Symbol:
CNR1
Name:
cannabinoid receptor 1
RGD ID:
735525
HGNC Page
HGNC:2159
Description:
Enables cannabinoid receptor activity and identical protein binding activity. Involved in adenylate cyclase-modulating G protein-coupled receptor signaling pathway and cannabinoid signaling pathway. Located in actin cytoskeleton and plasma membrane. Implicated in heroin dependence; obesity; schizophrenia; and type 2 diabetes mellitus.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
CANN6; cannabinoid receptor 1 (brain); CB-R; CB1; CB1A; CB1K5; CB1R; central cannabinoid receptor; CNR
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Cnr1 (cannabinoid receptor 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Cnr1 (cannabinoid receptor 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Cnr1 (cannabinoid receptor 1) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
CNR1 (cannabinoid receptor 1) NCBI
Ortholog
Canis lupus familiaris (dog):
CNR1 (cannabinoid receptor 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cnr1 (cannabinoid receptor 1) NCBI
Ortholog
Sus scrofa (pig):
CNR1 (cannabinoid receptor 1) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
CNR1 (cannabinoid receptor 1) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Cnr1 (cannabinoid receptor 1) NCBI
Ortholog
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Cnr1 (cannabinoid receptor 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Cnr1 (cannabinoid receptor 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
cnr1 (cannabinoid receptor 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Xenopus tropicalis (tropical clawed frog):
cnr1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Xenopus laevis (African clawed frog):
cnr1.S
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
cnr1.L
Alliance
DIOPT (Xenbase)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 88,139,864 - 88,167,349 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 88,139,864 - 88,166,347 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 88,849,583 - 88,877,068 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 88,906,302 - 88,911,775 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 88,906,301 - 88,911,775 NCBI Celera 6 89,267,475 - 89,293,659 (-) NCBI Celera Cytogenetic Map 6 q15 NCBI HuRef 6 86,064,928 - 86,090,983 (-) NCBI HuRef CHM1_1 6 88,947,341 - 88,973,526 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 89,348,358 - 89,375,841 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
CNR1 Human (+)-pilocarpine decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Pilocarpine results in decreased expression of CNR1 protein CTD PMID:19368833 CNR1 Human (R)-noradrenaline affects expression EXP 6480464 Norepinephrine affects the expression of CNR1 mRNA CTD PMID:29650773 CNR1 Human (S)-amphetamine decreases response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 mutant form results in decreased susceptibility to Dextroamphetamine CTD PMID:17596442 CNR1 Human (S)-amphetamine multiple interactions ISO Cnr1 (Mus musculus) 6480464 CNR1 mutant form inhibits the reaction [Dextroamphetamine results in increased phosphorylation of MAPK1 protein] and CNR1 mutant form inhibits the reaction [Dextroamphetamine results in increased phosphorylation of MAPK3 protein] CTD PMID:17596442 CNR1 Human (S)-nicotine affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the susceptibility to Nicotine CTD PMID:12384171 CNR1 Human (S)-nicotine increases expression ISO Cnr1 (Mus musculus) 6480464 Nicotine results in increased expression of CNR1 mRNA CTD PMID:21955143 CNR1 Human (S)-nicotine multiple interactions ISO Cnr1 (Mus musculus) 6480464 [rimonabant binds to and results in decreased activity of CNR1 protein] which results in decreased susceptibility to Nicotine CTD PMID:16416159 CNR1 Human 1,2-dichloroethane decreases expression ISO Cnr1 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of CNR1 mRNA CTD PMID:28960355 CNR1 Human 1,2-dimethylhydrazine decreases expression ISO Cnr1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of CNR1 mRNA CTD PMID:22206623 CNR1 Human 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Citalopram results in decreased expression of CNR1 protein CTD PMID:28866072 CNR1 Human 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Cnr1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:28978077 CNR1 Human 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Cnr1 (Mus musculus) 6480464 AM 1241 inhibits the reaction [1-Methyl-4-phenyl-1 more ... CTD PMID:28978077 CNR1 Human 17beta-estradiol multiple interactions EXP 6480464 [Estradiol co-treated with TGFB1 protein] results in decreased expression of CNR1 mRNA more ... CTD PMID:17404688 more ... CNR1 Human 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO Cnr1 (Rattus norvegicus) 6480464 2 more ... CTD PMID:27291303 CNR1 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cnr1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CNR1 mRNA CTD PMID:21570461 CNR1 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of CNR1 mRNA CTD PMID:32109520 and PMID:34747641 CNR1 Human 2,4-dinitrobenzenesulfonic acid decreases response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 results in decreased susceptibility to 2 and 4-dinitrobenzenesulfonic acid CTD PMID:15085199 CNR1 Human 2-arachidonoylglycerol multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 Acetaldehyde promotes the reaction [glyceryl 2-arachidonate results in increased expression of CNR1 mRNA] and Nitroglycerin affects the reaction [glyceryl 2-arachidonate affects the activity of CNR1 protein] CTD PMID:16775503 and PMID:21863215 CNR1 Human 2-arachidonoylglycerol increases expression ISO Cnr1 (Mus musculus) 6480464 glyceryl 2-arachidonate results in increased expression of CNR1 mRNA CTD PMID:28095641 CNR1 Human 2-arachidonoylglycerol multiple interactions EXP 6480464 [GRK2 protein co-treated with glyceryl 2-arachidonate] affects the reaction [CNR1 protein affects the localization of ARRB2 protein] more ... CTD PMID:23894352 and PMID:31024316 CNR1 Human 2-arachidonoylglycerol increases expression ISO Cnr1 (Rattus norvegicus) 6480464 glyceryl 2-arachidonate results in increased expression of CNR1 mRNA CTD PMID:15899896 and PMID:21863215 CNR1 Human 2-arachidonoylglycerol multiple interactions ISO Cnr1 (Mus musculus) 6480464 [CNR1 protein affects the susceptibility to Chlorpyrifos] which affects the hydrolysis of glyceryl 2-arachidonate more ... CTD PMID:12657697 more ... CNR1 Human 3',5'-cyclic AMP multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [3-(2-hydroxy-4-(1 and 1-dimethylheptyl)phenyl)-4-(3-hydroxypropyl)cyclohexanol binds to and results in increased activity of CNR1 protein] which results in increased abundance of Cyclic AMP CTD PMID:17953657 CNR1 Human 3',5'-cyclic AMP multiple interactions EXP 6480464 (1-(2-morpholin-4-yl-ethyl)-1H-indol-3-yl)-(2 more ... CTD PMID:10422789 more ... CNR1 Human 3,4-methylenedioxymethamphetamine increases expression ISO Cnr1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of CNR1 mRNA CTD PMID:20188158 CNR1 Human 3,4-methylenedioxymethamphetamine decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of CNR1 mRNA CTD PMID:30071829 CNR1 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of CNR1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of CNR1 mRNA CTD PMID:28628672 CNR1 Human 3-nitropropanoic acid affects expression ISO Cnr1 (Rattus norvegicus) 6480464 3-nitropropionic acid affects the expression of CNR1 mRNA CTD PMID:15640759 CNR1 Human 4-Hydroxy-N-desmethyltamoxifen multiple interactions EXP 6480464 4-hydroxy-N-desmethyltamoxifen inhibits the reaction [3-(2-hydroxy-4-(1 and 1-dimethylheptyl)phenyl)-4-(3-hydroxypropyl)cyclohexanol binds to CNR1 protein] CTD PMID:27936172 CNR1 Human 5-aza-2'-deoxycytidine increases expression EXP 6480464 Decitabine results in increased expression of CNR1 mRNA CTD PMID:22262103 CNR1 Human 6-propyl-2-thiouracil increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of CNR1 mRNA CTD PMID:24780913 CNR1 Human 8-Br-cAMP decreases expression EXP 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of CNR1 mRNA CTD PMID:22079614 CNR1 Human AB-Fubinaca multiple interactions ISO Cnr1 (Mus musculus) 6480464 AB-FUBINACA inhibits the reaction [3-(2-hydroxy-4-(1 and 1-dimethylheptyl)phenyl)-4-(3-hydroxypropyl)cyclohexanol binds to CNR1 protein] CTD PMID:28597570 CNR1 Human AB-Fubinaca multiple interactions EXP 6480464 AB-FUBINACA binds to and results in increased activity of CNR1 protein more ... CTD PMID:27547266 more ... CNR1 Human acetaldehyde increases expression EXP 6480464 Acetaldehyde results in increased expression of CNR1 mRNA CTD PMID:21863215 CNR1 Human acetaldehyde multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 Acetaldehyde promotes the reaction [Dronabinol results in increased expression of CNR1 mRNA] and Acetaldehyde promotes the reaction [glyceryl 2-arachidonate results in increased expression of CNR1 mRNA] CTD PMID:21863215 CNR1 Human acrylamide decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Acrylamide results in decreased expression of CNR1 mRNA CTD PMID:28959563 CNR1 Human actinomycin D multiple interactions EXP 6480464 Dactinomycin inhibits the reaction [Gemcitabine results in increased expression of CNR1 mRNA] CTD PMID:21525939 CNR1 Human Adb-fubinaca multiple interactions EXP 6480464 ADB-FUBINACA binds to and results in increased activity of CNR1 protein CTD PMID:29963207 CNR1 Human afimoxifene multiple interactions EXP 6480464 afimoxifene inhibits the reaction [3-(2-hydroxy-4-(1 and 1-dimethylheptyl)phenyl)-4-(3-hydroxypropyl)cyclohexanol binds to CNR1 protein] CTD PMID:27936172 CNR1 Human aflatoxin B1 decreases methylation EXP 6480464 Aflatoxin B1 results in decreased methylation of CNR1 gene CTD PMID:27153756 CNR1 Human aldehydo-D-glucose decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Glucose results in decreased expression of CNR1 mRNA CTD PMID:19501110 CNR1 Human aldehydo-D-glucose increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Glucose results in increased expression of CNR1 mRNA and Glucose results in increased expression of CNR1 protein CTD PMID:30642005 CNR1 Human aldehydo-D-glucose multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 MIR29A mRNA inhibits the reaction [Glucose results in increased expression of CNR1 mRNA] and MIR29A mRNA inhibits the reaction [Glucose results in increased expression of CNR1 protein] CTD PMID:30642005 CNR1 Human all-trans-retinoic acid increases expression ISO Cnr1 (Mus musculus) 6480464 Tretinoin results in increased expression of CNR1 mRNA and Tretinoin results in increased expression of CNR1 protein CTD PMID:16477621 CNR1 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of CNR1 mRNA CTD PMID:21934132 and PMID:23724009 CNR1 Human alpha-amanitin affects expression ISO Cnr1 (Mus musculus) 6480464 Alpha-Amanitin affects the expression of CNR1 mRNA CTD PMID:38531469 CNR1 Human alpha-Zearalanol multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CNR1 mRNA CTD PMID:35163327 CNR1 Human AM-251 multiple interactions ISO Cnr1 (Mus musculus) 6480464 [AM 251 binds to and results in decreased activity of CNR1 protein] which results in decreased susceptibility to 1-(5-fluoropentyl)-3-(1-naphthoyl)indole more ... CTD PMID:21907772 more ... CNR1 Human AM-251 increases methylation ISO Cnr1 (Rattus norvegicus) 6480464 AM 251 results in increased methylation of CNR1 promoter CTD PMID:30496751 CNR1 Human AM-251 multiple interactions EXP 6480464 AM 251 inhibits the reaction [Cannabidiol results in increased expression of CNR1 protein] CTD PMID:33817834 CNR1 Human AM-251 decreases activity EXP 6480464 AM 251 results in decreased activity of CNR1 