (junctional adhesion molecule 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Jam3 (junctional adhesion molecule 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
JAM3 (junctional adhesion molecule 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
JAM3 (junctional adhesion molecule 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Jam3 (junctional adhesion molecule 3) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
STX7 (syntaxin 7) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
JAM3 (junctional adhesion molecule 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Jam3 (junction adhesion molecule 3)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
jam3b (junctional adhesion molecule 3b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
jam3a (junctional adhesion molecule 3a)
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
jam3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 33,767,606 - 33,828,451 (-) NCBI GRCr8 mRatBN7.2 8 25,508,461 - 25,569,306 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 25,507,057 - 25,569,355 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 29,550,421 - 29,611,261 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 27,844,708 - 27,905,552 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 25,724,719 - 25,785,571 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 28,147,110 - 28,208,466 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 28,147,111 - 28,208,466 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 28,166,275 - 28,227,631 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 26,697,127 - 26,758,579 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 26,697,127 - 26,758,579 (-) NCBI Celera 8 26,995,820 - 27,056,659 (-) NCBI Celera Cytogenetic Map 8 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Jam3 Rat 1,1-dichloroethene decreases expression ISO Jam3 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of JAM3 mRNA CTD PMID:26682919 Jam3 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of JAM3 mRNA CTD PMID:30723492 Jam3 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of JAM3 mRNA CTD PMID:21215274 Jam3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of JAM3 mRNA CTD PMID:33387578 Jam3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of JAM3 mRNA CTD PMID:34747641 Jam3 Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Jam3 Rat 3,3',4,4'-tetrachlorobiphenyl multiple interactions ISO Jam3 (Mus musculus) 6480464 3 more ... CTD PMID:19467301 Jam3 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO JAM3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of JAM3 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of JAM3 mRNA CTD PMID:28628672 Jam3 Rat 4,4'-sulfonyldiphenol increases expression ISO Jam3 (Mus musculus) 6480464 bisphenol S results in increased expression of JAM3 mRNA CTD PMID:30951980 Jam3 Rat 4-hydroxyphenyl retinamide increases expression ISO Jam3 (Mus musculus) 6480464 Fenretinide results in increased expression of JAM3 mRNA CTD PMID:28973697 Jam3 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of JAM3 mRNA CTD PMID:24780913 and PMID:36843608 Jam3 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of JAM3 mRNA CTD PMID:31881176 Jam3 Rat acetohydrazide decreases expression ISO Jam3 (Mus musculus) 6480464 acetylhydrazine results in decreased expression of JAM3 mRNA CTD PMID:15282401 Jam3 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of JAM3 protein CTD PMID:33236894 Jam3 Rat acrylamide increases expression ISO JAM3 (Homo sapiens) 6480464 Acrylamide results in increased expression of JAM3 mRNA CTD PMID:32763439 Jam3 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of JAM3 mRNA CTD PMID:23385219 more ... Jam3 Rat aflatoxin B1 increases methylation ISO JAM3 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of JAM3 intron CTD PMID:30157460 Jam3 Rat anthracen-2-amine increases expression EXP 6480464 2-anthramine results in increased expression of JAM3 mRNA CTD PMID:23038007 Jam3 Rat aristolochic acid A decreases expression ISO JAM3 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of JAM3 mRNA CTD PMID:33212167 Jam3 Rat arsane multiple interactions ISO JAM3 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of JAM3 mRNA CTD PMID:32525701 Jam3 Rat arsenic atom multiple interactions ISO JAM3 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of JAM3 mRNA CTD PMID:32525701 Jam3 Rat Azoxymethane multiple interactions ISO Jam3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of JAM3 