Symbol:
LOC102008593 (Ensembl: CYP7A1)
Name:
cholesterol 7-alpha-monooxygenase (Ensembl:cytochrome P450 family 7 subfamily A member 1)
RGD ID:
8881152
Description:
ENCODES a protein that exhibits cholesterol 7-alpha-monooxygenase activity (ortholog); INVOLVED IN bile acid biosynthetic process (ortholog); cellular response to cholesterol (ortholog); cellular response to glucose stimulus (ortholog); PARTICIPATES IN bile acid biosynthetic pathway; bile acid signaling pathway; cerebrotendinous xanthomatosis pathway; ASSOCIATED WITH alcoholic hepatitis (ortholog); autism spectrum disorder (ortholog); cholestasis (ortholog); FOUND IN intracellular membrane-bounded organelle (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly
NCBI Annotation Information:
Annotation category: partial on reference assembly
Position:
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955454 17,036,204 - 17,042,756 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955454 17,035,105 - 17,078,854 (-) NCBI ChiLan1.0 ChiLan1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - SMPDB
LOC102008593 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955454 17,036,204 - 17,042,756 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955454 17,035,105 - 17,078,854 (-) NCBI ChiLan1.0 ChiLan1.0
CYP7A1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 58,490,178 - 58,500,163 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 58,490,178 - 58,500,163 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 59,402,737 - 59,412,722 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 59,565,292 - 59,575,275 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 8 59,565,291 - 59,575,275 NCBI Celera 8 55,395,751 - 55,405,734 (-) NCBI Celera Cytogenetic Map 8 q12.1 NCBI HuRef 8 54,889,962 - 54,899,885 (-) NCBI HuRef CHM1_1 8 59,454,626 - 59,464,609 (-) NCBI CHM1_1 T2T-CHM13v2.0 8 58,911,316 - 58,921,301 (-) NCBI T2T-CHM13v2.0
Cyp7a1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 6,265,612 - 6,275,632 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 6,265,612 - 6,275,633 (-) Ensembl GRCm39 Ensembl GRCm38 4 6,265,612 - 6,275,632 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 6,265,612 - 6,275,633 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 6,192,759 - 6,202,778 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 6,192,759 - 6,202,778 (-) NCBI MGSCv36 mm8 Celera 4 6,185,007 - 6,195,027 (-) NCBI Celera Cytogenetic Map 4 A1 NCBI cM Map 4 2.91 NCBI
Cyp7a1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 24,174,505 - 24,184,202 (-) NCBI GRCr8 mRatBN7.2 5 19,376,979 - 19,386,676 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 19,376,974 - 19,386,688 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 21,584,097 - 21,593,795 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 23,169,474 - 23,179,158 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 22,949,785 - 22,959,469 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 19,358,734 - 19,368,431 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 19,358,734 - 19,368,431 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 24,143,589 - 24,153,286 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 19,707,159 - 19,716,856 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 19,707,158 - 19,716,856 (-) NCBI Celera 5 18,677,267 - 18,686,964 (-) NCBI Celera Cytogenetic Map 5 q12 NCBI
CYP7A1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 74,184,135 - 74,194,121 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 49,837,992 - 49,847,979 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 54,942,509 - 54,952,500 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 56,593,799 - 56,603,933 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 56,593,799 - 56,604,037 (-) Ensembl panpan1.1 panPan2
CYP7A1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 29 9,285,315 - 9,295,895 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 29 9,286,181 - 9,332,310 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 29 9,598,242 - 9,625,248 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 29 9,370,713 - 9,397,915 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 29 9,371,580 - 9,417,428 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 29 9,368,643 - 9,395,863 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 29 9,494,537 - 9,521,733 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 29 9,773,555 - 9,801,001 (-) NCBI UU_Cfam_GSD_1.0
LOC101970910 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 70,179,849 - 70,187,118 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936496 4,599,138 - 4,605,653 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936496 4,599,138 - 4,605,653 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CYP7A1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 74,343,123 - 74,372,621 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 74,343,101 - 74,372,628 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 81,137,378 - 81,166,790 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CYP7A1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 54,475,801 - 54,489,329 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 54,477,105 - 54,485,649 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 87,237,971 - 87,247,876 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
LOC101701685
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSCLAT00000018804 ⟹ ENSCLAP00000018621
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 Ensembl NW_004955454 17,036,204 - 17,042,756 (-) Ensembl
RefSeq Acc Id:
XM_013520108 ⟹ XP_013375562
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955454 17,035,105 - 17,078,854 (-) NCBI
Sequence:
GTCTTGTGCAGCTGCGGTCACCTGTGGGCAGCAGAGTCCAGTTTCTTCAGCCTTTCAGAGCAGACAGAGCTGCTTCTGCACTTCCTGAGGAAGGCACTGTAGACTGTCCTACACCCTATCCTGTACAT
hide sequence
RefSeq Acc Id:
XP_013375562 ⟸ XM_013520108
- UniProtKB:
A0A8C2VRK5 (UniProtKB/TrEMBL)
- Sequence:
MTMTAYLIWGIAVVVPCCLWLIFGIRRRKIGEPPLENGLIPYLGCALKFGANPLEFLRANQRKHGHVFTCKLMGKYVHFITNSLSYHKVLCHGKYFDWKKFHYTTSAKAFGHRSIDPSDGNTTENIQS
hide sequence
Ensembl Acc Id:
ENSCLAP00000018621 ⟸ ENSCLAT00000018804
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-08-25
LOC102008593
cholesterol 7-alpha-monooxygenase
cholesterol 7-alpha-monooxygenase-like
Symbol and/or name change
5135510 APPROVED