protein CTD PMID:29883990 CNR1 Human AM-251 decreases activity ISO Cnr1 (Rattus norvegicus) 6480464 AM 251 results in decreased activity of CNR1 protein CTD PMID:27114535 and PMID:29982505 CNR1 Human AM-251 decreases activity ISO Cnr1 (Mus musculus) 6480464 AM 251 results in decreased activity of CNR1 protein CTD PMID:17596442 and PMID:27071101 CNR1 Human AM-251 multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [AM 251 binds to and results in decreased activity of CNR1 protein] which results in decreased activity of nimesulide more ... CTD PMID:12509806 more ... CNR1 Human AM6545 multiple interactions ISO Cnr1 (Mus musculus) 6480464 AM6545 affects the reaction [Ethanol affects the expression of CNR1 protein] CTD PMID:39251147 CNR1 Human AM6545 multiple interactions EXP 6480464 [Ethanol co-treated with AM6545] results in increased expression of CNR1 protein CTD PMID:39251147 CNR1 Human ammonium chloride affects expression ISO Cnr1 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of CNR1 mRNA CTD PMID:16483693 CNR1 Human amphetamines affects response to substance EXP 6480464 CNR1 polymorphism affects the susceptibility to Amphetamines CTD PMID:9106242 CNR1 Human anandamide affects activity EXP 6480464 anandamide affects the activity of CNR1 protein CTD PMID:19147270 CNR1 Human anandamide increases response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein results in increased susceptibility to anandamide CTD PMID:29730318 CNR1 Human anandamide decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 anandamide results in decreased expression of CNR1 protein CTD PMID:31199905 CNR1 Human anandamide affects binding ISO Cnr1 (Rattus norvegicus) 6480464 anandamide binds to CNR1 protein CTD PMID:11408034 CNR1 Human anandamide increases activity ISO Cnr1 (Rattus norvegicus) 6480464 anandamide results in increased activity of CNR1 protein CTD PMID:14504685 and PMID:17557913 CNR1 Human anandamide increases activity EXP 6480464 anandamide results in increased activity of CNR1 CTD PMID:10871313 CNR1 Human anandamide multiple interactions EXP 6480464 2-(2-amino-3-methoxyphenyl)-4H-1-benzopyran-4-one inhibits the reaction [anandamide results in increased activity of CNR1] more ... CTD PMID:10871313 more ... CNR1 Human anandamide multiple interactions ISO Cnr1 (Mus musculus) 6480464 [anandamide binds to and results in increased activity of CNR1 protein] inhibits the reaction [Lipopolysaccharides results in increased abundance of Nitric Oxide] more ... CTD PMID:11891798 more ... CNR1 Human arachidonyl-2'-chloroethylamide multiple interactions ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the reaction [arachidonyl-2-chloroethylamide results in increased expression of CCL4 mRNA] more ... CTD PMID:27455076 and PMID:29033935 CNR1 Human arachidonyl-2'-chloroethylamide multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 CNR1 protein affects the reaction [arachidonyl-2-chloroethylamide results in increased phosphorylation of and results in increased activity of MAPK1 protein] and CNR1 protein affects the reaction [arachidonyl-2-chloroethylamide results in increased phosphorylation of and results in increased activity of MAPK3 protein] CTD PMID:12734338 CNR1 Human aripiprazole increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Aripiprazole results in increased expression of CNR1 mRNA CTD PMID:17868501 CNR1 Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of CNR1 mRNA CTD PMID:33212167 CNR1 Human arsenite(3-) decreases expression ISO Cnr1 (Mus musculus) 6480464 arsenite results in decreased expression of CNR1 mRNA CTD PMID:33053406 CNR1 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of CNR1 5' UTR and Benzo(a)pyrene results in increased methylation of CNR1 promoter CTD PMID:27901495 CNR1 Human bis(2-chloroethyl) sulfide increases expression ISO Cnr1 (Mus musculus) 6480464 Mustard Gas results in increased expression of CNR1 protein CTD PMID:27125198 CNR1 Human bis(2-ethylhexyl) phthalate decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Diethylhexyl Phthalate results in decreased expression of CNR1 mRNA CTD PMID:15620428 CNR1 Human bisphenol A decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of CNR1 mRNA CTD PMID:25181051 more ... CNR1 Human bisphenol A increases expression ISO Cnr1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of CNR1 mRNA CTD PMID:36779543 CNR1 Human bisphenol A increases expression ISO Cnr1 (Mus musculus) 6480464 bisphenol A results in increased expression of CNR1 mRNA and bisphenol A results in increased expression of CNR1 protein CTD PMID:33256105 and PMID:33802611 CNR1 Human bisphenol A decreases expression ISO Cnr1 (Mus musculus) 6480464 bisphenol A results in decreased expression of CNR1 mRNA CTD PMID:27641926 and PMID:32156529 CNR1 Human bisphenol F multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of CNR1 mRNA CTD PMID:28628672 CNR1 Human bisphenol F increases expression ISO Cnr1 (Mus musculus) 6480464 bisphenol F results in increased expression of CNR1 mRNA CTD PMID:30951980 CNR1 Human bleomycin A2 decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Bleomycin results in decreased expression of CNR1 mRNA CTD PMID:15808516 CNR1 Human Bromazepam increases response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 results in increased susceptibility to Bromazepam CTD PMID:15081793 CNR1 Human buspirone affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 affects the susceptibility to Buspirone CTD PMID:15081793 CNR1 Human buta-1,3-diene decreases expression ISO Cnr1 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of CNR1 mRNA CTD PMID:29038090 CNR1 Human cadmium dichloride increases methylation ISO Cnr1 (Rattus norvegicus) 6480464 Cadmium Chloride results in increased methylation of CNR1 promoter CTD PMID:22457795 CNR1 Human calcium atom multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [(3R)-((2 more ... CTD PMID:12421626 more ... CNR1 Human calcium(0) multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [(3R)-((2 more ... CTD PMID:12421626 more ... CNR1 Human cannabidiol multiple interactions EXP 6480464 AM 251 inhibits the reaction [Cannabidiol results in increased expression of CNR1 protein] more ... CTD PMID:20668920 more ... CNR1 Human cannabidiol increases expression EXP 6480464 Cannabidiol results in increased expression of CNR1 protein CTD PMID:27932991 and PMID:33817834 CNR1 Human cannabidiol decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Cannabidiol results in decreased expression of CNR1 protein CTD PMID:30496751 CNR1 Human cannabidiol affects expression EXP 6480464 Cannabidiol affects the expression of CNR1 mRNA CTD PMID:38342230 CNR1 Human cannabidiol affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the susceptibility to Cannabidiol CTD PMID:30550613 CNR1 Human cannabidiol multiple interactions ISO Cnr1 (Mus musculus) 6480464 [1 more ... CTD PMID:29624642 and PMID:30550613 CNR1 Human cannabidiol multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 Cannabidiol inhibits the reaction [Heroin results in increased expression of CNR1 mRNA] more ... CTD PMID:19940171 more ... CNR1 Human Cannabinol affects binding ISO Cnr1 (Rattus norvegicus) 6480464 Cannabinol binds to CNR1 protein CTD PMID:19679411 CNR1 Human capsaicin increases activity ISO Cnr1 (Rattus norvegicus) 6480464 Capsaicin results in increased activity of CNR1 protein CTD PMID:11408034 CNR1 Human capsaicin affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the susceptibility to Capsaicin CTD PMID:18987195 CNR1 Human capsaicin multiple interactions ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the reaction [Capsaicin results in increased secretion of CALCA protein] CTD PMID:18987195 CNR1 Human carbazoles multiple interactions EXP 6480464 Carbazoles analog binds to and affects the activity of CNR1 protein and Carbazoles analog binds to and results in increased activity of CNR1 protein CTD PMID:29963207 CNR1 Human CB1 receptor antagonist decreases response to substance ISO Cnr1 (Rattus norvegicus) 596933102 CB1 receptor antagonist decreases response to substance HU210 in ventral tegmental area RGD CNR1 Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to CNR1 gene] CTD PMID:28238834 CNR1 Human chaetocin multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 chaetocin inhibits the reaction [Dronabinol results in decreased expression of CNR1 mRNA] CTD PMID:29022873 and PMID:29481316 CNR1 Human chloroprene decreases expression ISO Cnr1 (Mus musculus) 6480464 Chloroprene results in decreased expression of CNR1 mRNA CTD PMID:23125180 CNR1 Human chlorpyrifos affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the susceptibility to Chlorpyrifos CTD PMID:36858108 CNR1 Human chlorpyrifos multiple interactions ISO Cnr1 (Mus musculus) 6480464 [CNR1 protein affects the susceptibility to Chlorpyrifos] which affects the hydrolysis of anandamide and [CNR1 protein affects the susceptibility to Chlorpyrifos] which affects the hydrolysis of glyceryl 2-arachidonate CTD PMID:36858108 CNR1 Human chlorpyrifos-methyl decreases activity ISO Cnr1 (Mus musculus) 6480464 chlorpyrifos-methyl results in decreased activity of CNR1 protein CTD PMID:12243867 CNR1 Human chlorpyrifos-methyl multiple interactions ISO Cnr1 (Mus musculus) 6480464 chlorpyrifos-methyl inhibits the reaction [CP 55244 binds to CNR1 protein] CTD PMID:12243867 CNR1 Human choline multiple interactions ISO Cnr1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CNR1 gene CTD PMID:20938992 CNR1 Human cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of CNR1 mRNA CTD PMID:27392435 CNR1 Human cisplatin decreases expression ISO Cnr1 (Mus musculus) 6480464 Cisplatin results in decreased expression of CNR1 protein CTD PMID:31256211 CNR1 Human cisplatin multiple interactions EXP 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of CNR1 mRNA CTD PMID:27392435 CNR1 Human citalopram decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Citalopram results in decreased expression of CNR1 protein CTD PMID:28866072 CNR1 Human cocaine affects response to substance EXP 6480464 CNR1 gene polymorphism affects the susceptibility to Cocaine more ... CTD PMID:16314880 more ... CNR1 Human cocaine increases activity ISO Cnr1 (Mus musculus) 6480464 Cocaine results in increased activity of CNR1 protein CTD PMID:20554863 CNR1 Human cocaine decreases response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 mutant form results in decreased susceptibility to Cocaine CTD PMID:17596442 CNR1 Human cocaine multiple interactions ISO Cnr1 (Mus musculus) 6480464 CNR1 gene mutant form inhibits the reaction [Cocaine results in increased phosphorylation of PPP1R1B protein] more ... CTD PMID:17596442 CNR1 Human colforsin daropate hydrochloride multiple interactions EXP 6480464 (1-(2-morpholin-4-yl-ethyl)-1H-indol-3-yl)-(2 more ... CTD PMID:27429655 more ... CNR1 Human colforsin daropate hydrochloride affects response to substance EXP 6480464 CNR1 protein affects the susceptibility to Colforsin CTD PMID:27527584 CNR1 Human colforsin daropate hydrochloride increases activity EXP 6480464 Colforsin results in increased activity of CNR1 protein CTD PMID:28861508 CNR1 Human corticosterone increases abundance ISO Cnr1 (Mus musculus) 6480464 CNR1 gene mutant form results in increased abundance of Corticosterone CTD PMID:15081793 CNR1 Human crocidolite asbestos increases expression ISO Cnr1 (Mus musculus) 6480464 Asbestos and Crocidolite results in increased expression of CNR1 mRNA CTD PMID:23917077 CNR1 Human Cuprizon decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Cuprizone results in decreased expression of CNR1 mRNA CTD PMID:26577399 CNR1 Human Cuprizon increases expression ISO Cnr1 (Mus musculus) 6480464 Cuprizone results in increased expression of CNR1 protein CTD PMID:30075103 CNR1 Human Cuprizon affects expression ISO Cnr1 (Mus musculus) 6480464 Cuprizone affects the expression of CNR1 mRNA CTD PMID:30075103 CNR1 Human cycloheximide multiple interactions EXP 6480464 Cycloheximide inhibits the reaction [Dronabinol results in increased expression of CNR1 mRNA] and Cycloheximide inhibits the reaction [Morphine inhibits the reaction [TNF protein results in increased expression of CNR1 mRNA]] CTD PMID:17041005 and PMID:22258905 CNR1 Human cycloheximide multiple interactions ISO Cnr1 (Mus musculus) 6480464 Cycloheximide results in decreased expression of and affects the localization of CNR1 protein CTD PMID:27513693 CNR1 Human Cyclopamine increases expression ISO Cnr1 (Mus musculus) 6480464 cyclopamine results in increased expression of CNR1 mRNA and cyclopamine results in increased expression of CNR1 protein CTD PMID:33168583 CNR1 Human cytarabine increases expression EXP 6480464 Cytarabine results in increased expression of CNR1 mRNA CTD PMID:21198554 CNR1 Human D-glucose decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Glucose results in decreased expression of CNR1 mRNA CTD PMID:19501110 CNR1 Human D-glucose increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Glucose results in increased expression of CNR1 mRNA and Glucose results in increased expression of CNR1 protein CTD PMID:30642005 CNR1 Human D-glucose multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 MIR29A mRNA inhibits the reaction [Glucose results in increased expression of CNR1 mRNA] and MIR29A mRNA inhibits the reaction [Glucose results in increased expression of CNR1 protein] CTD PMID:30642005 CNR1 Human decabromodiphenyl ether increases expression ISO Cnr1 (Rattus norvegicus) 6480464 decabromobiphenyl ether results in increased expression of CNR1 mRNA CTD PMID:23640034 CNR1 Human Delta(9)-tetrahydrocannabinolic acid multiple interactions EXP 6480464 delta(9)-tetrahydrocannabinolic acid inhibits the reaction [3-(2-hydroxy-4-(1 more ... CTD PMID:28861508 and PMID:32510591 CNR1 Human dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of CNR1 mRNA CTD PMID:25047013 CNR1 Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of CNR1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of CNR1 mRNA CTD PMID:28628672 CNR1 Human dextran sulfate decreases response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 results in decreased susceptibility to Dextran Sulfate CTD PMID:15085199 CNR1 Human dextran sulfate increases expression ISO Cnr1 (Mus musculus) 6480464 Dextran Sulfate results in increased expression of CNR1 protein CTD PMID:27920472 and PMID:30611738 CNR1 Human dextran sulfate multiple interactions ISO Cnr1 (Mus musculus) 6480464 SB 203580 inhibits the reaction [Dextran Sulfate results in increased expression of CNR1 protein] and Serotonin inhibits the reaction [Dextran Sulfate results in increased expression of CNR1 protein] CTD PMID:27920472 and PMID:30611738 CNR1 Human diazepam affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the susceptibility to Diazepam CTD PMID:17442049 CNR1 Human diazoxon decreases activity ISO Cnr1 (Mus musculus) 6480464 diazoxon results in decreased activity of CNR1 protein CTD PMID:12243867 CNR1 Human diazoxon multiple interactions ISO Cnr1 (Mus musculus) 6480464 diazoxon inhibits the reaction [CP 55244 binds to CNR1 protein] CTD PMID:12243867 CNR1 Human dibenzofuran multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 dibenzofuran analog inhibits the reaction [3-(2-hydroxy-4-(1 and 1-dimethylheptyl)phenyl)-4-(3-hydroxypropyl)cyclohexanol binds to CNR1 protein] CTD PMID:21880487 CNR1 Human dibutyl phthalate increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of CNR1 mRNA CTD PMID:21266533 CNR1 Human dibutyl phthalate decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of CNR1 mRNA CTD PMID:15620428 CNR1 Human dichlorine multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [Ozone co-treated with Chlorine] affects the expression of CNR1 mRNA CTD PMID:18636392 CNR1 Human dichlorvos multiple interactions ISO Cnr1 (Mus musculus) 6480464 Dichlorvos inhibits the reaction [CP 55244 binds to CNR1 protein] CTD PMID:12243867 CNR1 Human dichlorvos decreases activity ISO Cnr1 (Mus musculus) 6480464 Dichlorvos results in decreased activity of CNR1 protein CTD PMID:12243867 CNR1 Human dioxygen decreases expression EXP 6480464 Oxygen deficiency results in decreased expression of CNR1 mRNA CTD PMID:21863215 CNR1 Human diprotium oxide multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [Water deficiency co-treated with Sodium Chloride more ... CTD PMID:26468265 CNR1 Human dizocilpine maleate affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the susceptibility to Dizocilpine Maleate CTD PMID:17442049 CNR1 Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CNR1 mRNA CTD PMID:27188386 CNR1 Human doxorubicin affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the susceptibility to Doxorubicin CTD PMID:19942623 CNR1 Human entinostat decreases expression EXP 6480464 entinostat results in decreased expression of CNR1 mRNA CTD PMID:27188386 CNR1 Human ethanol affects expression ISO Cnr1 (Rattus norvegicus) 6480464 Ethanol affects the expression of CNR1 mRNA CTD PMID:11772933 CNR1 Human ethanol increases expression EXP 6480464 Ethanol results in increased expression of CNR1 protein CTD PMID:39251147 CNR1 Human ethanol affects expression ISO Cnr1 (Mus musculus) 6480464 Ethanol affects the expression of CNR1 protein CTD PMID:39251147 CNR1 Human ethanol multiple interactions EXP 6480464 [Ethanol co-treated with AM6545] results in increased expression of CNR1 protein and [Ethanol co-treated with SR 144528] results in increased expression of CNR1 protein CTD PMID:39251147 CNR1 Human ethanol increases expression ISO Cnr1 (Mus musculus) 6480464 Ethanol results in increased expression of CNR1 mRNA CTD PMID:28095641 CNR1 Human ethanol multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [Fluoxetine affects the susceptibility to Ethanol] which affects the expression of CNR1 mRNA CTD PMID:31339221 CNR1 Human ethanol affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the susceptibility to Ethanol CTD PMID:17442049 and PMID:23894352 CNR1 Human ethanol decreases expression ISO Cnr1 (Mus musculus) 6480464 Ethanol results in decreased expression of CNR1 mRNA CTD PMID:21955143 CNR1 Human ethanol multiple interactions ISO Cnr1 (Mus musculus) 6480464 AM 251 inhibits the reaction [Ethanol results in increased expression of CNR1 mRNA] more ... CTD PMID:21863215 more ... CNR1 Human ethanol decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Ethanol results in decreased expression of CNR1 mRNA CTD PMID:18713641 CNR1 Human fluoxetine multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [Fluoxetine affects the susceptibility to Ethanol] which affects the expression of CNR1 mRNA and Fluoxetine results in decreased expression of and results in decreased phosphorylation of CNR1 protein CTD PMID:18722357 and PMID:31339221 CNR1 Human fluoxetine decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Fluoxetine results in decreased expression of CNR1 mRNA CTD PMID:15936043 CNR1 Human folic acid multiple interactions ISO Cnr1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CNR1 gene CTD PMID:20938992 CNR1 Human folic acid increases expression ISO Cnr1 (Mus musculus) 6480464 Folic Acid results in increased expression of CNR1 mRNA CTD PMID:25006883 CNR1 Human fructose increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Fructose results in increased expression of CNR1 mRNA CTD PMID:18627777 CNR1 Human fructose multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [Fructose co-treated with Streptozocin] results in decreased expression of CNR1 mRNA and Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in decreased expression of CNR1 mRNA] CTD PMID:31468622 CNR1 Human furan increases methylation ISO Cnr1 (Rattus norvegicus) 6480464 furan results in increased methylation of CNR1 gene CTD PMID:22079235 CNR1 Human gemcitabine multiple interactions EXP 6480464 BAY 11-7085 inhibits the reaction [Gemcitabine results in increased expression of CNR1 mRNA] more ... CTD PMID:21525939 CNR1 Human gemcitabine increases expression EXP 6480464 Gemcitabine results in increased expression of CNR1 mRNA CTD PMID:21525939 CNR1 Human gentamycin increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of CNR1 mRNA CTD PMID:33387578 CNR1 Human ghrelin multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in decreased expression of CNR1 mRNA] CTD PMID:31468622 CNR1 Human glucose decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Glucose results in decreased expression of CNR1 mRNA CTD PMID:19501110 CNR1 Human glucose increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Glucose results in increased expression of CNR1 mRNA and Glucose results in increased expression of CNR1 protein CTD PMID:30642005 CNR1 Human glucose multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 MIR29A mRNA inhibits the reaction [Glucose results in increased expression of CNR1 mRNA] and MIR29A mRNA inhibits the reaction [Glucose results in increased expression of CNR1 protein] CTD PMID:30642005 CNR1 Human guanosine 5'-[gamma-thio]triphosphate multiple interactions EXP 6480464 (1-pentyl-1H-indol-3-yl)(2 more ... CTD PMID:28087785 more ... CNR1 Human guanosine 5'-[gamma-thio]triphosphate affects binding EXP 6480464 Guanosine 5'-O-(3-Thiotriphosphate) binds to CNR1 protein CTD PMID:29549157 and PMID:32510591 CNR1 Human haloperidol multiple interactions ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the reaction [[potassium perchlorate co-treated with 2-mercapto-1-methylimidazole] inhibits the reaction [Haloperidol results in increased phosphorylation of MAPK1 protein]] and CNR1 protein affects the reaction [[potassium perchlorate co-treated with 2-mercapto-1-methylimidazole] inhibits the reaction [Haloperidol results in increased phosphorylation of MAPK3 protein]] CTD PMID:28017790 CNR1 Human haloperidol increases methylation ISO Cnr1 (Rattus norvegicus) 6480464 Haloperidol results in increased methylation of CNR1 promoter CTD PMID:30496751 CNR1 Human haloperidol multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 Haloperidol inhibits the reaction [Methylazoxymethanol Acetate results in decreased methylation of CNR1 promoter] CTD PMID:30496751 CNR1 Human heroin increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Heroin results in increased expression of CNR1 mRNA and Heroin results in increased expression of CNR1 protein CTD PMID:19940171 CNR1 Human heroin multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 Cannabidiol inhibits the reaction [Heroin results in increased expression of CNR1 mRNA] and Cannabidiol inhibits the reaction [Heroin results in increased expression of CNR1 protein] CTD PMID:19940171 CNR1 Human hydrogen peroxide increases expression EXP 6480464 Hydrogen Peroxide results in increased expression of CNR1 mRNA and Hydrogen Peroxide results in increased expression of CNR1 protein CTD PMID:21863215 and PMID:28285367 CNR1 Human hydrogen peroxide multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [Hydrogen Peroxide results in increased expression of CNR1 protein] CTD PMID:28285367 CNR1 Human ibuprofen multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 Ibuprofen analog inhibits the reaction [3-(2-hydroxy-4-(1 and 1-dimethylheptyl)phenyl)-4-(3-hydroxypropyl)cyclohexanol binds to CNR1 protein] CTD PMID:17397826 CNR1 Human imipramine decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Imipramine results in decreased expression of CNR1 protein CTD PMID:28866072 CNR1 Human indazoles multiple interactions EXP 6480464 Indazoles analog binds to and results in increased activity of CNR1 protein more ... CTD PMID:27429655 and PMID:29963207 CNR1 Human indoles multiple interactions EXP 6480464 Indoles analog binds to and results in increased activity of CNR1 protein more ... CTD PMID:27429655 and PMID:29963207 CNR1 Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of CNR1 mRNA and [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of CNR1 mRNA CTD PMID:28628672 CNR1 Human kainic acid increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Kainic Acid results in increased expression of CNR1 mRNA CTD PMID:22079489 CNR1 Human ketamine decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Ketamine results in decreased expression of CNR1 mRNA CTD PMID:20080153 CNR1 Human L-ascorbic acid multiple interactions EXP 6480464 Ascorbic Acid inhibits the reaction [Hydrogen Peroxide results in increased expression of CNR1 protein] CTD PMID:28285367 CNR1 Human L-glutamic acid multiple interactions ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the reaction [Glutamic Acid results in increased phosphorylation of AKT1 protein] more ... CTD PMID:27543109 CNR1 Human L-methionine multiple interactions ISO Cnr1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of CNR1 gene CTD PMID:20938992 CNR1 Human linoleic acid affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the susceptibility to Linoleic Acid CTD PMID:30241419 CNR1 Human linoleic acid multiple interactions ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the reaction [Linoleic Acid results in increased secretion of GCG protein] CTD PMID:30241419 CNR1 Human lipopolysaccharide decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Lipopolysaccharides results in decreased expression of CNR1 mRNA CTD PMID:24448467 CNR1 Human lipopolysaccharide decreases expression EXP 6480464 Lipopolysaccharides results in decreased expression of CNR1 mRNA CTD PMID:35811015 CNR1 Human lipopolysaccharide multiple interactions EXP 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CNR1 mRNA CTD PMID:35811015 CNR1 Human lipopolysaccharide multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [3-(2-hydroxy-4-(1 more ... CTD PMID:11727767 CNR1 Human lipopolysaccharide multiple interactions ISO Cnr1 (Mus musculus) 6480464 [3-(2-hydroxy-4-(1 more ... CTD PMID:11891798 CNR1 Human mechlorethamine increases expression ISO Cnr1 (Mus musculus) 6480464 Mechlorethamine results in increased expression of CNR1 protein CTD PMID:27125198 CNR1 Human medroxyprogesterone acetate increases expression EXP 6480464 Medroxyprogesterone Acetate results in increased expression of CNR1 mRNA CTD PMID:20843944 CNR1 Human medroxyprogesterone acetate multiple interactions EXP 6480464 [Medroxyprogesterone Acetate co-treated with Estradiol co-treated with Colforsin] results in increased expression of CNR1 mRNA CTD PMID:31154070 CNR1 Human methamphetamine affects response to substance ISO Cnr1 (Rattus norvegicus) 6480464 CNR1 protein affects the susceptibility to Methamphetamine CTD PMID:17953657 CNR1 Human Methanandamide decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 methanandamide results in decreased expression of CNR1 mRNA and methanandamide results in decreased expression of CNR1 protein CTD PMID:31199905 CNR1 Human Methanandamide multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 CNR1 protein affects the reaction [methanandamide results in increased phosphorylation of and results in increased activity of MAPK1 protein] and CNR1 protein affects the reaction [methanandamide results in increased phosphorylation of and results in increased activity of MAPK3 protein] CTD PMID:12734338 CNR1 Human methotrexate affects expression ISO Cnr1 (Mus musculus) 6480464 Methotrexate affects the expression of CNR1 mRNA CTD PMID:18502557 CNR1 Human methoxychlor affects methylation ISO Cnr1 (Rattus norvegicus) 6480464 Methoxychlor affects the methylation of CNR1 gene CTD PMID:35440735 CNR1 Human Methylazoxymethanol acetate multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 AM 251 inhibits the reaction [Methylazoxymethanol Acetate results in increased expression of CNR1 mRNA] more ... CTD PMID:30496751 CNR1 Human Methylazoxymethanol acetate decreases methylation ISO Cnr1 (Rattus norvegicus) 6480464 Methylazoxymethanol Acetate results in decreased methylation of CNR1 promoter CTD PMID:30496751 CNR1 Human Methylazoxymethanol acetate increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Methylazoxymethanol Acetate results in increased expression of CNR1 mRNA and Methylazoxymethanol Acetate results in increased expression of CNR1 protein CTD PMID:30496751 CNR1 Human methylisothiazolinone increases expression EXP 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of CNR1 mRNA CTD PMID:31629900 CNR1 Human methylmercury chloride decreases expression EXP 6480464 methylmercuric chloride results in decreased expression of CNR1 mRNA CTD PMID:37210002 CNR1 Human methylphenidate increases expression ISO Cnr1 (Mus musculus) 6480464 Methylphenidate results in increased expression of CNR1 mRNA CTD PMID:22470460 CNR1 Human morphine multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [Morphine results in increased expression of CNR1 mRNA] which results in increased susceptibility to Dronabinol and Morphine inhibits the reaction [TNF protein results in increased expression of CNR1 mRNA] CTD PMID:22258905 and PMID:9351646 CNR1 Human morphine decreases expression ISO Cnr1 (Mus musculus) 6480464 Morphine deficiency results in decreased expression of CNR1 mRNA CTD PMID:27126842 CNR1 Human morphine multiple interactions EXP 6480464 CTAP octapeptide inhibits the reaction [Morphine inhibits the reaction [TNF protein results in increased expression of CNR1 mRNA]] more ... CTD PMID:22258905 CNR1 Human morphine increases expression ISO Cnr1 (Mus musculus) 6480464 Morphine results in increased expression of CNR1 mRNA CTD PMID:21955143 CNR1 Human morphine increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Morphine results in increased expression of CNR1 mRNA CTD PMID:9351646 CNR1 Human N-acetyl-1,4-benzoquinone imine affects response to substance EXP 6480464 CNR1 gene SNP affects the susceptibility to N-acetyl-4-benzoquinoneimine CTD PMID:21177773 CNR1 Human N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions EXP 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [Gemcitabine results in increased expression of CNR1 mRNA] CTD PMID:21525939 CNR1 Human N-oleoyldopamine multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 N-oleoyldopamine binds to and results in increased activity of CNR1 protein CTD PMID:12569099 CNR1 Human nicotine affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the susceptibility to Nicotine CTD PMID:12384171 CNR1 Human nicotine increases expression ISO Cnr1 (Mus musculus) 6480464 Nicotine results in increased expression of CNR1 mRNA CTD PMID:21955143 CNR1 Human nicotine multiple interactions ISO Cnr1 (Mus musculus) 6480464 [rimonabant binds to and results in decreased activity of CNR1 protein] which results in decreased susceptibility to Nicotine CTD PMID:16416159 CNR1 Human nimesulide multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [AM 251 binds to and results in decreased activity of CNR1 protein] which results in decreased activity of nimesulide CTD PMID:20590570 CNR1 Human nitric oxide multiple interactions ISO Cnr1 (Mus musculus) 6480464 [3-(2-hydroxy-4-(1 more ... CTD PMID:11891798 CNR1 Human nitric oxide multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [3-(2-hydroxy-4-(1 more ... CTD PMID:10027878 and PMID:11727767 CNR1 Human nitroglycerin multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 Nitroglycerin affects the reaction [glyceryl 2-arachidonate affects the activity of CNR1 protein] CTD PMID:16775503 CNR1 Human Nonylphenol decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 nonylphenol results in decreased expression of CNR1 mRNA CTD PMID:15620428 CNR1 Human ochratoxin A decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 ochratoxin A results in decreased expression of CNR1 mRNA CTD PMID:30449730 CNR1 Human oxidopamine affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 affects the susceptibility to Oxidopamine CTD PMID:19419794 CNR1 Human ozone multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [Ozone co-treated with Chlorine] affects the expression of CNR1 mRNA CTD PMID:18636392 CNR1 Human p-menthan-3-ol decreases expression EXP 6480464 Menthol results in decreased expression of CNR1 mRNA CTD PMID:26760959 CNR1 Human palmitoyl ethanolamide multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [rimonabant binds to and results in decreased activity of CNR1 protein] which results in decreased susceptibility to palmidrol analog CTD PMID:17558434 CNR1 Human paracetamol multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 sodium arsenite inhibits the reaction [Acetaminophen results in increased expression of CNR1 mRNA] CTD PMID:24448467 and PMID:25128769 CNR1 Human paracetamol increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of CNR1 mRNA CTD PMID:24448467 and PMID:25128769 CNR1 Human paraoxon multiple interactions ISO Cnr1 (Mus musculus) 6480464 Paraoxon inhibits the reaction [CP 55244 binds to CNR1 protein] CTD PMID:12243867 CNR1 Human paraoxon decreases activity ISO Cnr1 (Mus musculus) 6480464 Paraoxon results in decreased activity of CNR1 protein CTD PMID:12243867 CNR1 Human paraquat decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Paraquat results in decreased expression of CNR1 mRNA CTD PMID:32680482 CNR1 Human parecoxib increases response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein results in increased susceptibility to parecoxib CTD PMID:23371449 CNR1 Human pentetrazol increases response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 gene mutant form results in increased susceptibility to Pentylenetetrazole CTD PMID:26460022 CNR1 Human pentobarbital affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the susceptibility to Pentobarbital CTD PMID:17442049 CNR1 Human perfluorooctanoic acid multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of CNR1 mRNA CTD PMID:35163327 CNR1 Human phencyclidine multiple interactions ISO Cnr1 (Mus musculus) 6480464 [Phencyclidine co-treated with Dronabinol] results in decreased expression of CNR1 protein CTD PMID:28648819 CNR1 Human Phenol, 5-(1,1-dimethylheptyl)-2-[(1r,3s)-3-hydroxycyclohexyl]- multiple interactions ISO Cnr1 (Mus musculus) 6480464 [AM 251 binds to and results in decreased activity of CNR1 protein] which results in decreased susceptibility to CP 47497 and [AM 251 binds to and results in decreased activity of CNR1 protein] which results in decreased susceptibility to CP 47497 analog CTD PMID:21907772 and PMID:24211273 CNR1 Human Phenol, 5-(1,1-dimethylheptyl)-2-[(1r,3s)-3-hydroxycyclohexyl]- affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the susceptibility to CP 47497 and CNR1 protein affects the susceptibility to CP 47497 analog CTD PMID:24211273 CNR1 Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CNR1 mRNA CTD PMID:27188386 CNR1 Human piperidines multiple interactions ISO Cnr1 (Mus musculus) 6480464 Piperidines analog binds to and results in decreased activity of CNR1 protein CTD PMID:16279795 CNR1 Human poly(I:C) multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 Cannabidiol inhibits the reaction [Poly I-C inhibits the reaction [Rimonabant binds to CNR1 protein]] and Poly I-C inhibits the reaction [Rimonabant binds to CNR1 protein] CTD PMID:31202911 CNR1 Human potassium atom multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [3-(2-hydroxy-4-(1 more ... CTD PMID:14973253 CNR1 Human potassium chloride multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [(3R)-((2 more ... CTD PMID:12421626 and PMID:16412482 CNR1 Human potassium chloride decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Potassium Chloride results in decreased expression of CNR1 mRNA and Potassium Chloride results in decreased expression of CNR1 protein CTD PMID:16412482 CNR1 Human pregabalin affects expression ISO Cnr1 (Mus musculus) 6480464 Pregabalin affects the expression of CNR1 mRNA CTD PMID:22017514 CNR1 Human pregnenolone decreases activity ISO Cnr1 (Mus musculus) 6480464 Pregnenolone results in decreased activity of CNR1 protein CTD PMID:28220044 CNR1 Human progesterone multiple interactions EXP 6480464 [Progesterone co-treated with Estradiol] results in increased expression of CNR1 mRNA CTD PMID:17404688 CNR1 Human progesterone increases expression EXP 6480464 Progesterone results in increased expression of CNR1 mRNA CTD PMID:17404688 and PMID:20864642 CNR1 Human pyrazoles multiple interactions ISO Cnr1 (Mus musculus) 6480464 Pyrazoles analog binds to and results in decreased activity of CNR1 protein CTD PMID:16279795 CNR1 Human pyrrolidine dithiocarbamate multiple interactions EXP 6480464 pyrrolidine dithiocarbamic acid inhibits the reaction [Gemcitabine results in increased expression of CNR1 mRNA] CTD PMID:21525939 CNR1 Human quetiapine fumarate decreases expression ISO Cnr1 (Mus musculus) 6480464 Quetiapine Fumarate results in decreased expression of CNR1 protein CTD PMID:31220554 CNR1 Human reserpine decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Reserpine results in decreased expression of CNR1 mRNA CTD PMID:11358453 CNR1 Human ricinoleic acid affects binding EXP 6480464 ricinoleic acid analog binds to CNR1 protein CTD PMID:16406364 CNR1 Human rimonabant multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [Rimonabant binds to and results in decreased activity of CNR1 protein] which results in decreased susceptibility to (3R)-((2 more ... CTD PMID:10027878 more ... CNR1 Human rimonabant decreases activity ISO Cnr1 (Rattus norvegicus) 6480464 Rimonabant results in decreased activity of CNR1 protein CTD PMID:26558620 CNR1 Human rimonabant affects binding ISO Cnr1 (Rattus norvegicus) 6480464 Rimonabant binds to CNR1 protein CTD PMID:31202911 CNR1 Human rimonabant decreases activity EXP 6480464 Rimonabant results in decreased activity of CNR1 protein CTD PMID:29410032 CNR1 Human rimonabant affects binding ISO Cnr1 (Mus musculus) 6480464 Rimonabant binds to CNR1 protein CTD PMID:16113085 and PMID:26052038 CNR1 Human rimonabant affects localization ISO Cnr1 (Mus musculus) 6480464 Rimonabant affects the localization of CNR1 protein CTD PMID:27513693 CNR1 Human rimonabant affects localization EXP 6480464 Rimonabant affects the localization of CNR1 protein CTD PMID:16822929 CNR1 Human rimonabant multiple interactions ISO Cnr1 (Mus musculus) 6480464 6-methyl-3-(2-nitro-1-(thiophen-2-yl)propyl)-2-phenyl-1H-indole inhibits the reaction [Rimonabant binds to CNR1 protein] more ... CTD PMID:11891798 more ... CNR1 Human rimonabant decreases expression ISO Cnr1 (Mus musculus) 6480464 Rimonabant results in decreased expression of CNR1 mRNA CTD PMID:20110567 CNR1 Human rimonabant affects binding EXP 6480464 Rimonabant binds to CNR1 protein CTD PMID:20522703 more ... CNR1 Human rimonabant multiple interactions EXP 6480464 1-(4-chlorophenyl)-3-(3-(6-pyrrolidin-1-ylpyridin-2-yl)phenyl)urea analog inhibits the reaction [Rimonabant binds to CNR1 protein] more ... CTD PMID:10422789 more ... CNR1 Human S-(1,2-dichlorovinyl)-L-cysteine multiple interactions EXP 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CNR1 mRNA CTD PMID:35811015 CNR1 Human SB 203580 multiple interactions ISO Cnr1 (Mus musculus) 6480464 SB 203580 inhibits the reaction [Dextran Sulfate results in increased expression of CNR1 protein] CTD PMID:27920472 CNR1 Human SB 431542 multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CNR1 mRNA CTD PMID:27188386 CNR1 Human serotonin multiple interactions ISO Cnr1 (Mus musculus) 6480464 Serotonin inhibits the reaction [Dextran Sulfate results in increased expression of CNR1 protein] CTD PMID:30611738 CNR1 Human serpentine asbestos increases methylation EXP 6480464 Asbestos and Serpentine results in increased methylation of CNR1 5' UTR CTD PMID:29523930 CNR1 Human silicon dioxide decreases expression EXP 6480464 Silicon Dioxide analog results in decreased expression of CNR1 mRNA and Silicon Dioxide results in decreased expression of CNR1 mRNA CTD PMID:22300531 and PMID:25895662 CNR1 Human silver atom decreases expression EXP 6480464 Silver results in decreased expression of CNR1 mRNA CTD PMID:26551752 CNR1 Human silver atom decreases expression ISO Cnr1 (Mus musculus) 6480464 Silver results in decreased expression of CNR1 mRNA CTD PMID:27131904 CNR1 Human silver(0) decreases expression EXP 6480464 Silver results in decreased expression of CNR1 mRNA CTD PMID:26551752 CNR1 Human silver(0) decreases expression ISO Cnr1 (Mus musculus) 6480464 Silver results in decreased expression of CNR1 mRNA CTD PMID:27131904 CNR1 Human sodium arsenite multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 sodium arsenite inhibits the reaction [Acetaminophen results in increased expression of CNR1 mRNA] CTD PMID:24448467 and PMID:25128769 CNR1 Human sodium arsenite decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 sodium arsenite results in decreased expression of CNR1 mRNA CTD PMID:24448467 and PMID:25128769 CNR1 Human SR 144528 multiple interactions ISO Cnr1 (Mus musculus) 6480464 SR 144528 affects the reaction [Ethanol affects the expression of CNR1 protein] and SR 144528 inhibits the reaction [[anandamide binds to and results in increased activity of CNR1 protein] inhibits the reaction [Lipopolysaccharides results in increased transport of Nitric Oxide]] CTD PMID:11891798 and PMID:39251147 CNR1 Human SR 144528 multiple interactions EXP 6480464 [Ethanol co-treated with SR 144528] results in increased expression of CNR1 protein CTD PMID:39251147 CNR1 Human streptozocin multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [Fructose co-treated with Streptozocin] results in decreased expression of CNR1 mRNA and Ghrelin inhibits the reaction [[Fructose co-treated with Streptozocin] results in decreased expression of CNR1 mRNA] CTD PMID:31468622 CNR1 Human streptozocin decreases expression ISO Cnr1 (Mus musculus) 6480464 Streptozocin results in decreased expression of CNR1 protein CTD PMID:30721768 CNR1 Human streptozocin increases expression ISO Cnr1 (Mus musculus) 6480464 Streptozocin results in increased expression of CNR1 mRNA and Streptozocin results in increased expression of CNR1 protein CTD PMID:30184259 and PMID:30642005 CNR1 Human streptozocin multiple interactions ISO Cnr1 (Mus musculus) 6480464 [Streptozocin co-treated with CNR1 protein] affects the expression of IGF1R protein more ... CTD PMID:26967640 more ... CNR1 Human sulfur dioxide multiple interactions ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the reaction [glyceryl 2-arachidonate inhibits the reaction [Sulfur Dioxide results in increased expression of PTGS2 protein]] more ... CTD PMID:26209559 CNR1 Human tamoxifen multiple interactions EXP 6480464 Tamoxifen inhibits the reaction [3-(2-hydroxy-4-(1 and 1-dimethylheptyl)phenyl)-4-(3-hydroxypropyl)cyclohexanol binds to CNR1 protein] CTD PMID:27936172 CNR1 Human temozolomide increases expression EXP 6480464 Temozolomide results in increased expression of CNR1 mRNA CTD PMID:31758290 CNR1 Human tetrachloromethane increases expression ISO Cnr1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of CNR1 mRNA CTD PMID:29033935 CNR1 Human tetrachloromethane multiple interactions ISO Cnr1 (Mus musculus) 6480464 CNR1 protein affects the reaction [Carbon Tetrachloride results in increased expression of CCL4 mRNA] more ... CTD PMID:29033935 CNR1 Human Theaflavin 3,3'-digallate affects expression EXP 6480464 theaflavin-3 and 3'-digallate affects the expression of CNR1 mRNA CTD PMID:34925699 CNR1 Human thioacetamide multiple interactions ISO Cnr1 (Mus musculus) 6480464 CNR1 gene mutant form affects the reaction [[Ethanol co-treated with Thioacetamide] results in increased expression of NOS2 mRNA] more ... CTD PMID:21863215 CNR1 Human titanium dioxide decreases methylation ISO Cnr1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CNR1 promoter CTD PMID:35295148 CNR1 Human topiramate affects expression ISO Cnr1 (Mus musculus) 6480464 topiramate affects the expression of CNR1 mRNA CTD PMID:22017514 CNR1 Human tribufos decreases activity ISO Cnr1 (Mus musculus) 6480464 butyl phosphorotrithioate results in decreased activity of CNR1 protein CTD PMID:12243867 CNR1 Human tribufos multiple interactions ISO Cnr1 (Mus musculus) 6480464 butyl phosphorotrithioate inhibits the reaction [CP 55244 binds to CNR1 protein] CTD PMID:12243867 CNR1 Human trichloroethene decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 Trichloroethylene results in decreased expression of CNR1 mRNA CTD PMID:33387578 CNR1 Human trichostatin A increases expression EXP 6480464 trichostatin A results in increased expression of CNR1 mRNA CTD PMID:24935251 CNR1 Human triclosan increases expression EXP 6480464 Triclosan results in increased expression of CNR1 mRNA CTD PMID:30510588 CNR1 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of CNR1 mRNA CTD PMID:37042841 CNR1 Human triptonide increases expression ISO Cnr1 (Mus musculus) 6480464 triptonide results in increased expression of CNR1 mRNA CTD PMID:33045310 CNR1 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of CNR1 mRNA CTD PMID:24383497 more ... CNR1 Human valproic acid decreases expression EXP 6480464 Valproic Acid results in decreased expression of CNR1 mRNA CTD PMID:23179753 and PMID:27188386 CNR1 Human venlafaxine hydrochloride increases expression ISO Cnr1 (Rattus norvegicus) 6480464 Venlafaxine Hydrochloride results in increased expression of CNR1 mRNA CTD PMID:25423262 CNR1 Human water multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 [Water deficiency co-treated with Sodium Chloride more ... CTD PMID:26468265 CNR1 Human WIN 55212-2 affects localization ISO Cnr1 (Mus musculus) 6480464 (3R)-((2 more ... CTD PMID:27513693 CNR1 Human WIN 55212-2 increases expression EXP 6480464 (3R)-((2 more ... CTD PMID:39251147 CNR1 Human WIN 55212-2 affects binding ISO Cnr1 (Mus musculus) 6480464 (3R)-((2 more ... CTD PMID:26052038 CNR1 Human WIN 55212-2 increases degradation ISO Cnr1 (Mus musculus) 6480464 (3R)-((2 more ... CTD PMID:27305347 CNR1 Human WIN 55212-2 increases degradation EXP 6480464 (3R)-((2 more ... CTD PMID:27305347 CNR1 Human WIN 55212-2 increases response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein results in increased susceptibility to (3R)-((2 more ... CTD PMID:29730318 CNR1 Human WIN 55212-2 increases activity ISO Cnr1 (Rattus norvegicus) 6480464 (3R)-((2 more ... CTD PMID:27114535 CNR1 Human WIN 55212-2 affects response to substance ISO Cnr1 (Mus musculus) 6480464 CNR1 protein mutant form affects the susceptibility to (3R)-((2 more ... CTD PMID:30629988 CNR1 Human WIN 55212-2 decreases expression ISO Cnr1 (Rattus norvegicus) 6480464 (3R)-((2 more ... CTD PMID:29113897 CNR1 Human WIN 55212-2 multiple interactions ISO Cnr1 (Mus musculus) 6480464 (3R)-((2 more ... CTD PMID:12560108 more ... CNR1 Human WIN 55212-2 increases activity EXP 6480464 (3R)-((2 more ... CTD PMID:10871313 and PMID:29883990 CNR1 Human WIN 55212-2 affects binding EXP 6480464 (3R)-((2 more ... CTD PMID:16157695 more ... CNR1 Human WIN 55212-2 multiple interactions ISO Cnr1 (Rattus norvegicus) 6480464 (3R)-((2 more ... CTD PMID:12421626 more ... CNR1 Human WIN 55212-2 multiple interactions EXP 6480464 (3R)-((2 more ... CTD PMID:10871313 more ...