mRNA CTD PMID:29950665 Jam3 Rat benzatropine multiple interactions ISO JAM3 (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of JAM3 protein CTD PMID:34122009 Jam3 Rat benzo[a]pyrene increases expression ISO Jam3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of JAM3 mRNA CTD PMID:22228805 Jam3 Rat benzo[a]pyrene increases methylation ISO JAM3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of JAM3 exon CTD PMID:27901495 Jam3 Rat benzo[a]pyrene decreases methylation ISO Jam3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of JAM3 exon and Benzo(a)pyrene results in decreased methylation of JAM3 intron CTD PMID:27901495 Jam3 Rat benzo[a]pyrene affects methylation ISO JAM3 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of JAM3 promoter CTD PMID:27901495 Jam3 Rat benzo[a]pyrene increases expression ISO JAM3 (Homo sapiens) 6480464 Benzo(a)pyrene metabolite results in increased expression of JAM3 mRNA CTD PMID:26314263 Jam3 Rat benzo[a]pyrene decreases expression ISO Jam3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of JAM3 mRNA CTD PMID:23735875 Jam3 Rat benzo[e]pyrene increases methylation ISO JAM3 (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of JAM3 intron CTD PMID:30157460 Jam3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Jam3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of JAM3 mRNA CTD PMID:33754040 Jam3 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of JAM3 mRNA CTD PMID:25181051 Jam3 Rat bisphenol A increases expression ISO Jam3 (Mus musculus) 6480464 bisphenol A results in increased expression of JAM3 mRNA CTD PMID:30951980 Jam3 Rat bisphenol A multiple interactions ISO JAM3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of JAM3 gene and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of JAM3 mRNA CTD PMID:28628672 and PMID:31601247 Jam3 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of JAM3 gene CTD PMID:28505145 Jam3 Rat bisphenol F multiple interactions ISO JAM3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of JAM3 mRNA CTD PMID:28628672 Jam3 Rat bisphenol F increases expression ISO Jam3 (Mus musculus) 6480464 bisphenol F results in increased expression of JAM3 mRNA CTD PMID:30951980 Jam3 Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of JAM3 promoter CTD PMID:22457795 Jam3 Rat cadmium dichloride increases expression ISO JAM3 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of JAM3 mRNA CTD PMID:25851441 Jam3 Rat clobetasol increases expression ISO Jam3 (Mus musculus) 6480464 Clobetasol results in increased expression of JAM3 mRNA CTD PMID:27462272 Jam3 Rat cobalt dichloride increases expression ISO JAM3 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of JAM3 mRNA CTD PMID:26314263 Jam3 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of JAM3 mRNA CTD PMID:26577399 Jam3 Rat Cuprizon multiple interactions ISO JAM3 (Homo sapiens) 6480464 [Cuprizone co-treated with Benztropine] results in decreased expression of JAM3 protein CTD PMID:34122009 Jam3 Rat dexamethasone increases expression ISO JAM3 (Homo sapiens) 6480464 Dexamethasone results in increased expression of JAM3 mRNA CTD PMID:12782123 Jam3 Rat dexamethasone multiple interactions ISO JAM3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of JAM3 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of JAM3 mRNA CTD PMID:28628672 Jam3 Rat dextran sulfate multiple interactions ISO Jam3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of JAM3 mRNA CTD PMID:29950665 Jam3 Rat Dibutyl phosphate affects expression ISO JAM3 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of JAM3 mRNA CTD PMID:37042841 Jam3 Rat diethyl maleate decreases expression EXP 6480464 diethyl maleate results in decreased expression of JAM3 mRNA CTD PMID:21161181 Jam3 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of JAM3 mRNA CTD PMID:29391264 Jam3 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of JAM3 mRNA CTD PMID:31464424 Jam3 Rat epoxiconazole decreases expression ISO Jam3 (Mus musculus) 6480464 epoxiconazole results in decreased expression of JAM3 mRNA CTD PMID:35436446 Jam3 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of JAM3 mRNA CTD PMID:31881178 Jam3 Rat fonofos increases methylation ISO JAM3 (Homo sapiens) 6480464 Fonofos results in increased methylation of JAM3 promoter CTD PMID:22847954 Jam3 Rat FR900359 decreases phosphorylation ISO JAM3 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of JAM3 protein CTD PMID:37730182 Jam3 Rat fulvestrant multiple interactions ISO JAM3 