Advanced Search (OLGA)

Gene: Glrx5 (glutaredoxin 5) Chinchilla lanigera

Subscribe to Updates

Analyze

Symbol:

Glrx5

Name:

glutaredoxin 5

RGD ID:

8863321

Description:

INVOLVED IN [2Fe-2S] cluster assembly (ortholog); protein maturation (ortholog); PARTICIPATES IN mitochondrial iron-sulfur cluster protein biogenesis pathway; ASSOCIATED WITH autosomal recessive pyridoxine-refractory sideroblastic anemia 2 (ortholog); autosomal recessive pyridoxine-refractory sideroblastic anemia 3 (ortholog); Childhood-Onset Spasticity with Hyperglycinemia (ortholog); FOUND IN dendrite (ortholog); iron-sulfur cluster assembly complex (ortholog); mitochondrial matrix (ortholog)

Type:

protein-coding

RefSeq Status:

MODEL

Previously known as:

glutaredoxin-related protein 5, mitochondrial

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GLRX5 (glutaredoxin 5)	NCBI	Ortholog
Mus musculus (house mouse):	Glrx5 (glutaredoxin 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):	Glrx5 (glutaredoxin 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GLRX5 (glutaredoxin 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GLRX5 (glutaredoxin 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GLRX5 (glutaredoxin 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GLRX5 (glutaredoxin 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Glrx5 (glutaredoxin 5)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline

Latest Assembly:

ChiLan1.0 - Chinchilla ChiLan1.0 Assembly

Position:

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955438	17,066,955 - 17,075,789 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955438	17,067,017 - 17,076,162 (-)	NCBI	ChiLan1.0	ChiLan1.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Glrx5	Chinchilla	autosomal recessive pyridoxine-refractory sideroblastic anemia 3		ISO	GLRX5 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Sideroblastic anemia 3	ClinVar	PMID:17485548 more ...
Glrx5	Chinchilla	Childhood-Onset Spasticity with Hyperglycinemia		ISO	GLRX5 (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:24334290 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Glrx5	Chinchilla	autosomal recessive pyridoxine-refractory sideroblastic anemia 2		ISO	GLRX5 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD
Glrx5	Chinchilla	sideroblastic anemia		ISO	GLRX5 (Homo sapiens)	9068941	CTD Direct Evidence: marker/mechanism	CTD	PMID:18637800

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Glrx5	Chinchilla	autosomal recessive pyridoxine-refractory sideroblastic anemia 3		ISO	GLRX5 (Homo sapiens)	7240710		OMIM
Glrx5	Chinchilla	Childhood-Onset Spasticity with Hyperglycinemia		ISO	GLRX5 (Homo sapiens)	7240710		OMIM

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Glrx5	Chinchilla	[2Fe-2S] cluster assembly	involved_in	ISO	UniProtKB:Q02784	9068941	PMID:23615440	UniProt	PMID:23615440
Glrx5	Chinchilla	protein maturation	involved_in	ISO	UniProtKB:Q02784	9068941	PMID:23615440	UniProt	PMID:23615440

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Glrx5	Chinchilla	dendrite		ISO	Glrx5 (Rattus norvegicus)	9068941		RGD	PMID:20620191 and REF_RGD_ID:5133712
Glrx5	Chinchilla	iron-sulfur cluster assembly complex	part_of	ISO	GLRX5 (Homo sapiens)	9068941	PMID:27532772	ComplexPortal	PMID:27532772
Glrx5	Chinchilla	mitochondrial matrix	located_in	ISO	GLRX5 (Homo sapiens)	9068941	PMID:20364084	UniProt	PMID:20364084
Glrx5	Chinchilla	mitochondrion	located_in	ISO	GLRX5 (Homo sapiens)	9068941		HPA	GO_REF:0000052
Glrx5	Chinchilla	mitochondrion	located_in	ISO	Glrx5 (Mus musculus)	9068941	PMID:14651853	UniProt	PMID:14651853
Glrx5	Chinchilla	mitochondrion	located_in	ISO	GLRX5 (Homo sapiens)	9068941	PMID:34800366	FlyBase	PMID:34800366
Glrx5	Chinchilla	neuronal cell body		ISO	Glrx5 (Rattus norvegicus)	9068941		RGD	PMID:20620191 and REF_RGD_ID:5133712

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Glrx5	Chinchilla	protein binding	enables	ISO	UniProtKB:Q8IWL3	9068941	PMID:24606901 and PMID:28380382	IntAct	PMID:24606901 and PMID:28380382
Glrx5	Chinchilla	protein binding	enables	ISO	UniProtKB:Q53S33 and UniProtKB:Q9Y3E2	9068941	PMID:27532772	IntAct	PMID:27532772
Glrx5	Chinchilla	protein binding	enables	ISO	UniProtKB:Q53S33	9068941	PMID:27499296 more ...	IntAct	PMID:27499296 more ...