Imported Annotations - PID (archival)
alcohol use disorder (ISO) Alcohol Withdrawal Delirium (IAGP) Animal Disease Models (EXP) anxiety disorder (EXP) Ascites (ISO) attention deficit hyperactivity disorder (EXP) Binge-Eating Disorder (EXP) cannabis abuse (EXP,ISO) Catalepsy (EXP) cholestasis (EXP) Cocaine-Related Disorders (EXP) cognitive disorder (EXP) developmental coordination disorder (EXP) diabetic neuropathy (ISO) Endometrial Neoplasms (EXP) endometriosis (EXP) Experimental Diabetes Mellitus (ISO) Experimental Liver Cirrhosis (EXP) Fever (ISO) focal epilepsy (ISO) glucose intolerance (EXP) Hemorrhagic Shock (ISO) heroin dependence (IAGP) Huntington's disease (EXP) Hyperalgesia (EXP) hypertension (ISO) Hypotension (EXP,ISO) Hypothermia (EXP) impotence (ISO) Insulin Resistance (ISO) Intravenous Substance Abuse (IAGP) liver cirrhosis (EXP) Memory Disorders (EXP) morphine dependence (ISO) movement disease (EXP) multiple sclerosis (EXP) Muscle Spasticity (EXP) Myocardial Reperfusion Injury (ISO) Nerve Degeneration (EXP,ISO) obesity (EXP,IAGP,IDA,ISO) Pain (EXP,ISO) pancreatic cancer (EXP) pancreatitis (EXP) Parkinsonism (ISO) peptic ulcer disease (ISO) post-traumatic stress disorder (EXP) Reperfusion Injury (ISO) rhabdomyosarcoma (EXP) schizophrenia (EXP,IAGP,ISO) skin melanoma (EXP) Spinal Cord Injuries (ISO) status epilepticus (EXP,ISO) stress-related disorder (ISO) substance-related disorder (EXP) systemic scleroderma (EXP) temporal lobe epilepsy (EXP) type 2 diabetes mellitus (IMP) Weight Gain (EXP) Weight Loss (EXP) withdrawal disorder (EXP)
(+)-pilocarpine (ISO) (R)-noradrenaline (EXP) (S)-amphetamine (ISO) (S)-nicotine (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 17beta-estradiol (EXP) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dinitrobenzenesulfonic acid (ISO) 2-arachidonoylglycerol (EXP,ISO) 3',5'-cyclic AMP (EXP,ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP) 3-nitropropanoic acid (ISO) 4-Hydroxy-N-desmethyltamoxifen (EXP) 5-aza-2'-deoxycytidine (EXP) 6-propyl-2-thiouracil (ISO) 8-Br-cAMP (EXP) AB-Fubinaca (EXP,ISO) acetaldehyde (EXP,ISO) acrylamide (ISO) actinomycin D (EXP) Adb-fubinaca (EXP) afimoxifene (EXP) aflatoxin B1 (EXP) aldehydo-D-glucose (ISO) all-trans-retinoic acid (EXP,ISO) alpha-amanitin (ISO) alpha-Zearalanol (ISO) AM-251 (EXP,ISO) AM6545 (EXP,ISO) ammonium chloride (ISO) amphetamines (EXP) anandamide (EXP,ISO) arachidonyl-2'-chloroethylamide (ISO) aripiprazole (ISO) aristolochic acid A (EXP) arsenite(3-) (ISO) benzo[a]pyrene (EXP) bis(2-chloroethyl) sulfide (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (ISO) bisphenol F (EXP,ISO) bleomycin A2 (ISO) Bromazepam (ISO) buspirone (ISO) buta-1,3-diene (ISO) cadmium dichloride (ISO) calcium atom (ISO) calcium(0) (ISO) cannabidiol (EXP,ISO) Cannabinol (ISO) capsaicin (ISO) carbazoles (EXP) CB1 receptor antagonist (ISO) CGP 52608 (EXP) chaetocin (ISO) chloroprene (ISO) chlorpyrifos (ISO) chlorpyrifos-methyl (ISO) choline (ISO) cisplatin (EXP,ISO) citalopram (ISO) cocaine (EXP,ISO) colforsin daropate hydrochloride (EXP) corticosterone (ISO) crocidolite asbestos (ISO) Cuprizon (ISO) cycloheximide (EXP,ISO) Cyclopamine (ISO) cytarabine (EXP) D-glucose (ISO) decabromodiphenyl ether (ISO) Delta(9)-tetrahydrocannabinolic acid (EXP) dexamethasone (EXP) dextran sulfate (ISO) diazepam (ISO) diazoxon (ISO) dibenzofuran (ISO) dibutyl phthalate (ISO) dichlorine (ISO) dichlorvos (ISO) dioxygen (EXP) diprotium oxide (ISO) dizocilpine maleate (ISO) dorsomorphin (EXP) doxorubicin (ISO) entinostat (EXP) ethanol (EXP,ISO) fluoxetine (ISO) folic acid (ISO) fructose (ISO) furan (ISO) gemcitabine (EXP) gentamycin (ISO) ghrelin (ISO) glucose (ISO) guanosine 5'-[gamma-thio]triphosphate (EXP) haloperidol (ISO) heroin (ISO) hydrogen peroxide (EXP) ibuprofen (ISO) imipramine (ISO) indazoles (EXP) indoles (EXP) indometacin (EXP) kainic acid (ISO) ketamine (ISO) L-ascorbic acid (EXP) L-glutamic acid (ISO) L-methionine (ISO) linoleic acid (ISO) lipopolysaccharide (EXP,ISO) mechlorethamine (ISO) medroxyprogesterone acetate (EXP) methamphetamine (ISO) Methanandamide (ISO) methotrexate (ISO) methoxychlor (ISO) Methylazoxymethanol acetate (ISO) methylisothiazolinone (EXP) methylmercury chloride (EXP) methylphenidate (ISO) morphine (EXP,ISO) N-acetyl-1,4-benzoquinone imine (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP) N-oleoyldopamine (ISO) nicotine (ISO) nimesulide (ISO) nitric oxide (ISO) nitroglycerin (ISO) Nonylphenol (ISO) ochratoxin A (ISO) oxidopamine (ISO) ozone (ISO) p-menthan-3-ol (EXP) palmitoyl ethanolamide (ISO) paracetamol (ISO) paraoxon (ISO) paraquat (ISO) parecoxib (ISO) pentetrazol (ISO) pentobarbital (ISO) perfluorooctanoic acid (ISO) phencyclidine (ISO) Phenol, 5-(1,1-dimethylheptyl)-2-[(1r,3s)-3-hydroxycyclohexyl]- (ISO) phenylmercury acetate (EXP) piperidines (ISO) poly(I:C) (ISO) potassium atom (ISO) potassium chloride (ISO) pregabalin (ISO) pregnenolone (ISO) progesterone (EXP) pyrazoles (ISO) pyrrolidine dithiocarbamate (EXP) quetiapine fumarate (ISO) reserpine (ISO) ricinoleic acid (EXP) rimonabant (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (EXP) SB 203580 (ISO) SB 431542 (EXP) serotonin (ISO) serpentine asbestos (EXP) silicon dioxide (EXP) silver atom (EXP,ISO) silver(0) (EXP,ISO) sodium arsenite (ISO) SR 144528 (EXP,ISO) streptozocin (ISO) sulfur dioxide (ISO) tamoxifen (EXP) temozolomide (EXP) tetrachloromethane (ISO) Theaflavin 3,3'-digallate (EXP) thioacetamide (ISO) titanium dioxide (ISO) topiramate (ISO) tribufos (ISO) trichloroethene (ISO) trichostatin A (EXP) triclosan (EXP) triphenyl phosphate (EXP) triptonide (ISO) valproic acid (EXP) venlafaxine hydrochloride (ISO) water (ISO) WIN 55212-2 (EXP,ISO)
1.
Effect of cannabinoid receptor agonists on streptozotocin-induced hyperalgesia in diabetic neuropathy.
Bujalska M Pharmacology. 2008;82(3):193-200. Epub 2008 Sep 23.
2.
Precision therapeutic opioid dosing implications from genetic biomarkers and craving score.
Chang HW, etal., Medicine (Baltimore). 2020 May 29;99(22):e20429. doi: 10.1097/MD.0000000000020429.
3.
Cannabinoid receptor gene (CNR1): association with i.v. drug use.
Comings DE, etal., Mol Psychiatry 1997 Mar;2(2):161-8.
4.
Food intake-independent effects of CB1 antagonism on glucose and lipid metabolism.
Cota D, etal., Obesity (Silver Spring). 2009 Aug;17(8):1641-5. Epub 2009 Mar 26.
5.
Cortical expression of brain derived neurotrophic factor and type-1 cannabinoid receptor after striatal excitotoxic lesions.
De March Z, etal., Neuroscience. 2008 Mar 27;152(3):734-40. doi: 10.1016/j.neuroscience.2007.11.044. Epub 2007 Dec 8.
6.
Type 1 diabetes alters brain cannabinoid receptor expression and phosphorylation status in rats.
Diaz-Asensio C, etal., Horm Metab Res. 2008 Jul;40(7):454-8. Epub 2008 Mar 27.
7.
Cannabinoid type 1 receptor antagonism delays ascites formation in rats with cirrhosis.
Domenicali M, etal., Gastroenterology. 2009 Jul;137(1):341-9. Epub 2009 Jan 14.
8.
Temporal characterization of changes in hippocampal cannabinoid CB(1) receptor expression following pilocarpine-induced status epilepticus.
Falenski KW, etal., Brain Res. 2009 Mar 25;1262:64-72. Epub 2009 Jan 31.
9.
Endogenous cannabinoids induce fever through the activation of CB1 receptors.
Fraga D, etal., Br J Pharmacol. 2009 Aug;157(8):1494-501.
10.
The endocannabinoid system is modulated in response to spinal cord injury in rats.
Garcia-Ovejero D, etal., Neurobiol Dis. 2009 Jan;33(1):57-71. Epub 2008 Sep 30.
11.
Anandamide improves the impaired nitric oxide-mediated neurogenic relaxation of the corpus cavernosum in diabetic rats: involvement of cannabinoid CB1 and vanilloid VR1 receptors.
Ghasemi M, etal., BJU Int. 2007 Dec;100(6):1385-90. Epub 2007 Sep 10.
12.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
13.
Acute hypertension reveals depressor and vasodilator effects of cannabinoids in conscious rats.
Ho WS and Gardiner SM, Br J Pharmacol. 2009 Jan;156(1):94-104.
14.
CB1 cannabinoid receptor participates in the vascular hyporeactivity resulting from hemorrhagic shock in rats.
Hou LC, etal., Chin Med J (Engl). 2009 Apr 20;122(8):950-4.
15.
The CB(1) antagonist rimonabant is adjunctively therapeutic as well as monotherapeutic in an animal model of Parkinson's disease.
Kelsey JE, etal., Behav Brain Res. 2009 Nov 5;203(2):304-7. Epub 2009 May 3.
16.
Izvestiia Akademii nauk. Seriia biologicheskaia / Rossiiskaia akademiia nauk
Lasukova OV, etal., Izv Akad Nauk Ser Biol. 2008 Jul-Aug;(4):471-8.
17.
Schizophrenia and the cannabinoid receptor type 1 (CB1): association study using a single-base polymorphism in coding exon 1.
Leroy S, etal., Am J Med Genet 2001 Dec 8;105(8):749-52.
18.
Synaptic neurotransmission depression in ventral tegmental dopamine neurons and cannabinoid-associated addictive learning.
Liu Z, etal., PLoS One. 2010 Dec 20;5(12):e15634. doi: 10.1371/journal.pone.0015634.
19.
Sex-dependent influence of chronic mild stress (CMS) on voluntary alcohol consumption; study of neurobiological consequences.
Marco EM, etal., Pharmacol Biochem Behav. 2017 Jan;152:68-80. doi: 10.1016/j.pbb.2016.11.005. Epub 2016 Nov 25.
20.
No evidence for an involvement of variants in the cannabinoid receptor gene (CNR1) in obesity in German children and adolescents.
Muller TD, etal., Mol Genet Metab. 2007 Apr;90(4):429-34. Epub 2007 Feb 8.
21.