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of JAM3 gene CTD PMID:31601247 Jam3 Rat gemcitabine decreases expression ISO JAM3 (Homo sapiens) 6480464 Gemcitabine results in decreased expression of JAM3 mRNA CTD PMID:17039268 Jam3 Rat Heliotrine increases expression EXP 6480464 heliotrine results in increased expression of JAM3 mRNA CTD PMID:32419051 Jam3 Rat indometacin multiple interactions ISO JAM3 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of JAM3 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of JAM3 mRNA CTD PMID:28628672 Jam3 Rat Lasiocarpine increases expression EXP 6480464 lasiocarpine results in increased expression of JAM3 mRNA CTD PMID:32419051 Jam3 Rat lead(0) affects expression ISO JAM3 (Homo sapiens) 6480464 Lead affects the expression of JAM3 mRNA CTD PMID:28903495 Jam3 Rat methapyrilene increases methylation ISO JAM3 (Homo sapiens) 6480464 Methapyrilene results in increased methylation of JAM3 intron CTD PMID:30157460 Jam3 Rat methylmercury(1+) increases expression ISO JAM3 (Homo sapiens) 6480464 methylmercury II results in increased expression of JAM3 mRNA CTD PMID:26314263 Jam3 Rat N(4)-hydroxycytidine decreases expression ISO Jam3 (Mus musculus) 6480464 N(4)-hydroxycytidine results in decreased expression of JAM3 mRNA CTD PMID:37748715 Jam3 Rat Nor-9-carboxy-delta9-THC multiple interactions ISO JAM3 (Homo sapiens) 6480464 [Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of JAM3 gene CTD PMID:30521419 Jam3 Rat ochratoxin A increases expression ISO JAM3 (Homo sapiens) 6480464 ochratoxin A metabolite results in increased expression of JAM3 mRNA and ochratoxin A results in increased expression of JAM3 mRNA CTD PMID:26314263 Jam3 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of JAM3 mRNA CTD PMID:25729387 Jam3 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of JAM3 mRNA CTD PMID:25729387 Jam3 Rat ozone increases expression ISO JAM3 (Homo sapiens) 6480464 Ozone results in increased expression of JAM3 mRNA CTD PMID:31476115 Jam3 Rat ozone increases expression EXP 6480464 Ozone results in increased expression of JAM3 mRNA CTD PMID:35737395 Jam3 Rat paracetamol affects expression ISO Jam3 (Mus musculus) 6480464 Acetaminophen affects the expression of JAM3 mRNA CTD PMID:17562736 Jam3 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of JAM3 mRNA CTD PMID:33387578 Jam3 Rat parathion increases methylation ISO JAM3 (Homo sapiens) 6480464 Parathion results in increased methylation of JAM3 promoter CTD PMID:22847954 Jam3 Rat perfluorohexanesulfonic acid increases expression ISO Jam3 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of JAM3 mRNA CTD PMID:37995155 Jam3 Rat perfluorooctanoic acid decreases expression ISO JAM3 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of JAM3 mRNA CTD PMID:23146750 Jam3 Rat senecionine increases expression EXP 6480464 senecionine results in increased expression of JAM3 mRNA CTD PMID:32419051 Jam3 Rat sodium arsenate multiple interactions ISO JAM3 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of JAM3 mRNA CTD PMID:32525701 Jam3 Rat sodium arsenite decreases methylation ISO Jam3 (Mus musculus) 6480464 sodium arsenite results in decreased methylation of JAM3 gene CTD PMID:32068019 Jam3 Rat T-2 toxin decreases expression ISO JAM3 (Homo sapiens) 6480464 T-2 Toxin results in decreased expression of JAM3 mRNA CTD PMID:31863870 Jam3 Rat tamoxifen decreases expression ISO Jam3 (Mus musculus) 6480464 Tamoxifen results in decreased expression of JAM3 mRNA CTD PMID:17555576 Jam3 Rat terbufos increases methylation ISO JAM3 (Homo sapiens) 6480464 terbufos results in increased methylation of JAM3 promoter CTD PMID:22847954 Jam3 Rat tert-butyl hydroperoxide increases expression ISO Jam3 (Mus musculus) 6480464 tert-Butylhydroperoxide results in increased expression of JAM3 mRNA CTD PMID:14729362 Jam3 Rat tetrachloromethane affects expression ISO Jam3 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of JAM3 mRNA CTD PMID:17484886 Jam3 Rat thioacetamide affects expression EXP 6480464 Thioacetamide affects the expression of JAM3 mRNA CTD PMID:34492290 Jam3 Rat titanium dioxide multiple interactions ISO Jam3 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of JAM3 mRNA CTD PMID:29950665 Jam3 Rat titanium dioxide decreases methylation ISO Jam3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of JAM3 gene CTD PMID:35295148 Jam3 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of JAM3 mRNA CTD PMID:25729387 Jam3 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of JAM3 mRNA CTD PMID:25729387 Jam3 Rat tributylstannane increases expression ISO JAM3 (Homo sapiens) 6480464 tributyltin results in increased expression of JAM3 mRNA CTD PMID:26314263 Jam3 Rat Tributyltin oxide increases expression ISO JAM3 (Homo sapiens) 6480464 bis(tri-n-butyltin)oxide results in increased expression of JAM3 mRNA CTD PMID:26314263 Jam3 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of JAM3 mRNA CTD PMID:33387578 Jam3 Rat triclosan decreases expression ISO JAM3 (Homo sapiens) 6480464 Triclosan results in decreased expression of JAM3 mRNA CTD PMID:30510588 Jam3 Rat trimellitic anhydride decreases expression ISO Jam3 (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of JAM3 mRNA CTD PMID:19042947 Jam3 Rat triphenyl phosphate affects expression ISO JAM3 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of JAM3 mRNA CTD PMID:37042841 Jam3 Rat triptonide increases expression ISO Jam3 (Mus musculus) 6480464 triptonide results in increased expression of JAM3 mRNA CTD PMID:33045310 Jam3 Rat tunicamycin increases expression ISO Jam3 (Mus musculus) 6480464 Tunicamycin results in increased expression of JAM3 mRNA CTD PMID:17127020 Jam3 Rat urethane increases expression ISO JAM3 (Homo sapiens) 6480464 Urethane results in increased expression of JAM3 mRNA CTD PMID:28818685 Jam3 Rat valproic acid affects expression ISO JAM3 (Homo sapiens) 6480464 Valproic Acid affects the expression of JAM3 mRNA CTD PMID:25979313 Jam3 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of JAM3 mRNA CTD PMID:23034163
1,1-dichloroethene (ISO) 1-naphthyl isothiocyanate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',4,4'-tetrachlorobiphenyl (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acetohydrazide (ISO) aconitine (EXP) acrylamide (ISO) aflatoxin B1 (EXP,ISO) anthracen-2-amine (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) Azoxymethane (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) cadmium dichloride (EXP,ISO) clobetasol (ISO) cobalt dichloride (ISO) Cuprizon (EXP,ISO) dexamethasone (ISO) dextran sulfate (ISO) Dibutyl phosphate (ISO) diethyl maleate (EXP) endosulfan (EXP) epoxiconazole (ISO) fipronil (EXP) fonofos (ISO) FR900359 (ISO) fulvestrant (ISO) gemcitabine (ISO) Heliotrine (EXP) indometacin (ISO) Lasiocarpine (EXP) lead(0) (ISO) methapyrilene (ISO) methylmercury(1+) (ISO) N(4)-hydroxycytidine (ISO) Nor-9-carboxy-delta9-THC (ISO) ochratoxin A (ISO) oxaliplatin (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) parathion (ISO) perfluorohexanesulfonic acid (ISO) perfluorooctanoic acid (ISO) senecionine (EXP) sodium arsenate (ISO) sodium arsenite (ISO) T-2 toxin (ISO) tamoxifen (ISO) terbufos (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) tributylstannane (ISO) Tributyltin oxide (ISO) trichloroethene (EXP) triclosan (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
Biological Process
adaptive immune response (ISO) adherens junction assembly (IEA,ISO) angiogenesis (IEA,ISO) apical protein localization (IEA,ISO) axon regeneration (IEP) cell adhesion (IEA,ISO) cell differentiation (IEA) cell migration (IBA,ISO) cell-cell adhesion (IBA,IEA,ISO) cell-matrix adhesion (ISO) establishment of cell polarity (ISO) granulocyte migration (IEA,ISO) hematopoietic stem cell migration to bone marrow (IEA,ISO) heterotypic cell-cell adhesion (IEA,ISO) leukocyte migration involved in inflammatory response (ISO) myelination (ISO) myeloid progenitor cell differentiation (ISO) negative regulation of cell adhesion mediated by integrin (IEA,ISO) negative regulation of integrin activation (IEA,ISO) neutrophil homeostasis (ISO) positive regulation of membrane permeability (IEA,ISO) positive regulation of monocyte extravasation (IEA,ISO) protein localization to cell junction (IEA,ISO) protein localization to cell surface (IEA,ISO) regulation of actin cytoskeleton organization by cell-cell adhesion (ISO) regulation of neutrophil chemotaxis (IEA,ISO) spermatid development (ISO) spermatogenesis (IEA,ISO) transmission of nerve impulse (ISO)
Cellular Component
anchoring junction (IEA) bicellular tight junction (IEA,ISO,ISS) cell-cell contact zone (IBA,IEA,ISO) cell-cell junction (IEA,ISO) desmosome (IEA,ISO) extracellular region (IEA) extracellular space (IEA,ISO) filamentous actin (IEA,ISO) Golgi apparatus (IEA,ISO) membrane (IEA) microvillus (IEA,ISO) paranodal junction (ISO) plasma membrane (IBA,IEA,ISO,ISS) protein complex involved in cell adhesion (IBA,IEA,ISO,ISS) Schmidt-Lanterman incisure (ISO) tight junction (IEA,ISO)
1.
The spatiotemporal localization of JAM-C following sciatic nerve crush in adult rats.
Avari P, etal., Brain Behav. 2012 Jul;2(4):402-14. doi: 10.1002/brb3.63.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Targeting of junctional adhesion molecule-C inhibits experimental choroidal neovascularization.
Hou X, etal., Invest Ophthalmol Vis Sci. 2012 Mar 21;53(3):1584-91. doi: 10.1167/iovs.11-9005. Print 2012 Mar.
4.
Antibody against junctional adhesion molecule-C inhibits angiogenesis and tumor growth.
Lamagna C, etal., Cancer Res. 2005 Jul 1;65(13):5703-10.
5.
Junctional adhesion molecules (JAM)-B and -C contribute to leukocyte extravasation to the skin and mediate cutaneous inflammation.
Ludwig RJ, etal., J Invest Dermatol. 2005 Nov;125(5):969-76.
6.
Differential expression of junctional adhesion molecules in different stages of systemic sclerosis.
Manetti M, etal., Arthritis Rheum. 2013 Jan;65(1):247-57. doi: 10.1002/art.37712.
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
The proadhesive phenotype of systemic sclerosis skin promotes myeloid cell adhesion via ICAM-1 and VCAM-1.
Rabquer BJ, etal., Rheumatology (Oxford). 2009 Jul;48(7):734-40. doi: 10.1093/rheumatology/kep091. Epub 2009 May 13.
9.
GOA pipeline
RGD automated data pipeline
10.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
12.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
Jam3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 33,767,606 - 33,828,451 (-) NCBI GRCr8 mRatBN7.2 8 25,508,461 - 25,569,306 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 25,507,057 - 25,569,355 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 29,550,421 - 29,611,261 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 27,844,708 - 27,905,552 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 25,724,719 - 25,785,571 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 28,147,110 - 28,208,466 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 28,147,111 - 28,208,466 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 28,166,275 - 28,227,631 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 26,697,127 - 26,758,579 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 26,697,127 - 26,758,579 (-) NCBI Celera 8 26,995,820 - 27,056,659 (-) NCBI Celera Cytogenetic Map 8 q13 NCBI
JAM3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 134,069,072 - 134,152,001 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 134,069,071 - 134,152,001 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 133,938,967 - 134,021,896 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 133,444,030 - 133,526,861 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 133,444,029 - 133,526,858 NCBI Celera 11 131,112,218 - 131,194,832 (+) NCBI Celera Cytogenetic Map 11 q25 NCBI HuRef 11 129,893,248 - 129,976,188 (+) NCBI HuRef CHM1_1 11 133,826,755 - 133,908,474 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 134,112,013 - 134,194,140 (+) NCBI T2T-CHM13v2.0
Jam3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 27,008,680 - 27,066,739 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 27,008,680 - 27,066,717 (-) Ensembl GRCm39 Ensembl GRCm38 9 27,097,384 - 27,155,421 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 27,097,384 - 27,155,421 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 26,904,969 - 26,962,965 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 26,846,830 - 26,904,826 (-) NCBI MGSCv36 mm8 Celera 9 24,355,390 - 24,413,352 (-) NCBI Celera Cytogenetic Map 9 A4 NCBI cM Map 9 12.27 NCBI
Jam3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 34,901,681 - 34,967,394 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 34,901,850 - 34,967,394 (+) NCBI ChiLan1.0 ChiLan1.0
JAM3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 134,787,560 - 134,878,062 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 135,892,480 - 135,977,406 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 128,916,024 - 129,006,497 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 132,783,580 - 132,864,657 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 132,783,580 - 132,864,657 (+) Ensembl panpan1.1 panPan2
JAM3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 1,082,619 - 1,165,188 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 1,084,560 - 1,165,121 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 1,202,269 - 1,285,185 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 1,038,590 - 1,121,616 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 1,038,594 - 1,121,627 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 1,071,730 - 1,155,064 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 1,072,117 - 1,155,128 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 1,109,856 - 1,192,622 (-) NCBI UU_Cfam_GSD_1.0
Jam3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 115,840,860 - 115,913,401 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936684 1,692,089 - 1,762,087 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936684 1,689,594 - 1,762,066 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
JAM3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 60,613,400 - 60,738,924 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 60,629,245 - 60,738,979 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 67,205,386 - 67,284,770 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
JAM3
Jam3
.