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Glrx5	Chinchilla	mitochondrial iron-sulfur cluster protein biogenesis pathway		ISO	GLRX5 (Homo sapiens)	9068941		RGD	PMID:25245479 and REF_RGD_ID:11554190

#	Reference Title	Reference Citation
1.	Transitive Annotation Pipeline	Automated assignment of GO, PW and RDO ISO annotations across species
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline

Glrx5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955438	17,066,955 - 17,075,789 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955438	17,067,017 - 17,076,162 (-)	NCBI	ChiLan1.0	ChiLan1.0

GLRX5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	95,535,050 - 95,544,714 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	95,533,503 - 95,544,724 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	96,001,387 - 96,011,051 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	95,071,076 - 95,080,808 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	95,071,075 - 95,080,808	NCBI
Celera	14	76,057,010 - 76,066,743 (+)	NCBI		Celera
Cytogenetic Map	14	q32.13	NCBI
HuRef	14	76,186,979 - 76,196,711 (+)	NCBI		HuRef
CHM1_1	14	95,939,246 - 95,948,981 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	89,765,742 - 89,775,402 (+)	NCBI		T2T-CHM13v2.0

Glrx5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	104,998,877 - 105,007,170 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	104,998,947 - 105,009,165 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	105,032,618 - 105,040,911 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	105,032,688 - 105,042,906 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	106,270,899 - 106,279,120 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	105,433,739 - 105,441,960 (+)	NCBI		MGSCv36	mm8
Celera	12	106,265,134 - 106,273,355 (+)	NCBI		Celera
Cytogenetic Map	12	E	NCBI
cM Map	12	55.04	NCBI

Glrx5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	129,752,902 - 129,763,278 (+)	NCBI		GRCr8
mRatBN7.2	6	123,988,461 - 123,998,545 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	123,988,134 - 123,998,545 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	124,118,169 - 124,128,237 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	124,413,421 - 124,423,489 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	123,785,337 - 123,795,417 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	128,750,503 - 128,760,880 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	128,750,795 - 128,760,880 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	137,947,583 - 137,957,960 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	129,233,209 - 129,243,293 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	129,236,842 - 129,245,795 (+)	NCBI
Celera	6	121,459,083 - 121,469,162 (+)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

GLRX5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	96,688,753 - 96,698,490 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	95,905,267 - 95,914,996 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	76,162,541 - 76,172,291 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	95,486,818 - 95,496,438 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

GLRX5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	64,383,203 - 64,392,886 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	64,383,227 - 64,383,841 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	63,961,948 - 63,972,042 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	64,651,949 - 64,662,047 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	64,652,309 - 64,662,049 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	64,326,648 - 64,336,722 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	64,385,664 - 64,395,761 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	64,710,831 - 64,720,934 (+)	NCBI		UU_Cfam_GSD_1.0

GLRX5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	116,787,432 - 116,800,554 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	116,787,346 - 116,797,477 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	124,001,745 - 124,011,835 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GLRX5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	73,387,941 - 73,398,208 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	73,387,641 - 73,398,233 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	60,564,346 - 60,574,102 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Glrx5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	7,987,116 - 7,995,220 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624734	7,986,999 - 7,995,604 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	XM_005390376	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AGCD01035430	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	GBBH01092204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSCLAT00000020642 ⟹ ENSCLAP00000020444

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0 Ensembl	NW_004955438	17,066,955 - 17,075,789 (-)	Ensembl

RefSeq Acc Id:

XM_005390376 ⟹ XP_005390433

Type:

CODING

Position:

Chinchilla Assembly	Chr	Position (strand)	Source
ChiLan1.0	NW_004955438	17,067,017 - 17,076,162 (-)	NCBI