Spinal endocannabinoids and CB1 receptors mediate C-fiber-induced heterosynaptic pain sensitization.
Pernia-Andrade AJ, etal., Science. 2009 Aug 7;325(5941):760-4.
22.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
23.
Preclinical and Clinical Evidence for a Distinct Regulation of Mu Opioid and Type 1 Cannabinoid Receptor Genes Expression in Obesity.
Pucci M, etal., Front Genet. 2019 Jun 14;10:523. doi: 10.3389/fgene.2019.00523. eCollection 2019.
24.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
25.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
26.
Evidences of cannabinoids-induced modulation of paroxysmal events in an experimental model of partial epilepsy in the rat.
Rizzo V, etal., Neurosci Lett. 2009 Sep 22;462(2):135-9. Epub 2009 Jul 10.
27.
SERENADE: the Study Evaluating Rimonabant Efficacy in Drug-naive Diabetic Patients: effects of monotherapy with rimonabant, the first selective CB1 receptor antagonist, on glycemic control, body weight, and lipid profile in drug-naive type 2 diabetes.
Rosenstock J, etal., Diabetes Care. 2008 Nov;31(11):2169-76. Epub 2008 Aug 4.
28.
Genetic variations at the endocannabinoid type 1 receptor gene (CNR1) are associated with obesity phenotypes in men.
Russo P, etal., J Clin Endocrinol Metab. 2007 Jun;92(6):2382-6. Epub 2007 Apr 3.
29.
Involvement of nitric oxide in the gastroprotective effect of ACEA, a selective cannabinoid CB1 receptor agonist, on aspirin-induced gastric ulceration.
Rutkowska M and Fereniec-Golebiewska L, Pharmazie. 2009 Sep;64(9):595-7.
30.
Association of a CB1 cannabinoid receptor gene (CNR1) polymorphism with severe alcohol dependence.
Schmidt LG, etal., Drug Alcohol Depend. 2002 Feb 1;65(3):221-4.
31.
Cannabinoid self-administration attenuates PCP-induced schizophrenia-like symptoms in adult rats.
Spano MS, etal., Eur Neuropsychopharmacol. 2009 Oct 22.
32.
New perspectives in the studies on endocannabinoid and cannabis: cannabinoid receptors and schizophrenia.
Ujike H and Morita Y, J Pharmacol Sci. 2004 Dec;96(4):376-81.
33.
Central cannabinoid 1 receptor antagonist administration prevents endotoxic hypotension affecting norepinephrine release in the preoptic anterior hypothalamic area.
Villanueva A, etal., Shock. 2009 Dec;32(6):614-20.
34.
Pretreatment with electroacupuncture induces rapid tolerance to focal cerebral ischemia through regulation of endocannabinoid system.
Wang Q, etal., Stroke. 2009 Jun;40(6):2157-64. Epub 2009 Apr 16.
35.
Discovery of 2-[5-(4-chloro-phenyl)-1-(2,4-dichloro-phenyl)-4-ethyl-1H-pyrazol-3-yl]-1, 5,5-trimethyl-1,5-dihydro-imidazol-4-thione (BPR-890) via an active metabolite. A novel, potent and selective cannabinoid-1 receptor inverse agonist with high antiobesity efficacy in DIO mice.
Wu CH, etal., J Med Chem. 2009 Jul 23;52(14):4496-510.
36.
Blockade of Cannabinoid CB1 receptor attenuates the acquisition of morphine-induced conditioned place preference along with a downregulation of ERK, CREB phosphorylation, and BDNF expression in the nucleus accumbens and hippocampus.
Zhang J, etal., Neurosci Lett. 2016 Sep 6;630:70-76. doi: 10.1016/j.neulet.2016.07.047. Epub 2016 Jul 25.
CNR1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 88,139,864 - 88,167,349 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 88,139,864 - 88,166,347 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 88,849,583 - 88,877,068 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 88,906,302 - 88,911,775 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 88,906,301 - 88,911,775 NCBI Celera 6 89,267,475 - 89,293,659 (-) NCBI Celera Cytogenetic Map 6 q15 NCBI HuRef 6 86,064,928 - 86,090,983 (-) NCBI HuRef CHM1_1 6 88,947,341 - 88,973,526 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 89,348,358 - 89,375,841 (-) NCBI T2T-CHM13v2.0
Cnr1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 33,923,171 - 33,948,831 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 33,924,593 - 33,948,831 (+) Ensembl GRCm39 Ensembl GRCm38 4 33,923,171 - 33,948,831 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 33,924,593 - 33,948,831 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 34,011,607 - 34,035,806 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 34,253,245 - 34,277,444 (+) NCBI MGSCv36 mm8 Celera 4 33,679,304 - 33,703,476 (+) NCBI Celera Cytogenetic Map 4 A5 NCBI cM Map 4 16.28 NCBI
Cnr1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 53,204,867 - 53,230,396 (+) NCBI GRCr8 mRatBN7.2 5 48,408,543 - 48,436,099 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 48,408,574 - 48,435,099 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 50,575,033 - 50,597,155 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 52,174,251 - 52,196,375 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 52,110,881 - 52,132,920 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 49,307,584 - 49,333,064 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 49,311,030 - 49,333,056 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 53,878,619 - 53,904,013 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 50,427,173 - 50,445,471 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 50,427,351 - 50,445,650 (+) NCBI Celera 5 47,168,709 - 47,190,724 (+) NCBI Celera Cytogenetic Map 5 q21 NCBI
Cnr1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955411 15,052,163 - 15,077,320 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955411 15,052,151 - 15,077,320 (-) NCBI ChiLan1.0 ChiLan1.0
CNR1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 108,222,001 - 108,249,883 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 106,115,872 - 106,143,699 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 86,017,141 - 86,044,889 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 89,289,102 - 89,315,174 (-) NCBI panpan1.1 PanPan1.1 panPan2
CNR1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 47,537,240 - 47,560,723 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 47,509,583 - 47,560,983 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 47,344,588 - 47,368,064 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 48,342,012 - 48,365,459 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 48,346,226 - 48,363,768 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 47,639,694 - 47,663,171 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 47,561,070 - 47,584,546 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 47,752,753 - 47,776,234 (-) NCBI UU_Cfam_GSD_1.0
Cnr1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 82,664,248 - 82,691,073 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936510 3,781,210 - 3,802,693 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936510 3,779,930 - 3,806,615 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CNR1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 56,467,835 - 56,492,602 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 56,466,022 - 56,493,275 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 63,201,796 - 63,224,939 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CNR1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 12,626,259 - 12,653,253 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 12,630,270 - 12,631,688 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 188,875,655 - 188,902,692 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cnr1
.
Predicted Target Of
Count of predictions: 8055 Count of miRNA genes: 1185 Interacting mature miRNAs: 1516 Transcripts: ENST00000362094, ENST00000369499, ENST00000369501, ENST00000428600, ENST00000468898, ENST00000535130, ENST00000537554, ENST00000549716, ENST00000549890, ENST00000551417 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298426 BFD3_H Body fluid distribution QTL 3 (human) 2.79 0.01 Body fluid distribution impedance ratio 6 84873647 110873647 Human
RH80958
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 88,849,629 - 88,849,859 UniSTS GRCh37 Build 36 6 88,906,348 - 88,906,578 RGD NCBI36 Celera 6 89,267,521 - 89,267,751 RGD Cytogenetic Map 6 q14-q15 UniSTS HuRef 6 86,064,974 - 86,065,204 UniSTS
D6S1243E
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 88,851,593 - 88,851,792 UniSTS GRCh37 Build 36 6 88,908,312 - 88,908,511 RGD NCBI36 Celera 6 89,269,485 - 89,269,684 RGD Cytogenetic Map 6 q14-q15 UniSTS HuRef 6 86,066,938 - 86,067,137 UniSTS
PMC193595P1
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 88,853,724 - 88,853,923 UniSTS GRCh37 Build 36 6 88,910,443 - 88,910,642 RGD NCBI36 Celera 6 89,271,616 - 89,271,815 RGD HuRef 6 86,069,069 - 86,069,268 UniSTS
CNR1
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 88,854,265 - 88,854,460 UniSTS GRCh37 Build 36 6 88,910,984 - 88,911,179 RGD NCBI36 Celera 6 89,272,157 - 89,272,352 RGD HuRef 6 86,069,610 - 86,069,805 UniSTS
D6S1909
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 88,851,266 - 88,851,518 UniSTS GRCh37 Build 36 6 88,907,985 - 88,908,237 RGD NCBI36 Celera 6 89,269,158 - 89,269,410 RGD Cytogenetic Map 6 q14-q15 UniSTS HuRef 6 86,066,611 - 86,066,863 UniSTS Whitehead-RH Map 6 577.6 UniSTS Whitehead-YAC Contig Map 6 UniSTS
SHGC-35377
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 88,853,281 - 88,853,480 UniSTS GRCh37 Build 36 6 88,910,000 - 88,910,199 RGD NCBI36 Celera 6 89,271,173 - 89,271,372 RGD Cytogenetic Map 6 q14-q15 UniSTS HuRef 6 86,068,626 - 86,068,825 UniSTS Stanford-G3 RH Map 6 3785.0 UniSTS GeneMap99-GB4 RH Map 6 387.19 UniSTS Whitehead-RH Map 6 586.3 UniSTS NCBI RH Map 6 1243.8 UniSTS GeneMap99-G3 RH Map 6 4091.0 UniSTS
RH70837
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 88,853,662 - 88,853,820 UniSTS GRCh37 Build 36 6 88,910,381 - 88,910,539 RGD NCBI36 Celera 6 89,271,554 - 89,271,712 RGD Cytogenetic Map 6 q14-q15 UniSTS HuRef 6 86,069,007 - 86,069,165 UniSTS GeneMap99-GB4 RH Map 6 385.58 UniSTS
RH79168
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 88,853,033 - 88,853,207 UniSTS GRCh37 Build 36 6 88,909,752 - 88,909,926 RGD NCBI36 Celera 6 89,270,925 - 89,271,099 RGD Cytogenetic Map 6 q14-q15 UniSTS HuRef 6 86,068,378 - 86,068,552 UniSTS GeneMap99-GB4 RH Map 6 389.88 UniSTS
WI-19695
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 88,849,618 - 88,849,886 UniSTS GRCh37 Build 36 6 88,906,337 - 88,906,605 RGD NCBI36 Celera 6 89,267,510 - 89,267,778 RGD Cytogenetic Map 6 q14-q15 UniSTS HuRef 6 86,064,963 - 86,065,231 UniSTS GeneMap99-GB4 RH Map 6 383.9 UniSTS Whitehead-RH Map 6 569.7 UniSTS NCBI RH Map 6 1194.9 UniSTS
UniSTS:482039
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 88,853,540 - 88,855,031 UniSTS GRCh37 Celera 6 89,271,432 - 89,272,923 UniSTS HuRef 6 86,068,885 - 86,070,376 UniSTS
UniSTS:482606
Human Assembly Chr Position (strand) Source JBrowse GRCh37 6 88,853,575 - 88,854,993 UniSTS GRCh37 Celera 6 89,271,467 - 89,272,885 UniSTS HuRef 6 86,068,920 - 86,070,338 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2305
2788
2245
4900
1596
2144
3
512
1857
353
2226
6929
6344
16
3701
787
1636
1527
166
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000362094 ⟹ ENSP00000355418
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 88,139,864 - 88,145,274 (-) Ensembl
Ensembl Acc Id:
ENST00000369499 ⟹ ENSP00000358511
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 88,139,864 - 88,164,343 (-) Ensembl
Ensembl Acc Id:
ENST00000369501 ⟹ ENSP00000358513
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 88,139,864 - 88,166,347 (-) Ensembl
Ensembl Acc Id:
ENST00000428600 ⟹ ENSP00000412192
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 88,139,864 - 88,163,024 (-) Ensembl
Ensembl Acc Id:
ENST00000468898 ⟹ ENSP00000420188
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 88,139,864 - 88,145,274 (-) Ensembl
Ensembl Acc Id:
ENST00000549890 ⟹ ENSP00000446819
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 88,139,864 - 88,145,365 (-) Ensembl
Ensembl Acc Id:
ENST00000551417 ⟹ ENSP00000446702
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 6 88,139,864 - 88,166,347 (-) Ensembl
RefSeq Acc Id:
NM_001160226 ⟹ NP_001153698
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,166,347 (-) NCBI GRCh37 6 88,849,583 - 88,876,063 (-) NCBI HuRef 6 86,064,928 - 86,090,983 (-) ENTREZGENE CHM1_1 6 88,947,341 - 88,973,526 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,374,839 (-) NCBI
Sequence:
AGAGACAGCGCGAGCGGAGGGAGCGGCAGGGACTGCGCGAGCGGGACGAGGCGACGGGCGCCCGGGCTGGCGGAGACGGGCGGCCCCACGCCGGGCCAGGCGGGGCTCGCGGGAGGACCCAGTGAAGA
hide sequence
RefSeq Acc Id:
NM_001160258 ⟹ NP_001153730
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,166,347 (-) NCBI GRCh37 6 88,849,583 - 88,876,063 (-) NCBI HuRef 6 86,064,928 - 86,090,983 (-) ENTREZGENE CHM1_1 6 88,947,341 - 88,973,526 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,374,839 (-) NCBI
Sequence:
AGAGACAGCGCGAGCGGAGGGAGCGGCAGGGACTGCGCGAGCGGGACGAGGCGACGGGCGCCCG
hide sequence
RefSeq Acc Id:
NM_001160259 ⟹ NP_001153731
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,166,347 (-) NCBI GRCh37 6 88,849,583 - 88,876,063 (-) NCBI HuRef 6 86,064,928 - 86,090,983 (-) ENTREZGENE CHM1_1 6 88,947,341 - 88,973,526 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,374,839 (-) NCBI
Sequence:
AGAGACAGCGCGAGCGGAGGGAGCGGCAGGGACTGCGCGAGCGGGACGAGGCGACGGGCGCCCGGGCTGGCGGAGACGGGCGGCCCCACGCCGGGCCAGGCGGGGCTCGCGGGAGGACCCAGTGAAGA
hide sequence
RefSeq Acc Id:
NM_001365869 ⟹ NP_001352798
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,166,347 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,374,839 (-) NCBI
Sequence:
AGAGACAGCGCGAGCGGAGGGAGCGGCAGGGACTGCGCGAGCGGGACGAGGCGACGGGCGCCCG
hide sequence
RefSeq Acc Id:
NM_001365870 ⟹ NP_001352799
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,166,347 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,374,839 (-) NCBI
Sequence:
AGAGACAGCGCGAGCGGAGGGAGCGGCAGGGACTGCGCGAGCGGGACGAGGCGACGGGCGCCCGGGCTGGCGGAGACGGGCGGCCCCACGCCGGGCCAGGCGGGGCTCGCGGGAGGACCCAGTGAAGA
hide sequence
RefSeq Acc Id:
NM_001365872 ⟹ NP_001352801
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,166,347 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,374,839 (-) NCBI
Sequence:
AGAGACAGCGCGAGCGGAGGGAGCGGCAGGGACTGCGCGAGCGGGACGAGGCGACGGGCGCCCGGGCTGGCGGAGACGGGCGGCCCCACGCCGGGCCAGGCGGGGCTCGCGGGAGGACCCAGTGAAGA
hide sequence
RefSeq Acc Id:
NM_001365874 ⟹ NP_001352803
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,163,024 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,371,516 (-) NCBI
Sequence:
CAGTTGCATAAAGAACATAGATGAGAGCTTTCATTCCCTGCTGAAAAGGATGCCATGCCTCCAC
hide sequence
RefSeq Acc Id:
NM_001370545 ⟹ NP_001357474
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,166,652 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,375,144 (-) NCBI
Sequence:
ATCCGGGAGCACAGCGAGGTCATGGCAGCGGGGGCCTCCGGGAGCGCGGCGGCGGAGGAGGAGGAGGAAGAGGAGAAGATTGCCCCCTGTGGGTCACTTTCTCAGTCATTTTGAGCTCAGCCTAATCA
hide sequence
RefSeq Acc Id:
NM_001370546 ⟹ NP_001357475
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,167,349 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,375,841 (-) NCBI
Sequence:
AGACGGCGGCTGATAGTGGAAACAATTAACGAGCATGTCCCCTAATTCCTGCCGCGGCTGCTGA
hide sequence
RefSeq Acc Id:
NM_001370547 ⟹ NP_001357476
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,167,349 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,375,841 (-) NCBI
Sequence:
AGACGGCGGCTGATAGTGGAAACAATTAACGAGCATGTCCCCTAATTCCTGCCGCGGCTGCTGAGCACACCGCGGCTCCCCAGGCGCCCGCCGCTGCCGCCCCCGAGTCCCAGAGCCCCCAGTCCGGC
hide sequence
RefSeq Acc Id:
NM_001424094 ⟹ NP_001411023
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,167,349 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,375,841 (-) NCBI
RefSeq Acc Id:
NM_001424095 ⟹ NP_001411024
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,167,109 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,375,601 (-) NCBI
RefSeq Acc Id:
NM_001424096 ⟹ NP_001411025
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,167,109 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,375,601 (-) NCBI
RefSeq Acc Id:
NM_001424097 ⟹ NP_001411026
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,167,109 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,375,601 (-) NCBI
RefSeq Acc Id:
NM_001424098 ⟹ NP_001411027
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,166,347 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,374,839 (-) NCBI
RefSeq Acc Id:
NM_016083 ⟹ NP_057167
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,166,347 (-) NCBI GRCh37 6 88,849,583 - 88,876,063 (-) NCBI Build 36 6 88,906,302 - 88,911,775 (-) NCBI Archive HuRef 6 86,064,928 - 86,090,983 (-) ENTREZGENE CHM1_1 6 88,947,341 - 88,973,526 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,374,839 (-) NCBI
Sequence:
AGAGACAGCGCGAGCGGAGGGAGCGGCAGGGACTGCGCGAGCGGGACGAGGCGACGGGCGCCCGGGCTGGCGGAGACGGGCGGCCCCACGCCGGGCCAGGCGGGGCTCGCGGGAGGACCCAGTGAAGA
hide sequence
RefSeq Acc Id:
NM_033181 ⟹ NP_149421
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,145,337 (-) NCBI GRCh37 6 88,849,583 - 88,876,063 (-) NCBI Build 36 6 88,906,302 - 88,911,775 (-) NCBI Archive HuRef 6 86,064,928 - 86,090,983 (-) ENTREZGENE CHM1_1 6 88,947,341 - 88,952,815 (-) NCBI T2T-CHM13v2.0 6 89,348,358 - 89,353,832 (-) NCBI
Sequence:
GATTGCCCCCTGTGGGTCACTTTCTCAGTCATTTTGAGCTCAGCCTAATCAAAGACTGAGGTTA
hide sequence
RefSeq Acc Id:
XM_047418171 ⟹ XP_047274127
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,166,347 (-) NCBI
RefSeq Acc Id:
XM_047418172 ⟹ XP_047274128
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,152,129 (-) NCBI
RefSeq Acc Id:
XM_047418173 ⟹ XP_047274129
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 6 88,139,864 - 88,166,347 (-) NCBI
RefSeq Acc Id:
XM_054354204 ⟹ XP_054210179
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 6 89,348,358 - 89,374,839 (-) NCBI
RefSeq Acc Id:
XM_054354205 ⟹ XP_054210180
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 6 89,348,358 - 89,360,624 (-) NCBI
RefSeq Acc Id:
XM_054354206 ⟹ XP_054210181
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 6 89,348,358 - 89,374,839 (-) NCBI
RefSeq Acc Id:
NP_057167 ⟸ NM_016083
- Peptide Label:
isoform a
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
- Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGT
hide sequence
RefSeq Acc Id:
NP_001153698 ⟸ NM_001160226
- Peptide Label:
isoform a
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
- Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGT
hide sequence
RefSeq Acc Id:
NP_001153730 ⟸ NM_001160258
- Peptide Label:
isoform a
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
- Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGT
hide sequence
RefSeq Acc Id:
NP_001153731 ⟸ NM_001160259
- Peptide Label:
isoform a
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
- Sequence:
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGT
hide sequence
RefSeq Acc Id:
NP_149421 ⟸ NM_033181
- Peptide Label:
isoform b
- UniProtKB:
V5KA96 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
- Sequence:
MKSILDGLADTTFRTITTDLLGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIAVLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAV
hide sequence
RefSeq Acc Id:
NP_001357475 ⟸ NM_001370546
- Peptide Label:
isoform a
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001357476 ⟸ NM_001370547
- Peptide Label:
isoform a
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001357474 ⟸ NM_001370545
- Peptide Label:
isoform a
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001352799 ⟸ NM_001365870
- Peptide Label:
isoform a
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001352798 ⟸ NM_001365869
- Peptide Label:
isoform a
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001352801 ⟸ NM_001365872
- Peptide Label:
isoform a
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001352803 ⟸ NM_001365874
- Peptide Label:
isoform a
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSP00000412192 ⟸ ENST00000428600
Ensembl Acc Id:
ENSP00000420188 ⟸ ENST00000468898
Ensembl Acc Id:
ENSP00000355418 ⟸ ENST00000362094
Ensembl Acc Id:
ENSP00000446819 ⟸ ENST00000549890
Ensembl Acc Id:
ENSP00000446702 ⟸ ENST00000551417
Ensembl Acc Id:
ENSP00000358511 ⟸ ENST00000369499
Ensembl Acc Id:
ENSP00000358513 ⟸ ENST00000369501
RefSeq Acc Id:
XP_047274127 ⟸ XM_047418171
- Peptide Label:
isoform X1
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047274129 ⟸ XM_047418173
- Peptide Label:
isoform X1
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047274128 ⟸ XM_047418172
- Peptide Label:
isoform X1
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054210179 ⟸ XM_054354204
- Peptide Label:
isoform X1
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054210181 ⟸ XM_054354206
- Peptide Label:
isoform X1
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054210180 ⟸ XM_054354205
- Peptide Label:
isoform X1
- UniProtKB:
Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), Q9UNN0 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001411023 ⟸ NM_001424094
- Peptide Label:
isoform a
- UniProtKB:
Q9UNN0 (UniProtKB/Swiss-Prot), Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001411025 ⟸ NM_001424096
- Peptide Label:
isoform a
- UniProtKB:
Q9UNN0 (UniProtKB/Swiss-Prot), Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001411026 ⟸ NM_001424097
- Peptide Label:
isoform a
- UniProtKB:
Q9UNN0 (UniProtKB/Swiss-Prot), Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001411024 ⟸ NM_001424095
- Peptide Label:
isoform a
- UniProtKB:
Q9UNN0 (UniProtKB/Swiss-Prot), Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001411027 ⟸ NM_001424098
- Peptide Label:
isoform a
- UniProtKB:
Q9UNN0 (UniProtKB/Swiss-Prot), Q5UB37 (UniProtKB/Swiss-Prot), Q5JVL5 (UniProtKB/Swiss-Prot), Q4VBM6 (UniProtKB/Swiss-Prot), Q4PLI4 (UniProtKB/Swiss-Prot), Q495Z0 (UniProtKB/Swiss-Prot), Q13949 (UniProtKB/Swiss-Prot), P21554 (UniProtKB/Swiss-Prot), E1P512 (UniProtKB/Swiss-Prot), B2R9T4 (UniProtKB/Swiss-Prot), S5TLS4 (UniProtKB/TrEMBL), Q506J9 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-07-05
CNR1
cannabinoid receptor 1
CNR1
cannabinoid receptor 1 (brain)
Symbol and/or name change
5135510 APPROVED