Predicted Target Of
Count of predictions: 612 Count of miRNA genes: 244 Interacting mature miRNAs: 301 Transcripts: ENSRNOT00000012247 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 1357398 Slep3 Serum leptin concentration QTL 3 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317882 Alcrsp24 Alcohol response QTL 24 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 8 1 25902202 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 2302367 Slep5 Serum leptin concentration QTL 5 3.43 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 8 9712463 41866876 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat
RH143914
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 25,508,834 - 25,508,991 (+) MAPPER mRatBN7.2 Rnor_6.0 8 28,147,484 - 28,147,640 NCBI Rnor6.0 Rnor_5.0 8 28,166,649 - 28,166,805 UniSTS Rnor5.0 RGSC_v3.4 8 26,697,501 - 26,697,657 UniSTS RGSC3.4 Celera 8 26,996,194 - 26,996,350 UniSTS RH 3.4 Map 8 220.2 UniSTS Cytogenetic Map 8 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012247 ⟹ ENSRNOP00000012247
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 25,508,473 - 25,569,303 (-) Ensembl Rnor_6.0 Ensembl 8 28,147,111 - 28,208,466 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100354 ⟹ ENSRNOP00000087591
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 25,508,473 - 25,569,303 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000100661 ⟹ ENSRNOP00000094560
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 25,508,473 - 25,569,306 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000101760 ⟹ ENSRNOP00000078492
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 25,507,057 - 25,569,355 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110398 ⟹ ENSRNOP00000088272
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 25,508,473 - 25,553,573 (-) Ensembl
RefSeq Acc Id:
NM_001004269 ⟹ NP_001004269
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 33,767,606 - 33,828,451 (-) NCBI mRatBN7.2 8 25,508,461 - 25,569,306 (-) NCBI Rnor_6.0 8 28,147,110 - 28,208,466 (-) NCBI Rnor_5.0 8 28,166,275 - 28,227,631 (-) NCBI RGSC_v3.4 8 26,697,127 - 26,758,579 (-) RGD Celera 8 26,995,820 - 27,056,659 (-) RGD
Sequence:
CTCACATTCCCCTCGACATGGCGCTGAGCCGGCGGCTGCGACTTCGCCTGTGCGCGCGGCTACCCGACTTCTTCCTGCTGCTGCTCTTCAGGGGCTGCGTGATAGAGGCAGTGAACCTCAAATCCAGC
hide sequence
RefSeq Acc Id:
NP_001004269 ⟸ NM_001004269
- Peptide Label:
precursor
- UniProtKB:
Q68FQ2 (UniProtKB/Swiss-Prot), A6JYE0 (UniProtKB/TrEMBL), A0A8I6ANI6 (UniProtKB/TrEMBL)
- Sequence:
MALSRRLRLRLCARLPDFFLLLLFRGCVIEAVNLKSSNRNPVVHEFESVELSCIITDSQTNDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDE
hide sequence
Ensembl Acc Id:
ENSRNOP00000012247 ⟸ ENSRNOT00000012247
Ensembl Acc Id:
ENSRNOP00000094560 ⟸ ENSRNOT00000100661
Ensembl Acc Id:
ENSRNOP00000088272 ⟸ ENSRNOT00000110398
Ensembl Acc Id:
ENSRNOP00000078492 ⟸ ENSRNOT00000101760
Ensembl Acc Id:
ENSRNOP00000087591 ⟸ ENSRNOT00000100354
RGD ID: 13695820 Promoter ID: EPDNEW_R6345 Type: initiation region Name: Jam3_1 Description: junctional adhesion molecule 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 28,208,462 - 28,208,522 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Jam3
junctional adhesion molecule 3
Symbol and Name status set to approved
1299863 APPROVED
2005-09-30
Jam3
Symbol and Name status set to provisional
70820 PROVISIONAL