Sequence:

show sequence

GGGTCCCAAGGAATCCTACGGGGCCGCGTCCGCTCTCCGCAGGAAAGTCGTCTGGCCGGAGTTTTGTCTCTATGCCCTCGGCGTGGACTCTGATGAACATTCACTTCTCCAATCAACTGACGAAACGG
GTGCCGACAGCCAATCGAATGCATGTAGGACGCGGGTCAGGCCTTTGCGGGCTACCGCCCACTAACCAGAATAAGCAAGCTGATTGGTAGCATCGAGTACTAGCCGTTGCCCAATCACGGAGAGTAGT
CTGGAGCCAGTCCAATGAGAACCCCCGGGGGGCGGGGCGGGTCGCCACGGGCCGGGACTGGGCTGGCGGAGGGCGCAAAGGTTCCGGGCTGTCTGGGGCTCCGTCGGCCGAGCGGTGATGAGCGGGAC
GTTGCGCCGCGCGGCGGCGGCTCTGCTCCGCTGGGGCCGCGGAACGGGCGGCATCGGCCTGCAGGGTGCGGGCGTGCGGGCGGCGGGCTCGGGCTCGGGCTCGGGCTCGGGCGGCGGCCAGGCGGAGC
AGCTGGACGCGCTGGTAAAGAAGGACAAGGTGGTGGTCTTCCTCAAGGGGACGCCTGAACAGCCCCAGTGCGGCTTCAGCAACGCCGTGGTGCAGATCCTGCGGCTGCACGGCGTCCGCGACTACGCG
GCCTACAACGTCCTGGAAGACCCCGACCTCCGGCAAGGCATCAAAGACTACTCCAACTGGCCCACCATCCCGCAGGTGTACCTCAACGGCGAGTTTGTGGGGGGCTGTGACATCCTTCTGCAGATGCA
CCAGAATGGGGACCTGGTGGAAGAACTGAAAAAGCTGGGGATCCGCTCTGCCCTTTTAGATGAAAAGAAAGACCAAGACTCGAAGTGACAGCTGGCCGGGCCTTGGGCGCAGAGACTTGCTGCCGGAA
AAGCCTTATCCCGCTGTCCCCTGCTGCAGTGGCTGCTGGCGCTGGTCCTCCTGGCTCAGAAGCGCGGTGCTTTCAGTGTGTCTGGTTTTTGGGCTAAGAGTACCCTGTTGTGAACTTCATGACAACCA
CTGCACTGTAATAATTCATGTTGTATTACGATATTGCCGTAACAGAATTTGTTCTTACATCGTCTTTTATTCTTTGCCTGACTCGGGAGCTGTTTGTGACTTGCAGACGTGTCCATCTGCAAAGATAC
TATCCTCTCTGTCTTTTGGTAACTTCTGTTAAGGAAAATGAAGGAGAGAGAAGAAAACACGATTGTTGGGTGTTGTTTTTTTTAAATAAACTGCCATTTCCGATA

hide sequence


Protein RefSeqs	XP_005390433	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSCLAP00000020444
	ENSCLAP00000020444.1

RefSeq Acc Id:	XP_005390433 ⟸ XM_005390376
- UniProtKB:	A0A8C2W174 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSGTLRRAAAALLRWGRGTGGIGLQGAGVRAAGSGSGSGSGGGQAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLEDPDLRQGIKDYSNWPTIPQVYLNGEFVGGCDIL LQMHQNGDLVEELKKLGIRSALLDEKKDQDSK hide sequence

Ensembl Acc Id:

ENSCLAP00000020444 ⟸ ENSCLAT00000020642

Protein Domains

Glutaredoxin

Database	Acc Id	Source(s)
Ensembl Genes	ENSCLAG00000014010	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSCLAT00000020642	ENTREZGENE
	ENSCLAT00000020642.1	UniProtKB/TrEMBL
Gene3D-CATH	Glutaredoxin	UniProtKB/TrEMBL
InterPro	Glutaredoxin	UniProtKB/TrEMBL
	GRX_PICOT-like	UniProtKB/TrEMBL
	Monothiol_GRX-rel	UniProtKB/TrEMBL
	Thioredoxin-like_sf	UniProtKB/TrEMBL
NCBI Gene	Glrx5	ENTREZGENE
PANTHER	GLUTAREDOXIN-RELATED PROTEIN 5, MITOCHONDRIAL	UniProtKB/TrEMBL
	PTHR10293	UniProtKB/TrEMBL
Pfam	Glutaredoxin	UniProtKB/TrEMBL
PROSITE	GLUTAREDOXIN_2	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52833	UniProtKB/TrEMBL
UniProt	A0A8C2W174	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations