Symbol:
Prf1
Name:
perforin 1
RGD ID:
8838953
Description:
ENCODES a protein that exhibits calcium ion binding (ortholog); identical protein binding (ortholog); wide pore channel activity (ortholog); INVOLVED IN circadian rhythm (ortholog); defense response to tumor cell (ortholog); defense response to virus (ortholog); ASSOCIATED WITH aplastic anemia (ortholog); asthma (ortholog); autistic disorder (ortholog); FOUND IN cytolytic granule (ortholog); cytoplasmic vesicle (ortholog); cytosol (ortholog)
Type:
protein-coding
RefSeq Status:
MODEL
Previously known as:
perforin 1 (pore forming protein); perforin-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PRF1 (perforin 1) NCBI
Ortholog
Mus musculus (house mouse):
Prf1 (perforin 1 (pore forming protein)) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Rattus norvegicus (Norway rat):
Prf1 (perforin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PRF1 (perforin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PRF1 (perforin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Prf1 (perforin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PRF1 (perforin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PRF1 (perforin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Prf1 (perforin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Latest Assembly:
ChiLan1.0 - Chinchilla ChiLan1.0 Assembly
Position:
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 20,700,718 - 20,706,929 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 20,700,912 - 20,705,076 (+) NCBI ChiLan1.0 ChiLan1.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Prf1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 20,700,718 - 20,706,929 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 20,700,912 - 20,705,076 (+) NCBI ChiLan1.0 ChiLan1.0
PRF1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 70,597,348 - 70,602,741 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 70,597,348 - 70,602,759 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 72,357,104 - 72,362,497 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 72,027,110 - 72,032,537 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 72,027,110 - 72,032,520 NCBI Celera 10 65,638,863 - 65,644,316 (-) NCBI Celera Cytogenetic Map 10 q22.1 NCBI HuRef 10 66,350,612 - 66,356,064 (-) NCBI HuRef CHM1_1 10 72,639,251 - 72,644,703 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 71,467,050 - 71,472,469 (-) NCBI T2T-CHM13v2.0
Prf1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 61,133,530 - 61,140,463 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 61,133,612 - 61,140,459 (+) Ensembl GRCm39 Ensembl GRCm38 10 61,297,751 - 61,304,684 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 61,297,833 - 61,304,680 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 60,760,584 - 60,767,011 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 60,693,191 - 60,699,667 (+) NCBI MGSCv36 mm8 Celera 10 62,399,002 - 62,405,430 (+) NCBI Celera Cytogenetic Map 10 B4 NCBI cM Map 10 32.18 NCBI
Prf1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 29,789,040 - 29,794,550 (+) NCBI GRCr8 mRatBN7.2 20 29,246,202 - 29,251,712 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 29,246,202 - 29,251,701 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 30,262,194 - 30,267,704 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 29,648,492 - 29,654,002 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 30,390,949 - 30,396,459 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 30,915,294 - 30,920,804 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 30,915,213 - 30,921,382 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 32,706,313 - 32,711,823 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 28,658,367 - 28,663,877 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 28,672,166 - 28,677,670 (+) NCBI Celera 20 30,679,378 - 30,684,888 (+) NCBI Celera Cytogenetic Map 20 q11 NCBI
PRF1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 82,751,239 - 82,757,941 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 82,756,560 - 82,763,263 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 67,071,141 - 67,078,057 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 69,597,574 - 69,603,070 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 69,597,574 - 69,603,070 (-) Ensembl panpan1.1 panPan2
PRF1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 21,497,865 - 21,502,429 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 21,498,249 - 21,500,864 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 21,630,717 - 21,633,264 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 21,771,953 - 21,776,587 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 21,772,387 - 21,775,002 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 21,669,548 - 21,672,095 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 21,875,818 - 21,878,365 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 22,227,730 - 22,230,277 (-) NCBI UU_Cfam_GSD_1.0
Prf1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 59,564,718 - 59,568,196 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936521 8,057,874 - 8,060,695 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936521 8,057,874 - 8,060,695 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRF1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 73,512,769 - 73,520,202 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 73,515,306 - 73,520,256 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 79,363,495 - 79,368,376 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRF1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 60,692,544 - 60,698,000 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 60,692,600 - 60,698,465 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 21,417,046 - 21,423,720 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prf1
.
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSCLAT00000021843 ⟹ ENSCLAP00000021640
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 Ensembl NW_004955437 20,700,718 - 20,706,929 (+) Ensembl
RefSeq Acc Id:
XM_005390052 ⟹ XP_005390109
Type:
CODING
Position:
Chinchilla Assembly Chr Position (strand) Source ChiLan1.0 NW_004955437 20,700,912 - 20,705,076 (+) NCBI
Sequence:
AATGCAAACGTGCTGGGGACCAACAGCACCATTCTGGCAGCCTCCACTGGGGAGGGAGTGTGTCCTCTGACAGCTTCTCCTCAGGATCCAGCTTCCCAGGTGCCATGGTCACCCACCTGCTCTTCCTG
hide sequence
RefSeq Acc Id:
XP_005390109 ⟸ XM_005390052
- UniProtKB:
A0A8C2VWT3 (UniProtKB/TrEMBL)
- Sequence:
MVTHLLFLGILLVLPPPAPAPCYTAGPSECKQKRNFVPGAWLAGEGVDVTSLRRSRSFPVDTQRFLRSDGTCTLCKNALQGGAVQLLPVALTHWRAEGPGCQRHVSRAEVSSTEAVAHDAASSITNDW
hide sequence
Ensembl Acc Id:
ENSCLAP00000021640 ⟸ ENSCLAT00000021843
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-08-03
Prf1
perforin 1
perforin 1 (pore forming protein)
Symbol and/or name change
5135510 APPROVED
