Symbol:
ADD3
Name:
adducin 3
RGD ID:
735411
HGNC Page
HGNC:245
Description:
Predicted to enable actin filament binding activity. Predicted to be involved in barbed-end actin filament capping. Located in plasma membrane. Implicated in spastic quadriplegic cerebral palsy 3.
Type:
protein-coding
RefSeq Status:
REVIEWED
Previously known as:
ADDL; adducin 3 (gamma); adducin 3, gamma; adducin-like protein 70; CPSQ3; gamma-adducin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Add3 (adducin 3) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Add3 (adducin 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Add3 (adducin 3) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
ADD3 (adducin 3) NCBI
Ortholog
Canis lupus familiaris (dog):
ADD3 (adducin 3) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Add3 (adducin 3) NCBI
Ortholog
Sus scrofa (pig):
ADD3 (adducin 3) HGNC
EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Chlorocebus sabaeus (green monkey):
ADD3 (adducin 3) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Add3 (adducin 3) NCBI
Ortholog
Other homologs 2
Mus musculus (house mouse):
Add1 (adducin 1) HGNC
OrthoMCL
Mus musculus (house mouse):
Add2 (adducin 2) HGNC
OrthoMCL
Rattus norvegicus (Norway rat):
Chrng (cholinergic receptor nicotinic gamma subunit) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Add3 (adducin 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Add3 (adducin 3)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
add3a (adducin 3 (gamma) a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
add3b (adducin 3 (gamma) b)
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB|ZFIN)
Caenorhabditis elegans (roundworm):
add-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
add-2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
hts
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
add3.L
Alliance
DIOPT (Xenbase)
Xenopus laevis (African clawed frog):
add3.S
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
add3
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 109,996,373 - 110,135,565 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 109,996,368 - 110,135,565 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 111,756,131 - 111,895,323 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 111,755,716 - 111,885,313 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 111,755,793 - 111,885,313 NCBI Celera 10 105,497,404 - 105,626,995 (+) NCBI Celera Cytogenetic Map 10 q25.1-q25.2 NCBI HuRef 10 105,396,619 - 105,526,176 (+) NCBI HuRef CHM1_1 10 112,047,392 - 112,177,067 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 110,880,187 - 111,019,428 (+) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
ADD3 Human 1,1-dichloroethene decreases expression ISO Add3 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of ADD3 mRNA CTD PMID:26682919 ADD3 Human 1,2-dimethylhydrazine decreases expression ISO Add3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of ADD3 mRNA CTD PMID:22206623 ADD3 Human 1-naphthyl isothiocyanate increases expression ISO Add3 (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in increased expression of ADD3 mRNA CTD PMID:25380136 ADD3 Human 17alpha-ethynylestradiol multiple interactions ISO Add3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ADD3 mRNA CTD PMID:17942748 ADD3 Human 17alpha-ethynylestradiol decreases expression ISO Add3 (Rattus norvegicus) 6480464 Ethinyl Estradiol results in decreased expression of ADD3 mRNA CTD PMID:15576828 and PMID:17557909 ADD3 Human 17alpha-ethynylestradiol increases expression ISO Add3 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ADD3 mRNA CTD PMID:17942748 ADD3 Human 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of ADD3 mRNA CTD PMID:19167446 and PMID:21185374 ADD3 Human 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of ADD3 mRNA CTD PMID:23019147 ADD3 Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Add3 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ADD3 mRNA and AHR protein affects the reaction [Tetrachlorodibenzodioxin results in increased expression of ADD3 mRNA] CTD PMID:17942748 and PMID:19465110 ADD3 Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Add3 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ADD3 mRNA CTD PMID:33387578 ADD3 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Add3 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of ADD3 mRNA CTD PMID:34747641 ADD3 Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Add3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ADD3 mRNA CTD PMID:21570461 ADD3 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of ADD3 mRNA CTD PMID:21802500 ADD3 Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Add3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ADD3 mRNA CTD PMID:19465110 ADD3 Human 2,4-dinitrotoluene affects expression ISO Add3 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of ADD3 mRNA CTD PMID:21346803 ADD3 Human 2-methylcholine affects expression EXP 6480464 beta-methylcholine affects the expression of ADD3 mRNA CTD PMID:21179406 ADD3 Human 3,3',4,4',5-pentachlorobiphenyl increases expression ISO Add3 (Rattus norvegicus) 6480464 3 more ... CTD PMID:23196670 ADD3 Human 3,4-methylenedioxymethamphetamine decreases expression ISO Add3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of ADD3 mRNA CTD PMID:26251327 ADD3 Human 3,4-methylenedioxymethamphetamine increases methylation ISO Add3 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased methylation of ADD3 promoter CTD PMID:26251327 ADD3 Human 3-isobutyl-1-methyl-7H-xanthine multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ADD3 mRNA CTD PMID:28628672 ADD3 Human 4,4'-diaminodiphenylmethane increases expression ISO Add3 (Rattus norvegicus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of ADD3 mRNA CTD PMID:25380136 ADD3 Human 4,4'-sulfonyldiphenol decreases methylation EXP 6480464 bisphenol S results in decreased methylation of ADD3 gene CTD PMID:31601247 ADD3 Human 5-fluorouracil affects response to substance EXP 6480464 ADD3 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 ADD3 Human 6-propyl-2-thiouracil decreases expression ISO Add3 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of ADD3 mRNA CTD PMID:24780913 ADD3 Human acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of ADD3 mRNA CTD PMID:32763439 ADD3 Human aflatoxin B1 increases expression ISO Add3 (Rattus norvegicus) 6480464 Aflatoxin B1 results in increased expression of ADD3 mRNA CTD PMID:23630614 ADD3 Human aflatoxin B1 increases methylation EXP 6480464 Aflatoxin B1 results in increased methylation of ADD3 intron CTD PMID:30157460 ADD3 Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of ADD3 mRNA CTD PMID:16054129 more ... ADD3 Human ammonium chloride affects expression ISO Add3 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of ADD3 mRNA CTD PMID:16483693 ADD3 Human antirheumatic drug increases expression EXP 6480464 Antirheumatic Agents results in increased expression of ADD3 mRNA CTD PMID:24449571 ADD3 Human aristolochic acid A decreases expression EXP 6480464 aristolochic acid I results in decreased expression of ADD3 mRNA CTD PMID:33212167 ADD3 Human arsane multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ADD3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ADD3 mRNA CTD PMID:39836092 ADD3 Human arsenic atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ADD3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ADD3 mRNA CTD PMID:39836092 ADD3 Human arsenite(3-) multiple interactions EXP 6480464 arsenite inhibits the reaction [G3BP1 protein binds to ADD3 mRNA] CTD PMID:32406909 ADD3 Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of ADD3 mRNA CTD PMID:21802500 ADD3 Human benzo[a]pyrene affects methylation EXP 6480464 Benzo(a)pyrene affects the methylation of ADD3 5' UTR and Benzo(a)pyrene affects the methylation of ADD3 promoter CTD PMID:27901495 and PMID:30157460 ADD3 Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of ADD3 exon and Benzo(a)pyrene results in increased methylation of ADD3 promoter CTD PMID:27901495 ADD3 Human benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of ADD3 mRNA CTD PMID:20106945 and PMID:21632981 ADD3 Human benzo[a]pyrene increases expression ISO Add3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ADD3 mRNA CTD PMID:22228805 ADD3 Human benzo[a]pyrene decreases expression ISO Add3 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ADD3 mRNA CTD PMID:22228805 ADD3 Human benzo[a]pyrene multiple interactions ISO Add3 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ADD3 mRNA and AHR protein affects the reaction [Benzo(a)pyrene affects the expression of ADD3 mRNA] CTD PMID:22228805 and PMID:27858113 ADD3 Human benzo[a]pyrene diol epoxide I increases expression EXP 6480464 7 more ... CTD PMID:19150397 ADD3 Human benzo[a]pyrene diol epoxide I decreases expression EXP 6480464 7 more ... CTD PMID:20018196 ADD3 Human benzo[b]fluoranthene increases expression ISO Add3 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of ADD3 mRNA CTD PMID:26377693 ADD3 Human benzo[b]fluoranthene multiple interactions ISO Add3 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ADD3 mRNA CTD PMID:27858113 ADD3 Human beta-lapachone increases expression EXP 6480464 beta-lapachone results in increased expression of ADD3 mRNA CTD PMID:38218311 ADD3 Human bexarotene increases expression EXP 6480464 bexarotene results in increased expression of ADD3 mRNA CTD PMID:17178900 ADD3 Human bis(2-ethylhexyl) phthalate decreases expression ISO Add3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of ADD3 mRNA CTD PMID:33754040 ADD3 Human bisphenol A increases expression ISO Add3 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of ADD3 mRNA CTD PMID:25181051 ADD3 Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ADD3 protein CTD PMID:34186270 and PMID:37567409 ADD3 Human bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of ADD3 gene CTD PMID:31601247 ADD3 Human bisphenol A decreases expression ISO Add3 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of ADD3 mRNA CTD PMID:30816183 more ... ADD3 Human bisphenol A multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ADD3 mRNA CTD PMID:28628672 ADD3 Human bisphenol AF increases expression EXP 6480464 bisphenol AF results in increased expression of ADD3 protein CTD PMID:34186270 ADD3 Human cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of ADD3 mRNA CTD PMID:38568856 ADD3 Human caffeine affects phosphorylation EXP 6480464 Caffeine affects the phosphorylation of ADD3 protein CTD PMID:35688186 ADD3 Human carbon nanotube decreases expression ISO Add3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 ADD3 Human chloroprene increases expression ISO Add3 (Rattus norvegicus) 6480464 Chloroprene results in increased expression of ADD3 mRNA CTD PMID:23125180 ADD3 Human choline multiple interactions ISO Add3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ADD3 gene CTD PMID:20938992 ADD3 Human chrysene multiple interactions ISO Add3 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ADD3 mRNA CTD PMID:27858113 ADD3 Human cisplatin multiple interactions EXP 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of ADD3 mRNA CTD PMID:27392435 ADD3 Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of ADD3 mRNA CTD PMID:27392435 and PMID:27594783 ADD3 Human cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of ADD3 mRNA CTD PMID:19376846 ADD3 Human copper atom multiple interactions ISO Add3 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of ADD3 mRNA CTD PMID:15467011 ADD3 Human copper(0) multiple interactions ISO Add3 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of ADD3 mRNA CTD PMID:15467011 ADD3 Human copper(II) chloride decreases expression EXP 6480464 cupric chloride results in decreased expression of ADD3 mRNA CTD PMID:38568856 ADD3 Human copper(II) sulfate decreases expression EXP 6480464 Copper Sulfate results in decreased expression of ADD3 mRNA CTD PMID:19549813 ADD3 Human coumarin decreases phosphorylation EXP 6480464 coumarin results in decreased phosphorylation of ADD3 protein CTD PMID:35688186 ADD3 Human coumestrol increases expression EXP 6480464 Coumestrol results in increased expression of ADD3 mRNA CTD PMID:19167446 ADD3 Human coumestrol multiple interactions EXP 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 ADD3 Human Cuprizon increases expression ISO Add3 (Rattus norvegicus) 6480464 Cuprizone results in increased expression of ADD3 mRNA CTD PMID:26577399 ADD3 Human cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of ADD3 mRNA CTD PMID:20106945 more ... ADD3 Human dexamethasone increases expression EXP 6480464 Dexamethasone results in increased expression of ADD3 mRNA CTD PMID:25047013 ADD3 Human dexamethasone multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ADD3 mRNA CTD PMID:28628672 ADD3 Human dibutyl phthalate decreases expression ISO Add3 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of ADD3 mRNA CTD PMID:21266533 ADD3 Human diuron decreases expression ISO Add3 (Rattus norvegicus) 6480464 Diuron results in decreased expression of ADD3 mRNA CTD PMID:25152437 ADD3 Human doxorubicin affects response to substance EXP 6480464 ADD3 protein affects the susceptibility to Doxorubicin CTD PMID:16217747 ADD3 Human elemental selenium decreases expression EXP 6480464 Selenium results in decreased expression of ADD3 mRNA CTD PMID:19244175 ADD3 Human endosulfan decreases expression ISO Add3 (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of ADD3 mRNA CTD PMID:29391264 ADD3 Human Enterolactone multiple interactions EXP 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of ADD3 mRNA CTD PMID:19167446 ADD3 Human ethanol increases expression ISO Add3 (Mus musculus) 6480464 Ethanol results in increased expression of ADD3 mRNA CTD PMID:30319688 ADD3 Human flavonoids decreases expression ISO Add3 (Rattus norvegicus) 6480464 Flavonoids results in decreased expression of ADD3 mRNA CTD PMID:18035473 ADD3 Human flusilazole increases expression ISO Add3 (Rattus norvegicus) 6480464 flusilazole results in increased expression of ADD3 mRNA CTD PMID:28263823 ADD3 Human folic acid multiple interactions ISO Add3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ADD3 gene CTD PMID:20938992 ADD3 Human FR900359 affects phosphorylation EXP 6480464 FR900359 affects the phosphorylation of ADD3 protein CTD PMID:37730182 ADD3 Human furan increases expression ISO Add3 (Rattus norvegicus) 6480464 furan results in increased expression of ADD3 mRNA CTD PMID:27387713 ADD3 Human gamma-hexachlorocyclohexane affects expression ISO Add3 (Rattus norvegicus) 6480464 Hexachlorocyclohexane affects the expression of ADD3 mRNA CTD PMID:17785943 ADD3 Human gentamycin increases expression ISO Add3 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of ADD3 mRNA CTD PMID:22061828 ADD3 Human gentamycin decreases expression ISO Add3 (Rattus norvegicus) 6480464 Gentamicins results in decreased expression of ADD3 mRNA CTD PMID:33387578 ADD3 Human glyphosate increases methylation ISO Add3 (Rattus norvegicus) 6480464 Glyphosate results in increased methylation of ADD3 gene CTD PMID:31011160 ADD3 Human hydrogen peroxide increases expression EXP 6480464 Hydrogen Peroxide results in increased expression of ADD3 mRNA CTD PMID:18951874 ADD3 Human indometacin multiple interactions EXP 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of ADD3 mRNA CTD PMID:28628672 ADD3 Human irinotecan decreases expression EXP 6480464 Irinotecan metabolite results in decreased expression of ADD3 mRNA and Irinotecan results in decreased expression of ADD3 mRNA CTD PMID:15956246 ADD3 Human isoprenaline decreases expression ISO Add3 (Mus musculus) 6480464 Isoproterenol results in decreased expression of ADD3 mRNA CTD PMID:21335049 ADD3 Human ivermectin decreases expression EXP 6480464 Ivermectin results in decreased expression of ADD3 protein CTD PMID:32959892 ADD3 Human L-methionine multiple interactions ISO Add3 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of ADD3 gene CTD PMID:20938992 ADD3 Human lipopolysaccharide multiple interactions EXP 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of ADD3 mRNA CTD PMID:35811015 ADD3 Human malathion increases expression ISO Add3 (Rattus norvegicus) 6480464 Malathion results in increased expression of ADD3 mRNA CTD PMID:19784758 ADD3 Human manganese atom multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ADD3 mRNA CTD PMID:39836092 ADD3 Human manganese(0) multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ADD3 mRNA CTD PMID:39836092 ADD3 Human manganese(II) chloride multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ADD3 mRNA CTD PMID:39836092 ADD3 Human menadione affects expression EXP 6480464 Vitamin K 3 affects the expression of ADD3 mRNA CTD PMID:20044591 ADD3 Human Mesaconitine decreases expression ISO Add3 (Rattus norvegicus) 6480464 mesaconitine results in decreased expression of ADD3 protein CTD PMID:37182599 ADD3 Human methylseleninic acid increases expression EXP 6480464 methylselenic acid results in increased expression of ADD3 mRNA CTD PMID:12517777 ADD3 Human mono(2-ethylhexyl) phthalate decreases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of ADD3 mRNA CTD PMID:38685446 ADD3 Human N-nitrosodimethylamine increases expression ISO Add3 (Rattus norvegicus) 6480464 Dimethylnitrosamine results in increased expression of ADD3 mRNA CTD PMID:25380136 ADD3 Human nickel sulfate decreases expression EXP 6480464 nickel sulfate results in decreased expression of ADD3 mRNA CTD PMID:18651567 ADD3 Human ozone multiple interactions ISO Add3 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of ADD3 mRNA CTD PMID:34911549 ADD3 Human ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of ADD3 mRNA CTD PMID:35430440 ADD3 Human paclitaxel affects response to substance EXP 6480464 ADD3 protein affects the susceptibility to Paclitaxel CTD PMID:16217747 ADD3 Human paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of ADD3 mRNA CTD PMID:22230336 ADD3 Human paracetamol increases expression ISO Add3 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of ADD3 mRNA CTD PMID:33387578 ADD3 Human parathion increases expression ISO Add3 (Rattus norvegicus) 6480464 Parathion results in increased expression of ADD3 mRNA CTD PMID:19784758 ADD3 Human parathion-methyl decreases expression ISO Add3 (Rattus norvegicus) 6480464 Methyl Parathion results in decreased expression of ADD3 mRNA CTD PMID:19784758 ADD3 Human parathion-methyl increases expression ISO Add3 (Rattus norvegicus) 6480464 Methyl Parathion results in increased expression of ADD3 mRNA CTD PMID:19784758 ADD3 Human parathion-methyl affects expression ISO Add3 (Rattus norvegicus) 6480464 Methyl Parathion affects the expression of ADD3 mRNA CTD PMID:19784758 ADD3 Human phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of ADD3 mRNA CTD PMID:19159669 ADD3 Human phenobarbital affects expression ISO Add3 (Mus musculus) 6480464 Phenobarbital affects the expression of ADD3 mRNA CTD PMID:23091169 ADD3 Human pirinixic acid multiple interactions ISO Add3 (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of ADD3 mRNA CTD PMID:19710929 ADD3 Human pirinixic acid increases expression ISO Add3 (Mus musculus) 6480464 pirinixic acid results in increased expression of ADD3 mRNA CTD PMID:18301758 and PMID:23811191 ADD3 Human potassium chromate decreases expression EXP 6480464 potassium chromate(VI) results in decreased expression of ADD3 mRNA CTD PMID:22714537 ADD3 Human quercetin decreases expression EXP 6480464 Quercetin results in decreased expression of ADD3 mRNA CTD PMID:21632981 ADD3 Human resveratrol multiple interactions EXP 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of ADD3 mRNA CTD PMID:19167446 ADD3 Human S-(1,2-dichlorovinyl)-L-cysteine multiple interactions EXP 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of ADD3 mRNA CTD PMID:35811015 ADD3 Human S-butyl-DL-homocysteine (S,R)-sulfoximine increases expression ISO Add3 (Mus musculus) 6480464 Buthionine Sulfoximine results in increased expression of ADD3 mRNA CTD PMID:15878706 ADD3 Human selenium atom decreases expression EXP 6480464 Selenium results in decreased expression of ADD3 mRNA CTD PMID:19244175 ADD3 Human silicon dioxide decreases expression EXP 6480464 Silicon Dioxide analog results in decreased expression of ADD3 mRNA CTD PMID:25895662 ADD3 Human sodium arsenite increases expression ISO Add3 (Mus musculus) 6480464 sodium arsenite results in increased expression of ADD3 protein CTD PMID:29044176 ADD3 Human sodium arsenite multiple interactions EXP 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in decreased expression of ADD3 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of ADD3 mRNA CTD PMID:39836092 ADD3 Human sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of ADD3 mRNA CTD PMID:34032870 ADD3 Human succimer multiple interactions ISO Add3 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of ADD3 mRNA CTD PMID:21641980 ADD3 Human sunitinib increases expression EXP 6480464 Sunitinib results in increased expression of ADD3 mRNA CTD PMID:31533062 ADD3 Human tamoxifen increases expression ISO Add3 (Rattus norvegicus) 6480464 Tamoxifen results in increased expression of ADD3 protein modified form CTD PMID:17901229 ADD3 Human tert-butyl hydroperoxide decreases expression EXP 6480464 tert-Butylhydroperoxide results in decreased expression of ADD3 mRNA CTD PMID:15336504 ADD3 Human tetrachloromethane decreases expression ISO Add3 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of ADD3 mRNA CTD PMID:17484886 ADD3 Human tetraphene multiple interactions ISO Add3 (Mus musculus) 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of ADD3 mRNA CTD PMID:27858113 ADD3 Human thapsigargin decreases expression ISO Add3 (Rattus norvegicus) 6480464 Thapsigargin results in decreased expression of ADD3 protein CTD PMID:35544339 ADD3 Human thiram decreases expression EXP 6480464 Thiram results in decreased expression of ADD3 mRNA CTD PMID:38568856 ADD3 Human titanium dioxide decreases methylation ISO Add3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ADD3 promoter CTD PMID:35295148 ADD3 Human topotecan affects response to substance EXP 6480464 ADD3 protein affects the susceptibility to Topotecan CTD PMID:16217747 ADD3 Human trichostatin A increases expression ISO Add3 (Rattus norvegicus) 6480464 trichostatin A results in increased expression of ADD3 mRNA CTD PMID:12445420 ADD3 Human triphenyl phosphate affects expression EXP 6480464 triphenyl phosphate affects the expression of ADD3 mRNA CTD PMID:37042841 ADD3 Human trovafloxacin decreases expression ISO Add3 (Mus musculus) 6480464 trovafloxacin results in decreased expression of ADD3 mRNA CTD PMID:35537566 ADD3 Human valproic acid affects expression ISO Add3 (Mus musculus) 6480464 Valproic Acid affects the expression of ADD3 mRNA CTD PMID:17963808 ADD3 Human valproic acid multiple interactions EXP 6480464 CEBPA protein affects the reaction [Valproic Acid results in increased expression of ADD3 mRNA] CTD PMID:32623605 ADD3 Human valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of ADD3 gene CTD PMID:29154799 ADD3 Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of ADD3 mRNA CTD PMID:25979313 ADD3 Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of ADD3 mRNA CTD PMID:32623605 ADD3 Human vincaleukoblastine affects response to substance EXP 6480464 ADD3 protein affects the susceptibility to Vinblastine CTD PMID:16217747 ADD3 Human vinclozolin affects expression ISO Add3 (Rattus norvegicus) 6480464 vinclozolin affects the expression of ADD3 mRNA CTD PMID:19015723 ADD3 Human vitamin E decreases expression EXP 6480464 Vitamin E results in decreased expression of ADD3 mRNA CTD PMID:19244175
1,1-dichloroethene (ISO) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2-methylcholine (EXP) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP) 5-fluorouracil (EXP) 6-propyl-2-thiouracil (ISO) acrylamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (EXP) ammonium chloride (ISO) antirheumatic drug (EXP) aristolochic acid A (EXP) arsane (EXP) arsenic atom (EXP) arsenite(3-) (EXP) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (EXP) benzo[b]fluoranthene (ISO) beta-lapachone (EXP) bexarotene (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP) cadmium dichloride (EXP) caffeine (EXP) carbon nanotube (ISO) chloroprene (ISO) choline (ISO) chrysene (ISO) cisplatin (EXP) cobalt dichloride (EXP) copper atom (ISO) copper(0) (ISO) copper(II) chloride (EXP) copper(II) sulfate (EXP) coumarin (EXP) coumestrol (EXP) Cuprizon (ISO) cyclosporin A (EXP) dexamethasone (EXP) dibutyl phthalate (ISO) diuron (ISO) doxorubicin (EXP) elemental selenium (EXP) endosulfan (ISO) Enterolactone (EXP) ethanol (ISO) flavonoids (ISO) flusilazole (ISO) folic acid (ISO) FR900359 (EXP) furan (ISO) gamma-hexachlorocyclohexane (ISO) gentamycin (ISO) glyphosate (ISO) hydrogen peroxide (EXP) indometacin (EXP) irinotecan (EXP) isoprenaline (ISO) ivermectin (EXP) L-methionine (ISO) lipopolysaccharide (EXP) malathion (ISO) manganese atom (EXP) manganese(0) (EXP) manganese(II) chloride (EXP) menadione (EXP) Mesaconitine (ISO) methylseleninic acid (EXP) mono(2-ethylhexyl) phthalate (EXP) N-nitrosodimethylamine (ISO) nickel sulfate (EXP) ozone (EXP,ISO) paclitaxel (EXP) paracetamol (EXP,ISO) parathion (ISO) parathion-methyl (ISO) phenobarbital (EXP,ISO) pirinixic acid (ISO) potassium chromate (EXP) quercetin (EXP) resveratrol (EXP) S-(1,2-dichlorovinyl)-L-cysteine (EXP) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) selenium atom (EXP) silicon dioxide (EXP) sodium arsenite (EXP,ISO) succimer (ISO) sunitinib (EXP) tamoxifen (ISO) tert-butyl hydroperoxide (EXP) tetrachloromethane (ISO) tetraphene (ISO) thapsigargin (ISO) thiram (EXP) titanium dioxide (ISO) topotecan (EXP) trichostatin A (ISO) triphenyl phosphate (EXP) trovafloxacin (ISO) valproic acid (EXP,ISO) vincaleukoblastine (EXP) vinclozolin (ISO) vitamin E (EXP)
1.
Microarray analysis of changes in renal phenotype in the ethylene glycol rat model of urolithiasis: potential and pitfalls.
Chen DH, etal., BJU Int. 2004 Sep;94(4):637-50.
2.
A Mutation in γ-Adducin Impairs Autoregulation of Renal Blood Flow and Promotes the Development of Kidney Disease.
Fan F, etal., J Am Soc Nephrol. 2020 Apr;31(4):687-700. doi: 10.1681/ASN.2019080784. Epub 2020 Feb 6.
3.
Targeted disruption of the beta adducin gene (Add2) causes red blood cell spherocytosis in mice.
Gilligan DM, etal., Proc Natl Acad Sci U S A 1999 Sep 14;96(19):10717-22.
4.
GOAs Human GO annotations
GOA_HUMAN data from the GO Consortium
5.
NUP98 is fused to adducin 3 in a patient with T-cell acute lymphoblastic leukemia and myeloid markers, with a new translocation t(10;11)(q25;p15).
Lahortiga I, etal., Cancer Res 2003 Jun 15;63(12):3079-83.
6.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
RGD HPO Phenotype Annotation Pipeline
RGD automated import pipeline for human HPO-to-gene-to-disease annotations
ADD3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 109,996,373 - 110,135,565 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 109,996,368 - 110,135,565 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 111,756,131 - 111,895,323 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 111,755,716 - 111,885,313 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 111,755,793 - 111,885,313 NCBI Celera 10 105,497,404 - 105,626,995 (+) NCBI Celera Cytogenetic Map 10 q25.1-q25.2 NCBI HuRef 10 105,396,619 - 105,526,176 (+) NCBI HuRef CHM1_1 10 112,047,392 - 112,177,067 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 110,880,187 - 111,019,428 (+) NCBI T2T-CHM13v2.0
Add3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 53,128,874 - 53,235,518 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 53,128,874 - 53,235,830 (+) Ensembl GRCm39 Ensembl GRCm38 19 53,140,443 - 53,247,326 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 53,140,443 - 53,247,399 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 53,214,935 - 53,321,889 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 53,256,726 - 53,300,399 (+) NCBI MGSCv36 mm8 Celera 19 55,321,358 - 55,428,774 (+) NCBI Celera Cytogenetic Map 19 D2 NCBI cM Map 19 47.18 NCBI
Add3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 262,152,722 - 262,260,504 (+) NCBI GRCr8 mRatBN7.2 1 252,147,341 - 252,255,126 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 252,147,386 - 252,255,124 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 260,336,161 - 260,443,763 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 267,042,224 - 267,149,829 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 259,697,436 - 259,805,286 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 273,854,195 - 273,961,982 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 273,854,248 - 273,961,982 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 281,267,424 - 281,375,203 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 259,347,673 - 259,455,407 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 259,560,471 - 259,923,891 (-) NCBI Celera 1 247,872,140 - 247,979,623 (+) NCBI Celera Cytogenetic Map 1 q55 NCBI
Add3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955485 1,216,435 - 1,353,953 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955485 1,216,435 - 1,273,275 (-) NCBI ChiLan1.0 ChiLan1.0
ADD3 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 121,884,928 - 122,014,764 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 121,890,333 - 122,020,100 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 106,597,693 - 106,727,494 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 110,048,680 - 110,178,671 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 110,123,270 - 110,178,671 (+) Ensembl panpan1.1 panPan2
ADD3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 21,402,068 - 21,527,006 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 21,403,680 - 21,525,063 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 21,545,130 - 21,669,800 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 21,916,580 - 22,041,306 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 21,875,987 - 22,041,302 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 21,477,401 - 21,602,290 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 21,481,987 - 21,606,180 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 21,617,201 - 21,742,113 (+) NCBI UU_Cfam_GSD_1.0
Add3 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 24,519,105 - 24,632,420 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936486 928,522 - 1,043,084 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936486 928,956 - 1,042,168 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ADD3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 120,451,575 - 120,583,722 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 120,451,421 - 120,583,725 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 131,288,509 - 131,420,807 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ADD3 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 102,930,270 - 103,056,558 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 103,010,713 - 103,057,101 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 64,133,099 - 64,259,617 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Add3
.
Predicted Target Of
Count of predictions: 3191 Count of miRNA genes: 1033 Interacting mature miRNAs: 1266 Transcripts: ENST00000277900, ENST00000356080, ENST00000360162, ENST00000459738, ENST00000468251, ENST00000468345, ENST00000472568, ENST00000473669, ENST00000475954, ENST00000479805, ENST00000484622, ENST00000486014, ENST00000487085, ENST00000488104, ENST00000488799, ENST00000488837, ENST00000492162, ENST00000495661, ENST00000496517, ENST00000497125 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
597108983 GWAS1205057_H self reported educational attainment QTL GWAS1205057 (human) 9e-14 self reported educational attainment 10 110010255 110010256 Human 597225531 GWAS1321605_H self reported educational attainment QTL GWAS1321605 (human) 1e-13 self reported educational attainment 10 110010255 110010256 Human 597514425 GWAS1610499_H educational attainment QTL GWAS1610499 (human) 6e-17 educational attainment 10 110001593 110001594 Human 597370846 GWAS1466920_H eosinophil count QTL GWAS1466920 (human) 2e-13 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 10 110005028 110005029 Human 597045361 GWAS1141435_H cutaneous melanoma QTL GWAS1141435 (human) 0.000003 cutaneous melanoma 10 110130021 110130022 Human 597045213 GWAS1141287_H cutaneous melanoma, hair color QTL GWAS1141287 (human) 3e-11 cutaneous melanoma, hair color 10 110130021 110130022 Human 597029850 GWAS1125924_H bipolar disorder QTL GWAS1125924 (human) 3e-08 bipolar disorder 10 110015049 110015050 Human 597180744 GWAS1276818_H laminin subunit alpha-4 measurement QTL GWAS1276818 (human) 3e-18 laminin subunit alpha-4 measurement 10 110080967 110080968 Human 597172328 GWAS1268402_H heparan sulfate glucosamine 3-O-sulfotransferase 3A1 measurement QTL GWAS1268402 (human) 4e-67 heparan sulfate glucosamine 3-O-sulfotransferase 3A1 measurement 10 110080967 110080968 Human 597045799 GWAS1141873_H Abnormality of refraction QTL GWAS1141873 (human) 2e-14 Abnormality of refraction 10 110095681 110095682 Human 597519752 GWAS1615826_H biliary atresia QTL GWAS1615826 (human) 6e-09 biliary atresia 10 109998033 109998034 Human 597587945 GWAS1644805_H eosinophil count QTL GWAS1644805 (human) 4e-12 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 10 110010255 110010256 Human 597215360 GWAS1311434_H self reported educational attainment QTL GWAS1311434 (human) 8e-10 self reported educational attainment 10 110075933 110075934 Human 597225697 GWAS1321771_H smoking status measurement QTL GWAS1321771 (human) 1e-09 smoking status measurement 10 110095681 110095682 Human 597055372 GWAS1151446_H FEV/FVC ratio QTL GWAS1151446 (human) 7e-10 FEV/FVC ratio forced expiratory volume to forced vital capacity ratio (CMO:0000241) 10 110013665 110013666 Human 597249090 GWAS1345164_H breast carcinoma QTL GWAS1345164 (human) 0.000004 mammary gland integrity trait (VT:0010552) 10 110044796 110044797 Human 597057257 GWAS1153331_H adolescent idiopathic scoliosis QTL GWAS1153331 (human) 5e-29 adolescent idiopathic scoliosis 10 110090745 110090746 Human
D10S543
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,839,136 - 111,839,278 UniSTS GRCh37 GRCh37 10 111,839,017 - 111,839,125 UniSTS GRCh37 Build 36 10 111,829,007 - 111,829,115 RGD NCBI36 Celera 10 105,570,690 - 105,570,798 RGD Celera 10 105,570,809 - 105,570,949 UniSTS Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,469,725 - 105,469,833 UniSTS HuRef 10 105,469,844 - 105,469,972 UniSTS Marshfield Genetic Map 10 128.73 RGD Genethon Genetic Map 10 136.3 UniSTS deCODE Assembly Map 10 127.43 UniSTS Stanford-G3 RH Map 10 5136.0 UniSTS Whitehead-YAC Contig Map 10 UniSTS NCBI RH Map 10 1179.0 UniSTS GeneMap99-G3 RH Map 10 5372.0 UniSTS
1186
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,863,076 - 111,863,167 UniSTS GRCh37 Build 36 10 111,853,066 - 111,853,157 RGD NCBI36 Celera 10 105,594,747 - 105,594,838 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,493,769 - 105,493,860 UniSTS GeneMap99-GB4 RH Map 10 504.55 UniSTS NCBI RH Map 10 1179.0 UniSTS
RH44681
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,870,139 - 111,870,297 UniSTS GRCh37 Build 36 10 111,860,129 - 111,860,287 RGD NCBI36 Celera 10 105,601,810 - 105,601,968 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,500,832 - 105,500,990 UniSTS GeneMap99-GB4 RH Map 10 506.99 UniSTS NCBI RH Map 10 1179.0 UniSTS
D10S1199
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,879,201 - 111,879,506 UniSTS GRCh37 Build 36 10 111,869,191 - 111,869,496 RGD NCBI36 Celera 10 105,610,873 - 105,611,178 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,510,054 - 105,510,359 UniSTS Stanford-G3 RH Map 10 5139.0 UniSTS Whitehead-RH Map 10 606.9 UniSTS Whitehead-YAC Contig Map 10 UniSTS NCBI RH Map 10 1179.0 UniSTS
STS-AA018233
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,893,797 - 111,894,042 UniSTS GRCh37 Build 36 10 111,883,787 - 111,884,032 RGD NCBI36 Celera 10 105,625,469 - 105,625,714 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,524,650 - 105,524,895 UniSTS GeneMap99-GB4 RH Map 10 509.38 UniSTS NCBI RH Map 10 1179.0 UniSTS
RH79633
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,893,125 - 111,893,341 UniSTS GRCh37 Build 36 10 111,883,115 - 111,883,331 RGD NCBI36 Celera 10 105,624,797 - 105,625,013 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,523,978 - 105,524,194 UniSTS GeneMap99-GB4 RH Map 10 511.73 UniSTS
RH104052
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,785,483 - 111,785,627 UniSTS GRCh37 Build 36 10 111,775,473 - 111,775,617 RGD NCBI36 Celera 10 105,517,164 - 105,517,308 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,416,380 - 105,416,524 UniSTS GeneMap99-GB4 RH Map 10 506.79 UniSTS
RH121559
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,794,577 - 111,794,906 UniSTS GRCh37 Build 36 10 111,784,567 - 111,784,896 RGD NCBI36 Celera 10 105,526,258 - 105,526,587 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,425,474 - 105,425,803 UniSTS TNG Radiation Hybrid Map 10 54148.0 UniSTS
RH121628
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,794,578 - 111,794,901 UniSTS GRCh37 Build 36 10 111,784,568 - 111,784,891 RGD NCBI36 Celera 10 105,526,259 - 105,526,582 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,425,475 - 105,425,798 UniSTS TNG Radiation Hybrid Map 10 54148.0 UniSTS
SHGC-108129
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,777,222 - 111,777,334 UniSTS GRCh37 Build 36 10 111,767,212 - 111,767,324 RGD NCBI36 Celera 10 105,508,899 - 105,509,011 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,408,114 - 105,408,226 UniSTS TNG Radiation Hybrid Map 10 54142.0 UniSTS
A007G14
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,860,383 - 111,860,597 UniSTS GRCh37 Build 36 10 111,850,373 - 111,850,587 RGD NCBI36 Celera 10 105,592,054 - 105,592,268 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,491,076 - 105,491,290 UniSTS GeneMap99-GB4 RH Map 10 504.55 UniSTS NCBI RH Map 10 1179.0 UniSTS
D10S408E
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,863,064 - 111,863,123 UniSTS GRCh37 Build 36 10 111,853,054 - 111,853,113 RGD NCBI36 Celera 10 105,594,735 - 105,594,794 RGD HuRef 10 105,493,757 - 105,493,816 UniSTS
RH78354
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,895,069 - 111,895,230 UniSTS GRCh37 Build 36 10 111,885,059 - 111,885,220 RGD NCBI36 Celera 10 105,626,741 - 105,626,902 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,525,922 - 105,526,083 UniSTS GeneMap99-GB4 RH Map 10 501.93 UniSTS NCBI RH Map 10 1179.0 UniSTS
D10S2337
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,870,783 - 111,870,878 UniSTS GRCh37 Build 36 10 111,860,773 - 111,860,868 RGD NCBI36 Celera 10 105,602,454 - 105,602,549 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,501,476 - 105,501,571 UniSTS Stanford-G3 RH Map 10 5143.0 UniSTS NCBI RH Map 10 1179.0 UniSTS
SHGC-33439
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,870,273 - 111,870,422 UniSTS GRCh37 Build 36 10 111,860,263 - 111,860,412 RGD NCBI36 Celera 10 105,601,944 - 105,602,093 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,500,966 - 105,501,115 UniSTS TNG Radiation Hybrid Map 10 54111.0 UniSTS GeneMap99-GB4 RH Map 10 504.55 UniSTS Whitehead-RH Map 10 604.1 UniSTS NCBI RH Map 10 1179.0 UniSTS GeneMap99-G3 RH Map 10 5372.0 UniSTS
STS-N93746
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,893,092 - 111,893,281 UniSTS GRCh37 Build 36 10 111,883,082 - 111,883,271 RGD NCBI36 Celera 10 105,624,764 - 105,624,953 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,523,945 - 105,524,134 UniSTS GeneMap99-GB4 RH Map 10 506.99 UniSTS NCBI RH Map 10 1179.0 UniSTS
HSC2MD022
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,893,775 - 111,893,978 UniSTS GRCh37 Build 36 10 111,883,765 - 111,883,968 RGD NCBI36 Celera 10 105,625,447 - 105,625,650 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,524,628 - 105,524,831 UniSTS GeneMap99-GB4 RH Map 10 511.25 UniSTS Whitehead-RH Map 10 608.2 UniSTS NCBI RH Map 10 1179.0 UniSTS
A008R19
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,870,154 - 111,870,304 UniSTS GRCh37 Build 36 10 111,860,144 - 111,860,294 RGD NCBI36 Celera 10 105,601,825 - 105,601,975 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,500,847 - 105,500,997 UniSTS GeneMap99-GB4 RH Map 10 504.75 UniSTS NCBI RH Map 10 1179.0 UniSTS
RH47300
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,893,943 - 111,894,048 UniSTS GRCh37 Build 36 10 111,883,933 - 111,884,038 RGD NCBI36 Celera 10 105,625,615 - 105,625,720 RGD Cytogenetic Map 10 q25.2 UniSTS HuRef 10 105,524,796 - 105,524,901 UniSTS GeneMap99-GB4 RH Map 10 506.79 UniSTS NCBI RH Map 10 1179.0 UniSTS
ADD3__4199
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,893,450 - 111,894,235 UniSTS GRCh37 Build 36 10 111,883,440 - 111,884,225 RGD NCBI36 Celera 10 105,625,122 - 105,625,907 RGD HuRef 10 105,524,303 - 105,525,088 UniSTS
D8S2279
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 21 q22.12 UniSTS Cytogenetic Map 15 q13 UniSTS Cytogenetic Map 9 q32 UniSTS Cytogenetic Map 15 q22.3 UniSTS Cytogenetic Map 17 p12 UniSTS Cytogenetic Map 21 q21.3 UniSTS Cytogenetic Map 3 p22-p21.3 UniSTS Cytogenetic Map 1 q21.1 UniSTS Cytogenetic Map 2 q24.2 UniSTS Cytogenetic Map 17 q24.2 UniSTS Cytogenetic Map 1 q32 UniSTS Cytogenetic Map 3 p25.3 UniSTS Cytogenetic Map 20 q13.3 UniSTS Cytogenetic Map 2 q31.1 UniSTS Cytogenetic Map 1 q21 UniSTS Cytogenetic Map 3 p14.1 UniSTS Cytogenetic Map 2 q37.3 UniSTS Cytogenetic Map 7 p14.1 UniSTS Cytogenetic Map 2 q22.3 UniSTS Cytogenetic Map 15 q13.2 UniSTS Cytogenetic Map 12 q24.1 UniSTS Cytogenetic Map 7 p15.2 UniSTS Cytogenetic Map 5 q31.2 UniSTS Cytogenetic Map 2 p25.2 UniSTS Cytogenetic Map 3 p24.3 UniSTS Cytogenetic Map 17 q25.3 UniSTS Cytogenetic Map 15 q22.31 UniSTS Cytogenetic Map 5 q14 UniSTS Cytogenetic Map 5 q31 UniSTS Cytogenetic Map 1 p36.32 UniSTS Cytogenetic Map 1 q42.12 UniSTS Cytogenetic Map 7 q21.11 UniSTS Cytogenetic Map 9 q34.2 UniSTS Cytogenetic Map 19 q13.3 UniSTS Cytogenetic Map 22 q13.33 UniSTS Cytogenetic Map 8 q22.3 UniSTS Cytogenetic Map 6 p21.1-p12 UniSTS Cytogenetic Map 1 p36.13 UniSTS Cytogenetic Map 7 q36.3 UniSTS Cytogenetic Map 2 p25.1 UniSTS Cytogenetic Map 7 p21.3 UniSTS Cytogenetic Map 4 q12 UniSTS Cytogenetic Map 22 q11.22 UniSTS Cytogenetic Map 11 p13 UniSTS Cytogenetic Map 1 q12 UniSTS Cytogenetic Map 8 p23 UniSTS Cytogenetic Map 11 q13.2-q13.3 UniSTS Cytogenetic Map 13 q14.1-q14.3 UniSTS Cytogenetic Map 3 q22-q24 UniSTS Cytogenetic Map 3 q13.1-q13.2 UniSTS Cytogenetic Map 16 q24 UniSTS Cytogenetic Map 5 q23.3-q31.1 UniSTS Cytogenetic Map 8 p21.3 UniSTS Cytogenetic Map 14 q32.3 UniSTS Cytogenetic Map 7 q11.23 UniSTS Cytogenetic Map 7 q32 UniSTS Cytogenetic Map 14 q32.33 UniSTS Cytogenetic Map 19 p13.2 UniSTS Cytogenetic Map 9 q34.3 UniSTS Cytogenetic Map 1 p32.3 UniSTS Cytogenetic Map 17 q11 UniSTS Cytogenetic Map 17 p13.1-p12 UniSTS Cytogenetic Map 18 q21.33 UniSTS Cytogenetic Map 19 p13.12 UniSTS Cytogenetic Map 5 q14.1 UniSTS Cytogenetic Map 14 q24.3 UniSTS Cytogenetic Map 1 q21-q23 UniSTS Cytogenetic Map X p11.23 UniSTS Cytogenetic Map 4 q21.1 UniSTS Cytogenetic Map 12 q13.13 UniSTS Cytogenetic Map 14 q23.3 UniSTS Cytogenetic Map 17 p12-p11.2 UniSTS Cytogenetic Map 6 p21.1 UniSTS Cytogenetic Map 1 q24 UniSTS Cytogenetic Map 1 q43 UniSTS Cytogenetic Map 9 q34.13 UniSTS Cytogenetic Map 19 q13.4 UniSTS Cytogenetic Map 2 q32 UniSTS Cytogenetic Map X p22.2 UniSTS Cytogenetic Map 19 p13.11 UniSTS Cytogenetic Map 2 q33 UniSTS Cytogenetic Map 10 p13 UniSTS Cytogenetic Map 2 q11.2 UniSTS Cytogenetic Map 3 q27 UniSTS Cytogenetic Map 17 q25.1 UniSTS Cytogenetic Map 4 p16.1 UniSTS Cytogenetic Map 14 q22.3 UniSTS Cytogenetic Map 10 q23-q24 UniSTS Cytogenetic Map 2 q37.1 UniSTS Cytogenetic Map 17 q12 UniSTS Cytogenetic Map 14 q31-q32 UniSTS Cytogenetic Map 5 p15.33 UniSTS Cytogenetic Map 1 q23.2 UniSTS Cytogenetic Map 16 q24.3 UniSTS Cytogenetic Map 4 p14 UniSTS Cytogenetic Map 2 q32.3 UniSTS Cytogenetic Map 15 q21.1 UniSTS Cytogenetic Map 4 q32.2 UniSTS Cytogenetic Map 10 q23 UniSTS Cytogenetic Map 5 q14.2 UniSTS Cytogenetic Map 4 q32.1 UniSTS Cytogenetic Map 1 q25.1 UniSTS Cytogenetic Map 11 q14.1 UniSTS Cytogenetic Map 4 p16.3 UniSTS Cytogenetic Map 1 p34.2 UniSTS Cytogenetic Map 11 q23.1 UniSTS Cytogenetic Map 3 p21.1 UniSTS Cytogenetic Map 16 q22.2 UniSTS Cytogenetic Map 14 q32.31 UniSTS Cytogenetic Map 16 q11.2 UniSTS Cytogenetic Map 6 q22 UniSTS Cytogenetic Map 10 p15.3 UniSTS Cytogenetic Map 11 q23 UniSTS Cytogenetic Map 22 q13.2 UniSTS Cytogenetic Map 12 q12 UniSTS Cytogenetic Map 19 q13.42 UniSTS Cytogenetic Map 19 q13.11 UniSTS Cytogenetic Map 12 q24.31 UniSTS Cytogenetic Map 15 q15 UniSTS Cytogenetic Map 2 q33.1 UniSTS Cytogenetic Map 22 q12.3 UniSTS Cytogenetic Map 20 q11 UniSTS Cytogenetic Map 22 q11.23 UniSTS Cytogenetic Map 17 q25 UniSTS Cytogenetic Map 1 p13.3 UniSTS Cytogenetic Map 3 p22.1 UniSTS Cytogenetic Map 8 q22.1 UniSTS Cytogenetic Map 16 q22.1 UniSTS Cytogenetic Map 18 p11.31 UniSTS Cytogenetic Map 19 p12 UniSTS Cytogenetic Map 11 q13.1 UniSTS Cytogenetic Map 19 p13.3 UniSTS Cytogenetic Map 2 p22.1 UniSTS Cytogenetic Map 16 p13.3 UniSTS Cytogenetic Map 1 p35.2 UniSTS Cytogenetic Map Y p11.2 UniSTS Cytogenetic Map 13 q13.1 UniSTS Cytogenetic Map 20 q11.22 UniSTS Cytogenetic Map 19 q13.2 UniSTS Cytogenetic Map 18 q12 UniSTS Cytogenetic Map 17 q21.33 UniSTS Cytogenetic Map 15 q15.1 UniSTS Cytogenetic Map 3 q27.2 UniSTS Cytogenetic Map 3 q21.3 UniSTS Cytogenetic Map 5 p15.2 UniSTS Cytogenetic Map 20 q13.12 UniSTS Cytogenetic Map 17 q21 UniSTS Cytogenetic Map 1 q42 UniSTS Cytogenetic Map 14 q32.11 UniSTS Cytogenetic Map 17 q21.2-q21.3 UniSTS Cytogenetic Map 5 q32-q34 UniSTS Cytogenetic Map 15 q14 UniSTS Cytogenetic Map 16 q13 UniSTS Cytogenetic Map 3 q21.2 UniSTS Cytogenetic Map 3 p21.3 UniSTS Cytogenetic Map 14 q24.2 UniSTS Cytogenetic Map 12 q24.13 UniSTS Cytogenetic Map 13 q14.11 UniSTS Cytogenetic Map 3 q27.3 UniSTS Cytogenetic Map 1 q32.3 UniSTS Cytogenetic Map 6 p22.1 UniSTS Cytogenetic Map 9 q34.11 UniSTS Cytogenetic Map 6 q21 UniSTS Cytogenetic Map 6 q25.3 UniSTS Cytogenetic Map 2 p11.2 UniSTS Cytogenetic Map 13 q14.3 UniSTS Cytogenetic Map 17 q11.2 UniSTS Cytogenetic Map 10 p12 UniSTS Cytogenetic Map 2 q33.3 UniSTS Cytogenetic Map 14 q21.3 UniSTS Cytogenetic Map 8 p22-p21 UniSTS Cytogenetic Map 18 q11.2 UniSTS Cytogenetic Map 2 p15 UniSTS Cytogenetic Map 17 q22 UniSTS Cytogenetic Map 12 q21.33 UniSTS Cytogenetic Map 20 q13.32 UniSTS Cytogenetic Map 1 p34.1 UniSTS Cytogenetic Map 10 q26 UniSTS Cytogenetic Map 8 p23.1 UniSTS Cytogenetic Map 19 p13 UniSTS Cytogenetic Map 7 q21.13 UniSTS Cytogenetic Map 7 q31.1 UniSTS Cytogenetic Map 1 p33 UniSTS Cytogenetic Map 21 q22.3 UniSTS Cytogenetic Map 1 p35.1 UniSTS Cytogenetic Map 22 q12.2 UniSTS Cytogenetic Map 9 q22.3 UniSTS Cytogenetic Map 8 q13.1 UniSTS Cytogenetic Map 3 q25 UniSTS Cytogenetic Map 1 p36.33 UniSTS Cytogenetic Map 20 q13.33 UniSTS Cytogenetic Map 1 p31.3 UniSTS Cytogenetic Map 14 q31.1 UniSTS Cytogenetic Map 22 q13.1 UniSTS Cytogenetic Map 12 q13.2 UniSTS Cytogenetic Map 22 q13.31-q13.33 UniSTS Cytogenetic Map 20 q13.31 UniSTS Cytogenetic Map 11 p11.2 UniSTS Cytogenetic Map 1 q41 UniSTS Cytogenetic Map 1 p36.11 UniSTS Cytogenetic Map 15 q25.2 UniSTS Cytogenetic Map 14 q11.2 UniSTS Cytogenetic Map 17 q23.2 UniSTS Cytogenetic Map 7 q32.2 UniSTS Cytogenetic Map 19 q13.12 UniSTS Cytogenetic Map 1 q32.1 UniSTS Cytogenetic Map 6 q25.1 UniSTS Cytogenetic Map 19 q13.43 UniSTS Cytogenetic Map 9 p13.3 UniSTS Cytogenetic Map 16 p11.2 UniSTS Cytogenetic Map 2 p13.1 UniSTS Cytogenetic Map 22 q11.21 UniSTS Cytogenetic Map 3 q29 UniSTS Cytogenetic Map 7 p13 UniSTS Cytogenetic Map 11 q23.3 UniSTS Cytogenetic Map 14 q31-q32.1 UniSTS Cytogenetic Map 1 q42.11 UniSTS Cytogenetic Map 4 q35.1 UniSTS Cytogenetic Map 2 p23.3 UniSTS Cytogenetic Map 2 p13.3 UniSTS Cytogenetic Map X p11.3 UniSTS Cytogenetic Map 2 q11.2-q12.1 UniSTS Cytogenetic Map 20 q13.13 UniSTS Cytogenetic Map 1 p22 UniSTS Cytogenetic Map 6 q16.2 UniSTS Cytogenetic Map 18 q23 UniSTS Cytogenetic Map 2 q14 UniSTS Cytogenetic Map 20 p11.23-p11.21 UniSTS Cytogenetic Map 16 p12.2 UniSTS Cytogenetic Map 8 p11.23 UniSTS Cytogenetic Map 19 q13.1 UniSTS Cytogenetic Map 19 q13 UniSTS Cytogenetic Map 8 p11.21 UniSTS Cytogenetic Map 12 q14.3 UniSTS Cytogenetic Map X q26.3 UniSTS Cytogenetic Map 8 q24.11 UniSTS Cytogenetic Map 10 q23.1 UniSTS Cytogenetic Map 1 q44 UniSTS Cytogenetic Map 9 q22.33 UniSTS Cytogenetic Map 3 p21.31 UniSTS Cytogenetic Map 17 p13.2 UniSTS Cytogenetic Map 9 q21.32 UniSTS Cytogenetic Map 7 q34 UniSTS Cytogenetic Map 9 q33.3 UniSTS Cytogenetic Map 1 p36.1 UniSTS Cytogenetic Map 20 q12 UniSTS Cytogenetic Map 4 q21.23 UniSTS Cytogenetic Map 5 q13.2 UniSTS Cytogenetic Map 22 q12.1 UniSTS Cytogenetic Map 5 q31.1 UniSTS Cytogenetic Map 2 q21.3 UniSTS Cytogenetic Map 7 q21.2 UniSTS Cytogenetic Map 17 q22.2 UniSTS Cytogenetic Map 17 p13 UniSTS Cytogenetic Map 12 q24.11 UniSTS Cytogenetic Map 18 q21 UniSTS Cytogenetic Map 10 q11.1 UniSTS Cytogenetic Map 22 q11.2 UniSTS Cytogenetic Map 19 q12 UniSTS Cytogenetic Map 7 q34-q35 UniSTS Cytogenetic Map 15 q24.1 UniSTS Cytogenetic Map 18 p11.21 UniSTS Cytogenetic Map 1 q23.1 UniSTS Cytogenetic Map 19 q13.41 UniSTS Cytogenetic Map 6 p25.1-p23 UniSTS Cytogenetic Map 11 p15.4 UniSTS Cytogenetic Map 10 q22 UniSTS Cytogenetic Map 5 q35.3 UniSTS Cytogenetic Map 18 q12.1-q21.1 UniSTS Cytogenetic Map 12 p13.1 UniSTS Cytogenetic Map 13 q12.1 UniSTS Cytogenetic Map 12 q15 UniSTS Cytogenetic Map 6 p21.32 UniSTS Cytogenetic Map 8 q24.3 UniSTS Cytogenetic Map 10 p14 UniSTS Cytogenetic Map 12 p13.1-p12.3 UniSTS Cytogenetic Map 3 p25.2 UniSTS Cytogenetic Map 6 p21.33 UniSTS Cytogenetic Map 6 p21.3 UniSTS Cytogenetic Map 3 p21.2 UniSTS Cytogenetic Map 10 q26.3 UniSTS Cytogenetic Map 1 q21.3 UniSTS Cytogenetic Map X p21.2 UniSTS Cytogenetic Map 7 q22.1 UniSTS Cytogenetic Map 14 q12 UniSTS Cytogenetic Map 8 p11.22 UniSTS Cytogenetic Map 19 q13.32 UniSTS Cytogenetic Map 2 q21.1 UniSTS Cytogenetic Map 9 q21.12 UniSTS Cytogenetic Map 15 q23 UniSTS Cytogenetic Map 7 p22.2 UniSTS Cytogenetic Map 8 p21.2 UniSTS Cytogenetic Map 7 q33 UniSTS Cytogenetic Map 15 q15.3 UniSTS Cytogenetic Map 4 q21.22 UniSTS Cytogenetic Map 12 q13.12 UniSTS Cytogenetic Map 10 q24.31 UniSTS Cytogenetic Map 12 p13.31 UniSTS Cytogenetic Map 14 q32.12 UniSTS Cytogenetic Map 10 q24.32 UniSTS Cytogenetic Map 11 q12.3 UniSTS Cytogenetic Map 16 p12.3 UniSTS Cytogenetic Map 1 p34.3 UniSTS Cytogenetic Map 1 p36.21 UniSTS Cytogenetic Map 2 q24.3 UniSTS Cytogenetic Map 2 q33.2 UniSTS Cytogenetic Map 16 q24.1 UniSTS Cytogenetic Map 1 p31.1 UniSTS Cytogenetic Map 19 q13.33 UniSTS Cytogenetic Map 1 p36.31 UniSTS Cytogenetic Map 3 q13.31 UniSTS Cytogenetic Map 15 q22.2 UniSTS Cytogenetic Map 5 q32 UniSTS Cytogenetic Map 6 q13 UniSTS Cytogenetic Map X q24 UniSTS Cytogenetic Map 6 q25 UniSTS Cytogenetic Map 6 p21 UniSTS Cytogenetic Map 2 q35 UniSTS Cytogenetic Map 12 p13-p12 UniSTS Cytogenetic Map 9 p13.2 UniSTS Cytogenetic Map 6 p22 UniSTS Cytogenetic Map 2 q12.1 UniSTS Cytogenetic Map 17 p13.3 UniSTS Cytogenetic Map 9 q22.2 UniSTS Cytogenetic Map 1 q22 UniSTS Cytogenetic Map 1 p22.1 UniSTS Cytogenetic Map 1 p36 UniSTS Cytogenetic Map 9 q13-q21 UniSTS Cytogenetic Map 11 p15.5 UniSTS Cytogenetic Map X p11.2 UniSTS Cytogenetic Map 19 p UniSTS Cytogenetic Map 19 p13.1-p12 UniSTS Cytogenetic Map 7 q22 UniSTS Cytogenetic Map 12 q24.33 UniSTS Cytogenetic Map 3 q21 UniSTS Cytogenetic Map 8 q24 UniSTS Cytogenetic Map 18 p11.31-p11.21 UniSTS Cytogenetic Map 11 p15.3-p15.1 UniSTS Cytogenetic Map 11 q13 UniSTS Cytogenetic Map 8 q22 UniSTS Cytogenetic Map 4 p15.1 UniSTS Cytogenetic Map 1 q25.2 UniSTS Cytogenetic Map 2 p16.3 UniSTS Cytogenetic Map 16 p13.12 UniSTS Cytogenetic Map 7 p21.2 UniSTS Cytogenetic Map 12 q21.1 UniSTS Cytogenetic Map 2 p14 UniSTS Cytogenetic Map 6 q24.3 UniSTS Cytogenetic Map 10 q22.2 UniSTS Cytogenetic Map 5 q23.1 UniSTS Cytogenetic Map 10 q23.2 UniSTS Cytogenetic Map 7 p22.3 UniSTS Cytogenetic Map 21 q22.2 UniSTS Cytogenetic Map 6 q22.1 UniSTS Cytogenetic Map 1 q42.1 UniSTS Cytogenetic Map 1 q25 UniSTS Cytogenetic Map 6 p22.3 UniSTS Cytogenetic Map 1 q21.2 UniSTS Cytogenetic Map 15 q22.1 UniSTS Cytogenetic Map 12 p13.2 UniSTS Cytogenetic Map 12 q22 UniSTS Cytogenetic Map 3 p21-p12 UniSTS Cytogenetic Map 4 q35 UniSTS Cytogenetic Map 1 p34-p33 UniSTS Cytogenetic Map 21 q22.11 UniSTS Cytogenetic Map 3 p22-p21.33 UniSTS Cytogenetic Map 3 q23 UniSTS Cytogenetic Map 3 q22.1 UniSTS Cytogenetic Map 8 q21.11 UniSTS Cytogenetic Map X q22.3 UniSTS Cytogenetic Map 7 p14 UniSTS Cytogenetic Map 17 q21.1 UniSTS Cytogenetic Map 15 q21 UniSTS Cytogenetic Map 1 q42.3 UniSTS Cytogenetic Map 9 q22 UniSTS Cytogenetic Map 2 q12.3 UniSTS Cytogenetic Map 20 q11.2-q13.2 UniSTS Cytogenetic Map 17 q21.31 UniSTS Cytogenetic Map 17 q24 UniSTS Cytogenetic Map 3 q25.31 UniSTS Cytogenetic Map 6 p24.3 UniSTS Cytogenetic Map 2 q31.3 UniSTS Cytogenetic Map 1 q31 UniSTS Cytogenetic Map 7 q32-q33 UniSTS Cytogenetic Map 7 q21.1 UniSTS Cytogenetic Map 14 q23-q24.2 UniSTS Cytogenetic Map 19 q13.3-q13.4 UniSTS Cytogenetic Map 2 p24-p21 UniSTS Cytogenetic Map 15 q11.2 UniSTS Cytogenetic Map 15 q26.3 UniSTS Cytogenetic Map 7 p22 UniSTS Cytogenetic Map 12 p11 UniSTS Cytogenetic Map 1 p35.3 UniSTS Cytogenetic Map 1 p12 UniSTS Cytogenetic Map 13 q32.3 UniSTS Cytogenetic Map 5 q23.3 UniSTS Cytogenetic Map 20 q13 UniSTS Cytogenetic Map 17 q25.2 UniSTS Cytogenetic Map 7 q36.1 UniSTS Cytogenetic Map 10 p12.33 UniSTS Cytogenetic Map 17 q21.32 UniSTS Cytogenetic Map X p11.22 UniSTS Cytogenetic Map 12 p13.3 UniSTS Cytogenetic Map X q25-q26 UniSTS Cytogenetic Map 2 q36.1 UniSTS Cytogenetic Map 5 p13 UniSTS Cytogenetic Map 15 q25 UniSTS Cytogenetic Map 5 q12.1 UniSTS Cytogenetic Map 5 p12 UniSTS Cytogenetic Map 1 p36.22 UniSTS Cytogenetic Map 3 q26.31 UniSTS Cytogenetic Map 17 q22-q23 UniSTS Cytogenetic Map X p22.33 UniSTS Cytogenetic Map Y p11.3 UniSTS Cytogenetic Map 17 p11.2 UniSTS Cytogenetic Map X q13.2 UniSTS Cytogenetic Map 12 q23.1 UniSTS Cytogenetic Map 16 q12.2 UniSTS Cytogenetic Map 3 q26.32 UniSTS Cytogenetic Map 6 q22.31 UniSTS Cytogenetic Map 3 q26.2-q27 UniSTS Cytogenetic Map 1 q25.1-q25.2 UniSTS Cytogenetic Map 14 q24 UniSTS Cytogenetic Map 9 q21.13 UniSTS Cytogenetic Map 10 q11.22 UniSTS Cytogenetic Map 22 q13.31 UniSTS Cytogenetic Map 3 p25.1 UniSTS Cytogenetic Map 5 q21.3 UniSTS Cytogenetic Map 5 p13.3 UniSTS Cytogenetic Map 10 q22.1 UniSTS Cytogenetic Map 14 q12-q13 UniSTS Cytogenetic Map X p22 UniSTS Cytogenetic Map X q23 UniSTS Cytogenetic Map 20 p12.3-p11.21 UniSTS Cytogenetic Map 2 p21 UniSTS Cytogenetic Map 17 q11.2-q12 UniSTS Cytogenetic Map 4 q32-q34 UniSTS Cytogenetic Map X q25-q26.1 UniSTS Cytogenetic Map 2 p25-p24 UniSTS Cytogenetic Map 2 p25 UniSTS Cytogenetic Map 11 q13.2 UniSTS Cytogenetic Map X p22.2-p22.1 UniSTS Cytogenetic Map X q22.1 UniSTS Cytogenetic Map 4 q25 UniSTS Cytogenetic Map 3 p24.2 UniSTS Cytogenetic Map 22 q13 UniSTS Cytogenetic Map 20 q11.22-q12 UniSTS Cytogenetic Map 4 q34.2 UniSTS Cytogenetic Map 20 p13 UniSTS Cytogenetic Map 22 q13.1-q13.2 UniSTS Cytogenetic Map X q28 UniSTS Cytogenetic Map 12 q13-q14 UniSTS Cytogenetic Map 6 q14.1 UniSTS Cytogenetic Map 12 q13.3 UniSTS Cytogenetic Map 9 q31.2 UniSTS Cytogenetic Map 11 q13.1-q13.2 UniSTS Cytogenetic Map 12 q13 UniSTS Cytogenetic Map 1 p32-p31 UniSTS Cytogenetic Map 21 q21.2 UniSTS Cytogenetic Map 10 q24.3 UniSTS Cytogenetic Map 16 q21 UniSTS Cytogenetic Map 8 q21.1 UniSTS Cytogenetic Map 5 p13.2 UniSTS Cytogenetic Map 1 p34 UniSTS Cytogenetic Map 1 q32.2 UniSTS Cytogenetic Map 4 q21.3 UniSTS Cytogenetic Map 7 q21-q22 UniSTS Cytogenetic Map 3 q26.2 UniSTS Cytogenetic Map 2 q36.3 UniSTS Cytogenetic Map 8 p22 UniSTS Cytogenetic Map 11 q22.1 UniSTS Cytogenetic Map 3 q25.33 UniSTS Cytogenetic Map 10 q23.31 UniSTS Cytogenetic Map 4 p15.32 UniSTS Cytogenetic Map 18 q12.2 UniSTS Cytogenetic Map 15 q15.2 UniSTS Cytogenetic Map 5 q12.3 UniSTS Cytogenetic Map 14 q24.1 UniSTS Cytogenetic Map 12 q14.1 UniSTS Cytogenetic Map 6 p22.3-p22.1 UniSTS Cytogenetic Map 7 p11.2 UniSTS Cytogenetic Map 6 q15 UniSTS Cytogenetic Map 6 q23.3 UniSTS Cytogenetic Map 13 q14 UniSTS Cytogenetic Map 5 q35.2 UniSTS Cytogenetic Map 10 q22.3 UniSTS Cytogenetic Map 1 p35 UniSTS Cytogenetic Map 3 q12.3 UniSTS Cytogenetic Map 19 q13.31 UniSTS Cytogenetic Map 8 q23.1 UniSTS Cytogenetic Map 6 q27 UniSTS Cytogenetic Map 2 q14.3 UniSTS Cytogenetic Map X p11 UniSTS Cytogenetic Map 11 p15.3 UniSTS Cytogenetic Map 20 p12 UniSTS Cytogenetic Map 15 q13.1 UniSTS Cytogenetic Map X p22.3 UniSTS Cytogenetic Map 11 q13.5 UniSTS Cytogenetic Map 19 p13.3-p13.2 UniSTS Cytogenetic Map 1 p36.11-p34.2 UniSTS Cytogenetic Map 4 q22.1-q23 UniSTS Cytogenetic Map 7 q22.3 UniSTS Cytogenetic Map 9 p22 UniSTS Cytogenetic Map 17 q23.3 UniSTS Cytogenetic Map 16 q23.2 UniSTS Cytogenetic Map 2 p16.1 UniSTS Cytogenetic Map 3 q27.1 UniSTS Cytogenetic Map 2 p22.3 UniSTS Cytogenetic Map X q26.1 UniSTS Cytogenetic Map 4 q21.21 UniSTS Cytogenetic Map 22 q13.3 UniSTS Cytogenetic Map 2 q32.1 UniSTS Cytogenetic Map Y p11.32 UniSTS Cytogenetic Map 11 p14 UniSTS Cytogenetic Map 1 p32.1 UniSTS Cytogenetic Map 2 p25.3 UniSTS Cytogenetic Map 4 q34.3 UniSTS Cytogenetic Map 9 p12 UniSTS Cytogenetic Map 3 q13.13 UniSTS Cytogenetic Map 13 q34 UniSTS Cytogenetic Map 3 p21 UniSTS Cytogenetic Map 11 q23.2 UniSTS Cytogenetic Map 20 p11.23 UniSTS Cytogenetic Map 3 p13 UniSTS Cytogenetic Map 4 p13 UniSTS Cytogenetic Map 16 q23.1 UniSTS Cytogenetic Map 10 p11.23 UniSTS Cytogenetic Map 8 p21.1 UniSTS Cytogenetic Map 15 q22-q24 UniSTS Cytogenetic Map 8 q23 UniSTS Cytogenetic Map 16 q12.1 UniSTS Cytogenetic Map 14 q13.2 UniSTS Cytogenetic Map 18 q12.1 UniSTS Cytogenetic Map 5 q31.3 UniSTS Cytogenetic Map 11 q14 UniSTS Cytogenetic Map 13 q33.1 UniSTS Cytogenetic Map 14 q21.2 UniSTS Cytogenetic Map 4 q31.3 UniSTS Cytogenetic Map 15 q21-q22 UniSTS Cytogenetic Map 3 p14.3 UniSTS Cytogenetic Map 17 p13.1 UniSTS Cytogenetic Map 13 q12.11 UniSTS Cytogenetic Map 6 p21.2 UniSTS Cytogenetic Map 15 q21.3 UniSTS Cytogenetic Map 3 q21.1 UniSTS Cytogenetic Map 6 p21.31 UniSTS Cytogenetic Map 10 p15.1 UniSTS Cytogenetic Map 1 q24.2 UniSTS Cytogenetic Map 12 p12 UniSTS Cytogenetic Map 7 p22.1 UniSTS Cytogenetic Map 11 q24 UniSTS Cytogenetic Map 21 q22.13 UniSTS Cytogenetic Map 15 q22.1-q22.31 UniSTS Cytogenetic Map 15 q22 UniSTS Cytogenetic Map X q13 UniSTS Cytogenetic Map 1 q31-q41 UniSTS Cytogenetic Map 6 p25 UniSTS Cytogenetic Map 14 q32.1 UniSTS Cytogenetic Map 16 q12-q13 UniSTS Cytogenetic Map X q12-q13 UniSTS Cytogenetic Map 14 q23 UniSTS Cytogenetic Map 12 q11-q12 UniSTS Cytogenetic Map 1 q42.1-q43 UniSTS Cytogenetic Map 3 q13.33 UniSTS Cytogenetic Map 7 q31 UniSTS Cytogenetic Map 12 q24 UniSTS Cytogenetic Map X p22.11 UniSTS Cytogenetic Map 11 q13.4 UniSTS Cytogenetic Map 2 p25.1-p24.1 UniSTS Cytogenetic Map 8 q24.21 UniSTS Cytogenetic Map 12 q13.1 UniSTS Cytogenetic Map 12 q22-q23.1 UniSTS Cytogenetic Map 11 q12.2 UniSTS Cytogenetic Map 1 p13.2 UniSTS Cytogenetic Map 5 q31.2-q34 UniSTS Cytogenetic Map 11 p15.1 UniSTS Cytogenetic Map 6 q24.2 UniSTS Cytogenetic Map 22 q UniSTS Cytogenetic Map 12 q13.11-q14.3 UniSTS Cytogenetic Map 7 p11 UniSTS Cytogenetic Map X p22.12-p22.11 UniSTS Cytogenetic Map 7 q11.21 UniSTS Cytogenetic Map 20 q11.22-q11.23 UniSTS Cytogenetic Map 8 q24.22 UniSTS Cytogenetic Map 8 p22-p21.3 UniSTS Cytogenetic Map 10 q24 UniSTS Cytogenetic Map 1 q21.2-q21.3 UniSTS Cytogenetic Map 1 p36.12 UniSTS Cytogenetic Map 9 p24.1 UniSTS Cytogenetic Map 6 q25.2-q27 UniSTS Cytogenetic Map 9 q34 UniSTS Cytogenetic Map 5 p13.1 UniSTS Cytogenetic Map 8 q11.2 UniSTS Cytogenetic Map 3 q28-q29 UniSTS Cytogenetic Map 7 p14-p13 UniSTS Cytogenetic Map 12 q24.2 UniSTS Cytogenetic Map 6 p22.2 UniSTS Cytogenetic Map 7 q22-qter UniSTS Cytogenetic Map 12 q24.2-q24.31 UniSTS Cytogenetic Map X q13.1 UniSTS Cytogenetic Map 6 p25.2 UniSTS Cytogenetic Map 1 p21 UniSTS Cytogenetic Map 1 q32.2-q41 UniSTS Cytogenetic Map 11 q22-q23 UniSTS Cytogenetic Map 3 q26.33 UniSTS Cytogenetic Map 12 q23-q24.1 UniSTS Cytogenetic Map 5 p15.1-p14.3 UniSTS Cytogenetic Map 16 p13.11 UniSTS Cytogenetic Map 6 q22-q23 UniSTS Cytogenetic Map 9 p21 UniSTS Cytogenetic Map 6 p12.3 UniSTS Cytogenetic Map 3 p12.1 UniSTS Cytogenetic Map 9 q21.11 UniSTS Cytogenetic Map 17 q24.1 UniSTS Cytogenetic Map 10 q11.21 UniSTS Cytogenetic Map 14 q21 UniSTS Cytogenetic Map 11 p15 UniSTS Cytogenetic Map 16 q22 UniSTS Cytogenetic Map 15 q11-q13 UniSTS Cytogenetic Map 13 q12-q14 UniSTS Cytogenetic Map 18 q21.1 UniSTS Cytogenetic Map 2 q24 UniSTS Cytogenetic Map 12 p13 UniSTS Cytogenetic Map 3 q28 UniSTS Cytogenetic Map 7 q32.1 UniSTS Cytogenetic Map X q22.2 UniSTS Cytogenetic Map 7 p12.3 UniSTS Cytogenetic Map 7 p15.1 UniSTS Cytogenetic Map 2 q37.2 UniSTS Cytogenetic Map 18 q22.3 UniSTS Cytogenetic Map 14 q32.13 UniSTS Cytogenetic Map 14 q22.1 UniSTS Cytogenetic Map 16 p13.1 UniSTS Cytogenetic Map 7 q31.3 UniSTS Cytogenetic Map 20 q13.2-q13.3 UniSTS Cytogenetic Map 1 p21.2 UniSTS Cytogenetic Map 9 q21.33 UniSTS Cytogenetic Map 14 q32.2 UniSTS Cytogenetic Map 13 q13.3 UniSTS Cytogenetic Map 10 p12.31 UniSTS Cytogenetic Map 22 q11.1 UniSTS Cytogenetic Map 5 q33.2 UniSTS Cytogenetic Map 13 q32.2 UniSTS Cytogenetic Map 14 q23.1 UniSTS Cytogenetic Map 8 q21.2 UniSTS Cytogenetic Map 2 q24.1 UniSTS Cytogenetic Map 10 q26.13 UniSTS Cytogenetic Map 2 q23.3 UniSTS Cytogenetic Map 19 p13.1 UniSTS Cytogenetic Map 15 q14-q15 UniSTS Cytogenetic Map 1 q42.13 UniSTS Cytogenetic Map 14 q31 UniSTS Cytogenetic Map 7 p21.1 UniSTS Cytogenetic Map 8 p12-p11 UniSTS Cytogenetic Map 18 p11.2 UniSTS Cytogenetic Map 7 p11.1 UniSTS Cytogenetic Map 1 q31-q32 UniSTS Cytogenetic Map 2 q12 UniSTS Cytogenetic Map 3 p21.32 UniSTS Cytogenetic Map 2 p24.2 UniSTS Cytogenetic Map 2 q33-q34 UniSTS Cytogenetic Map 6 q24.1 UniSTS Cytogenetic Map 4 q22.1 UniSTS Cytogenetic Map 15 q13.3 UniSTS Cytogenetic Map 10 q26.11 UniSTS Cytogenetic Map 7 p15.3 UniSTS Cytogenetic Map 10 q23.33 UniSTS Cytogenetic Map 12 p12.1 UniSTS Cytogenetic Map 7 p13-p12 UniSTS Cytogenetic Map X q25 UniSTS Cytogenetic Map 17 q11-q21 UniSTS Cytogenetic Map 12 q23 UniSTS Cytogenetic Map 6 p24-p22.3 UniSTS Cytogenetic Map 14 q23.2 UniSTS Cytogenetic Map 7 q31.1-q31.2 UniSTS Cytogenetic Map 8 q22.2 UniSTS Cytogenetic Map 15 q21.2 UniSTS Cytogenetic Map 3 p26.1-p25.1 UniSTS Cytogenetic Map 5 q35 UniSTS Cytogenetic Map 3 q13.2 UniSTS Cytogenetic Map 4 p15.2 UniSTS Cytogenetic Map 6 q16.3 UniSTS Cytogenetic Map 17 q24-q25 UniSTS Cytogenetic Map X q12 UniSTS Cytogenetic Map X q27.1 UniSTS Cytogenetic Map 8 q12.3 UniSTS Cytogenetic Map 5 q21.2 UniSTS Cytogenetic Map 5 q15 UniSTS Cytogenetic Map 5 q35.1 UniSTS Cytogenetic Map 4 q13.3 UniSTS Cytogenetic Map 4 q35.2 UniSTS Cytogenetic Map 3 p26.1 UniSTS Cytogenetic Map 3 p11.1 UniSTS Cytogenetic Map 17 q21.2 UniSTS Cytogenetic Map 2 q21.2 UniSTS Cytogenetic Map 19 p13.13 UniSTS Cytogenetic Map 18 q12.3 UniSTS Cytogenetic Map 18 p11.3 UniSTS Cytogenetic Map 17 q11.1 UniSTS Cytogenetic Map 15 q25.1 UniSTS Cytogenetic Map 13 q12.3 UniSTS Cytogenetic Map 12 q23.2 UniSTS Cytogenetic Map 12 q12-q13 UniSTS Cytogenetic Map 12 q14 UniSTS Cytogenetic Map 5 q33.1 UniSTS Cytogenetic Map 2 q32-q34 UniSTS Cytogenetic Map 16 q22.3 UniSTS Cytogenetic Map 2 p15-p13 UniSTS Cytogenetic Map X p11.4 UniSTS Cytogenetic Map 19 q13.33-q13.41 UniSTS Cytogenetic Map 20 p11 UniSTS Cytogenetic Map 6 q23-q24 UniSTS Cytogenetic Map 2 p12 UniSTS Cytogenetic Map 2 p13 UniSTS Cytogenetic Map 13 q11-q12 UniSTS Cytogenetic Map 6 p12.3-p11.2 UniSTS Cytogenetic Map 6 q16.1-q16.3 UniSTS Cytogenetic Map 22 q11 UniSTS Cytogenetic Map 7 q31.2 UniSTS Cytogenetic Map 10 q21.3 UniSTS Cytogenetic Map 3 q25.2 UniSTS Cytogenetic Map 3 p21.1-p14.3 UniSTS Cytogenetic Map 6 p12.1 UniSTS Cytogenetic Map 3 q23-q24 UniSTS Cytogenetic Map 3 q12 UniSTS Cytogenetic Map 7 q11.1 UniSTS Cytogenetic Map 3 q22.3 UniSTS Cytogenetic Map 7 q21.3 UniSTS Cytogenetic Map 4 q31.1 UniSTS Cytogenetic Map 22 q12-q13 UniSTS Cytogenetic Map 4 q23 UniSTS Cytogenetic Map X p22.12 UniSTS Cytogenetic Map 6 q16.1 UniSTS Cytogenetic Map 13 q14.13 UniSTS Cytogenetic Map 18 q21.3 UniSTS Cytogenetic Map 9 q33.2 UniSTS Cytogenetic Map 11 q21 UniSTS Cytogenetic Map 8 q12 UniSTS Cytogenetic Map 4 q28-q32 UniSTS Cytogenetic Map 17 q24.3 UniSTS Cytogenetic Map 6 p23 UniSTS Cytogenetic Map 8 p11 UniSTS Cytogenetic Map 5 q34 UniSTS Cytogenetic Map 1 q24.3 UniSTS Cytogenetic Map 9 q33.1 UniSTS Cytogenetic Map 1 q23.3 UniSTS Cytogenetic Map 2 p16.2 UniSTS Cytogenetic Map 9 q22.31 UniSTS Cytogenetic Map 9 p24.3 UniSTS Cytogenetic Map 7 q35 UniSTS Cytogenetic Map 1 p36.2 UniSTS Cytogenetic Map 11 q22.3 UniSTS Cytogenetic Map 16 p12 UniSTS Cytogenetic Map 1 q22-q23 UniSTS Cytogenetic Map 13 q22.1 UniSTS Cytogenetic Map 2 q12.2 UniSTS Cytogenetic Map 8 p12 UniSTS Cytogenetic Map 4 q21 UniSTS Cytogenetic Map 13 q12.2 UniSTS Cytogenetic Map 9 q31-q33 UniSTS Cytogenetic Map 6 p24.1 UniSTS Cytogenetic Map 1 q23 UniSTS Cytogenetic Map 11 q12-q13 UniSTS Cytogenetic Map 11 q13.3 UniSTS Cytogenetic Map 11 q24.2 UniSTS Cytogenetic Map 11 q12.1 UniSTS Cytogenetic Map 3 p26 UniSTS Cytogenetic Map 5 q13 UniSTS Cytogenetic Map 8 p21 UniSTS Cytogenetic Map 19 q13.1-q13.2 UniSTS Cytogenetic Map 1 p33-p32 UniSTS Cytogenetic Map 7 q36.2 UniSTS Cytogenetic Map 4 q32.3 UniSTS Cytogenetic Map 16 p13.2 UniSTS Cytogenetic Map 14 q32 UniSTS Cytogenetic Map 10 q11.23 UniSTS Cytogenetic Map 10 q26.1 UniSTS Cytogenetic Map 9 q32-q33.3 UniSTS Cytogenetic Map 9 q22.1-q22.2 UniSTS Cytogenetic Map 3 q26.1-q26.2 UniSTS Cytogenetic Map 5 q31-q34 UniSTS Cytogenetic Map 9 q33-q34 UniSTS Cytogenetic Map 5 q11.2-q13.2 UniSTS Cytogenetic Map 13 q32 UniSTS Cytogenetic Map 9 q22.32 UniSTS Cytogenetic Map 1 p36.3 UniSTS Cytogenetic Map 1 p36.3-p36.2 UniSTS Cytogenetic Map 4 q28.1 UniSTS Cytogenetic Map 5 q22 UniSTS Cytogenetic Map 12 p11.21 UniSTS Cytogenetic Map X q13.3 UniSTS Cytogenetic Map 9 q31.3 UniSTS Cytogenetic Map 3 p26.3 UniSTS Cytogenetic Map 2 q11.1 UniSTS Cytogenetic Map 21 q11.2 UniSTS Cytogenetic Map 18 q21.32 UniSTS Cytogenetic Map 15 q26.2 UniSTS Cytogenetic Map 12 q24.23 UniSTS Cytogenetic Map 10 q25.3 UniSTS Cytogenetic Map 20 q11.23 UniSTS Cytogenetic Map 20 p12.1 UniSTS Cytogenetic Map 2 q31.1-q31.2 UniSTS Cytogenetic Map X p22.31 UniSTS Cytogenetic Map X p21.3 UniSTS Cytogenetic Map 5 q33.3 UniSTS Cytogenetic Map 4 q28.2 UniSTS Cytogenetic Map 3 p14.2 UniSTS Cytogenetic Map 3 q24 UniSTS Cytogenetic Map 2 q13 UniSTS Cytogenetic Map 20 q13.2 UniSTS Cytogenetic Map 14 q11.2-q12 UniSTS Cytogenetic Map 3 p24 UniSTS Cytogenetic Map 12 q23.3 UniSTS Cytogenetic Map 11 q24.3 UniSTS Cytogenetic Map 11 q14.3 UniSTS Cytogenetic Map 10 q25.2 UniSTS Cytogenetic Map 3 q25.1 UniSTS Cytogenetic Map 8 q13 UniSTS Cytogenetic Map 1 p22.2 UniSTS Cytogenetic Map 3 p22.3 UniSTS Cytogenetic Map 18 q11.1 UniSTS Cytogenetic Map 8 q23.3 UniSTS Cytogenetic Map 15 q24 UniSTS Cytogenetic Map 11 cen-q12 UniSTS Cytogenetic Map 11 q25 UniSTS Cytogenetic Map 3 p22.2 UniSTS Cytogenetic Map X p21.1 UniSTS Cytogenetic Map 7 q36 UniSTS Cytogenetic Map 7 p14.3 UniSTS Cytogenetic Map 12 q21 UniSTS Cytogenetic Map 7 p15 UniSTS Cytogenetic Map 7 q22-q31 UniSTS Cytogenetic Map 11 q22 UniSTS Cytogenetic Map 5 p15.3 UniSTS Cytogenetic Map 20 q13.3-qter UniSTS Cytogenetic Map 1 p35-p34 UniSTS Cytogenetic Map 4 p13-p12 UniSTS Cytogenetic Map 10 q21-q22 UniSTS Cytogenetic Map 4 q22 UniSTS Cytogenetic Map 7 p13-p11.1 UniSTS Cytogenetic Map 9 q31-q34 UniSTS Cytogenetic Map 7 q21.1-q22 UniSTS Cytogenetic Map 15 q26.1 UniSTS Cytogenetic Map 3 q13.13-q13.2 UniSTS Cytogenetic Map X p22.13 UniSTS Cytogenetic Map 13 q12.12 UniSTS Cytogenetic Map 13 q14.2 UniSTS Cytogenetic Map 12 q UniSTS Cytogenetic Map 1 p UniSTS Cytogenetic Map 16 p UniSTS Cytogenetic Map 15 q UniSTS Cytogenetic Map 7 q UniSTS Cytogenetic Map 2 q UniSTS Cytogenetic Map 5 q13.1 UniSTS Cytogenetic Map 11 p14.1 UniSTS Cytogenetic Map 4 q32 UniSTS Cytogenetic Map 2 p22 UniSTS Cytogenetic Map 5 q14.3 UniSTS Cytogenetic Map 10 p12.1 UniSTS Cytogenetic Map 5 q23.2 UniSTS Cytogenetic Map 2 p24.1 UniSTS Cytogenetic Map 8 q24.13 UniSTS Cytogenetic Map 12 p13.32 UniSTS Cytogenetic Map 9 p21.1 UniSTS Cytogenetic Map 9 q34.2-q34.3 UniSTS
sY3122
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 14 q23.3 UniSTS Cytogenetic Map 19 q13.41 UniSTS Cytogenetic Map 17 q23.3 UniSTS Cytogenetic Map 8 q24 UniSTS Cytogenetic Map 10 q25.2 UniSTS Cytogenetic Map 22 q13.31 UniSTS Cytogenetic Map 1 p36.11 UniSTS Cytogenetic Map 4 q28.1 UniSTS Cytogenetic Map 17 p13.3 UniSTS
ADD3
Human Assembly Chr Position (strand) Source JBrowse GRCh37 10 111,892,123 - 111,893,197 UniSTS GRCh37 Celera 10 105,623,795 - 105,624,869 UniSTS HuRef 10 105,522,976 - 105,524,050 UniSTS
D10S543
Human Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 10 q25.2 UniSTS Marshfield Genetic Map 10 128.73 UniSTS Genethon Genetic Map 10 136.3 UniSTS deCODE Assembly Map 10 127.43 UniSTS Whitehead-YAC Contig Map 10 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2439
2788
2251
4971
1726
2351
6
624
1950
465
2269
7303
6469
52
3733
1
852
1744
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000277900 ⟹ ENSP00000277900
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,007,964 - 110,135,565 (+) Ensembl
Ensembl Acc Id:
ENST00000356080 ⟹ ENSP00000348381
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,007,984 - 110,135,565 (+) Ensembl
Ensembl Acc Id:
ENST00000360162 ⟹ ENSP00000353286
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,005,804 - 110,134,330 (+) Ensembl
Ensembl Acc Id:
ENST00000459738
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,008,209 - 110,100,704 (+) Ensembl
Ensembl Acc Id:
ENST00000468251
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 109,996,368 - 110,118,608 (+) Ensembl
Ensembl Acc Id:
ENST00000468345
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,077,005 - 110,117,395 (+) Ensembl
Ensembl Acc Id:
ENST00000472568
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,123,837 - 110,130,389 (+) Ensembl
Ensembl Acc Id:
ENST00000473669
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,077,005 - 110,112,906 (+) Ensembl
Ensembl Acc Id:
ENST00000475954
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,008,252 - 110,117,379 (+) Ensembl
Ensembl Acc Id:
ENST00000479805
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,125,902 - 110,132,727 (+) Ensembl
Ensembl Acc Id:
ENST00000484622
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,008,208 - 110,117,359 (+) Ensembl
Ensembl Acc Id:
ENST00000486014
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,079,239 - 110,124,143 (+) Ensembl
Ensembl Acc Id:
ENST00000487085
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,008,208 - 110,112,899 (+) Ensembl
Ensembl Acc Id:
ENST00000488104
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,119,315 - 110,119,690 (+) Ensembl
Ensembl Acc Id:
ENST00000488799
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,125,755 - 110,133,348 (+) Ensembl
Ensembl Acc Id:
ENST00000488837
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,121,855 - 110,124,168 (+) Ensembl
Ensembl Acc Id:
ENST00000492162
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,124,240 - 110,130,393 (+) Ensembl
Ensembl Acc Id:
ENST00000495661
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,008,231 - 110,112,894 (+) Ensembl
Ensembl Acc Id:
ENST00000496517
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,016,435 - 110,117,402 (+) Ensembl
Ensembl Acc Id:
ENST00000497125
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 10 110,008,231 - 110,118,630 (+) Ensembl
RefSeq Acc Id:
NM_001121 ⟹ NP_001112
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,007,984 - 110,135,565 (+) NCBI GRCh37 10 111,765,627 - 111,895,323 (+) NCBI Build 36 10 111,757,701 - 111,885,313 (+) NCBI Archive HuRef 10 105,396,619 - 105,526,176 (+) ENTREZGENE CHM1_1 10 112,049,359 - 112,177,067 (+) NCBI T2T-CHM13v2.0 10 110,891,836 - 111,019,428 (+) NCBI
Sequence:
AGAGCGCGAGCCGCCAGCCCGTAACGGTCGCCAGTGTGAGGGGCGGGAGGGAAAGAAGAGGGGTTTAAATTAGATTTTTTAAAACACAGAGCAAGCGCCAGAGGCGTCGGCATCCCAGGTGTCGCCGC
hide sequence
RefSeq Acc Id:
NM_001320591 ⟹ NP_001307520
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 109,996,373 - 110,135,565 (+) NCBI CHM1_1 10 112,037,774 - 112,177,067 (+) NCBI T2T-CHM13v2.0 10 110,880,227 - 111,019,428 (+) NCBI
Sequence:
AGTTTCAGTAATCATTGTGAATGAGACTGTGAGAAACTTGGCTTGTTCAGAAGATACTGTGCATAAGACATGAGCATTGAGAGAAGCTGCTGCTGCTAATGCTGCTGCTGCTGCTGCCGCCGCCGCCG
hide sequence
RefSeq Acc Id:
NM_001320592 ⟹ NP_001307521
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,005,947 - 110,135,565 (+) NCBI CHM1_1 10 112,047,228 - 112,177,067 (+) NCBI T2T-CHM13v2.0 10 110,889,800 - 111,019,428 (+) NCBI
Sequence:
AAACACTTACTACTCAGCATTGAGAGAAGCTGCTGCTGCTAATGCTGCTGCTGCTGCTGCCGCC
hide sequence
RefSeq Acc Id:
NM_001320593 ⟹ NP_001307522
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,005,947 - 110,135,565 (+) NCBI CHM1_1 10 112,047,228 - 112,177,067 (+) NCBI T2T-CHM13v2.0 10 110,889,800 - 111,019,428 (+) NCBI
Sequence:
AAACACTTACTACTCAGCATTGAGAGAAGCTGCTGCTGCTAATGCTGCTGCTGCTGCTGCCGCC
hide sequence
RefSeq Acc Id:
NM_001320594 ⟹ NP_001307523
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,007,984 - 110,135,565 (+) NCBI CHM1_1 10 112,049,359 - 112,177,067 (+) NCBI T2T-CHM13v2.0 10 110,891,836 - 111,019,428 (+) NCBI
Sequence:
AGAGCGCGAGCCGCCAGCCCGTAACGGTCGCCAGTGTGAGGGGCGGGAGGGAAAGAAGAGGGGT
hide sequence
RefSeq Acc Id:
NM_016824 ⟹ NP_058432
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,007,984 - 110,135,565 (+) NCBI GRCh37 10 111,765,627 - 111,895,323 (+) NCBI Build 36 10 111,757,701 - 111,885,313 (+) NCBI Archive HuRef 10 105,396,619 - 105,526,176 (+) ENTREZGENE CHM1_1 10 112,049,359 - 112,177,067 (+) NCBI T2T-CHM13v2.0 10 110,891,836 - 111,019,428 (+) NCBI
Sequence:
AGAGCGCGAGCCGCCAGCCCGTAACGGTCGCCAGTGTGAGGGGCGGGAGGGAAAGAAGAGGGGT
hide sequence
RefSeq Acc Id:
NM_019903 ⟹ NP_063968
RefSeq Status:
REVIEWED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,005,947 - 110,135,565 (+) NCBI GRCh37 10 111,765,627 - 111,895,323 (+) NCBI Build 36 10 111,755,716 - 111,885,313 (+) NCBI Archive HuRef 10 105,396,619 - 105,526,176 (+) ENTREZGENE CHM1_1 10 112,047,228 - 112,177,067 (+) NCBI T2T-CHM13v2.0 10 110,889,800 - 111,019,428 (+) NCBI
Sequence:
AAACACTTACTACTCAGCATTGAGAGAAGCTGCTGCTGCTAATGCTGCTGCTGCTGCTGCCGCCGCCGCCGCTGCTGCTGCTGCTGTTGGTCTGAGGCTGCAGTAGGTTTCTGTGCAGCATTGCAGAA
hide sequence
RefSeq Acc Id:
XM_024447794 ⟹ XP_024303562
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,077,044 - 110,135,565 (+) NCBI
Sequence:
ACATTGAGTGTGGATATCTTGCTCTTTAAAACAAAGTTCATTGTTAGGGCAGTATTGCAACAGAATTGCCACACAAAAACCAGCTTAAGAAATGTACAGCACTTCAATTTTTTTAGTTGTCTCCCAGA
hide sequence
RefSeq Acc Id:
XM_024447795 ⟹ XP_024303563
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,007,984 - 110,135,565 (+) NCBI
Sequence:
AGAGCGCGAGCCGCCAGCCCGTAACGGTCGCCAGTGTGAGGGGCGGGAGGGAAAGAAGAGGGGT
hide sequence
RefSeq Acc Id:
XM_024447796 ⟹ XP_024303564
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,007,984 - 110,135,565 (+) NCBI
Sequence:
GGCTGCTGCAGCCCGGGCGGCTGCCGAGAAGGAGGGAGGGGAAACACAAAGCCGGCTACGCGCT
hide sequence
RefSeq Acc Id:
XM_024447797 ⟹ XP_024303565
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,005,947 - 110,135,565 (+) NCBI
Sequence:
ACTACTCAGCATTGAGAGAAGCTGCTGCTGCTAATGCTGCTGCTGCTGCTGCCGCCGCCGCCGC
hide sequence
RefSeq Acc Id:
XM_024447798 ⟹ XP_024303566
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,077,044 - 110,135,565 (+) NCBI
Sequence:
ATTGTTAGGGCAGTATTGCAACAGAATTGCCACACAAAAACCAGCTTAAGAAATGTACAGCACT
hide sequence
RefSeq Acc Id:
XM_024447799 ⟹ XP_024303567
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 109,996,373 - 110,135,565 (+) NCBI
Sequence:
GTTACTTTAGTTTCAGTAATCATTGTGAATGAGACTGTGAGAAACTTGGCTTGTTCAGAAGATA
hide sequence
RefSeq Acc Id:
XM_024447800 ⟹ XP_024303568
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,008,231 - 110,135,565 (+) NCBI
Sequence:
ACATGTTAGGTTGAGCTTCCTGCTAGGGGTGACAAGCGAAGTTGGCAGCAGGTCTGGTGTGCTG
hide sequence
RefSeq Acc Id:
XM_024447801 ⟹ XP_024303569
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,007,984 - 110,135,565 (+) NCBI
Sequence:
AGAGCGCGAGCCGCCAGCCCGTAACGGTCGCCAGTGTGAGGGGCGGGAGGGAAAGAAGAGGGGT
hide sequence
RefSeq Acc Id:
XM_024447802 ⟹ XP_024303570
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,080,951 - 110,135,565 (+) NCBI
Sequence:
ATCACACATAGGATATTTAGCATTGGGTAGCATTACCTGTTTCACAGTTTTAGTTTCATAATTCAATCAAATGACAGCTGTTCTAAAGATAAAATGATGTAAGGACTTCAATTGATTTGTGTAATTAC
hide sequence
RefSeq Acc Id:
XM_024447803 ⟹ XP_024303571
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,005,947 - 110,135,565 (+) NCBI
Sequence:
AGTTTACTAAGTCAAACACTTACTACTCAGCATTGAGAGAAGCTGCTGCTGCTAATGCTGCTGC
hide sequence
RefSeq Acc Id:
XM_024447804 ⟹ XP_024303572
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,007,984 - 110,135,565 (+) NCBI
Sequence:
AGAGCGCGAGCCGCCAGCCCGTAACGGTCGCCAGTGTGAGGGGCGGGAGGGAAAGAAGAGGGGT
hide sequence
RefSeq Acc Id:
XM_024447805 ⟹ XP_024303573
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,007,984 - 110,135,565 (+) NCBI
Sequence:
GGCTGCTGCAGCCCGGGCGGCTGCCGAGAAGGAGGGAGGGGAAACACAAAGCCGGCTACGCGCTGCGAGCTGTGAAAGTGAAGTTTGGCTTGAAAACACATTCTGCCAGTGCAAATCCAAAAAGTATC
hide sequence
RefSeq Acc Id:
XM_024447806 ⟹ XP_024303574
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,005,947 - 110,135,565 (+) NCBI
Sequence:
ACTACTCAGCATTGAGAGAAGCTGCTGCTGCTAATGCTGCTGCTGCTGCTGCCGCCGCCGCCGCTGCTGCTGCTGCTGTTGGTCTGAGGCTGCAGTAGGTTTCTGTGCAGCATTGCAGAATCCACACC
hide sequence
RefSeq Acc Id:
XM_024447807 ⟹ XP_024303575
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,007,984 - 110,135,565 (+) NCBI
Sequence:
AGAGCGCGAGCCGCCAGCCCGTAACGGTCGCCAGTGTGAGGGGCGGGAGGGAAAGAAGAGGGGT
hide sequence
RefSeq Acc Id:
XM_047424587 ⟹ XP_047280543
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 109,996,373 - 110,135,565 (+) NCBI
RefSeq Acc Id:
XM_047424588 ⟹ XP_047280544
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 109,996,373 - 110,135,565 (+) NCBI
RefSeq Acc Id:
XM_047424589 ⟹ XP_047280545
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,008,231 - 110,135,565 (+) NCBI
RefSeq Acc Id:
XM_047424590 ⟹ XP_047280546
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 109,996,373 - 110,135,565 (+) NCBI
RefSeq Acc Id:
XM_047424591 ⟹ XP_047280547
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,077,044 - 110,135,565 (+) NCBI
RefSeq Acc Id:
XM_047424592 ⟹ XP_047280548
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,077,044 - 110,135,565 (+) NCBI
RefSeq Acc Id:
XM_047424593 ⟹ XP_047280549
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,008,231 - 110,135,565 (+) NCBI
RefSeq Acc Id:
XM_047424594 ⟹ XP_047280550
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,077,044 - 110,135,565 (+) NCBI
RefSeq Acc Id:
XM_047424595 ⟹ XP_047280551
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 109,996,373 - 110,135,565 (+) NCBI
RefSeq Acc Id:
XM_047424597 ⟹ XP_047280553
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 10 110,112,814 - 110,135,565 (+) NCBI
RefSeq Acc Id:
XM_054364767 ⟹ XP_054220742
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,891,836 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364768 ⟹ XP_054220743
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,880,187 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364769 ⟹ XP_054220744
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,960,879 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364770 ⟹ XP_054220745
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,892,634 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364771 ⟹ XP_054220746
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,889,800 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364772 ⟹ XP_054220747
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,880,217 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364773 ⟹ XP_054220748
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,960,877 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364774 ⟹ XP_054220749
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,880,209 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364775 ⟹ XP_054220750
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,892,771 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364776 ⟹ XP_054220751
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,891,836 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364777 ⟹ XP_054220752
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,880,207 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364778 ⟹ XP_054220753
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,891,836 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364779 ⟹ XP_054220754
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,964,799 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364780 ⟹ XP_054220755
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,961,516 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364781 ⟹ XP_054220756
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,889,800 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364782 ⟹ XP_054220757
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,960,879 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364783 ⟹ XP_054220758
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,892,639 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364784 ⟹ XP_054220759
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,891,836 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364785 ⟹ XP_054220760
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,889,800 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364786 ⟹ XP_054220761
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,961,487 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364787 ⟹ XP_054220762
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,880,218 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364788 ⟹ XP_054220763
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,891,836 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364789 ⟹ XP_054220764
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,891,836 - 111,019,428 (+) NCBI
RefSeq Acc Id:
XM_054364790 ⟹ XP_054220765
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 10 110,996,681 - 111,019,428 (+) NCBI
RefSeq Acc Id:
NP_063968 ⟸ NM_019903
- Peptide Label:
isoform b
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQSPAFREDLECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPINDLPGADTS
hide sequence
RefSeq Acc Id:
NP_058432 ⟸ NM_016824
- Peptide Label:
isoform a
- UniProtKB:
Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q9UEY8 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQS
hide sequence
RefSeq Acc Id:
NP_001112 ⟸ NM_001121
- Peptide Label:
isoform b
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQS
hide sequence
RefSeq Acc Id:
NP_001307520 ⟸ NM_001320591
- Peptide Label:
isoform a
- UniProtKB:
Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q9UEY8 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQSPAFREDLECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPINDLPGADTS
hide sequence
RefSeq Acc Id:
NP_001307521 ⟸ NM_001320592
- Peptide Label:
isoform a
- UniProtKB:
Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q9UEY8 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQSPAFREDLECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPINDLPGADTS
hide sequence
RefSeq Acc Id:
NP_001307522 ⟸ NM_001320593
- Peptide Label:
isoform a
- UniProtKB:
Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q9UEY8 (UniProtKB/Swiss-Prot), Q59EK1 (UniProtKB/TrEMBL), Q5VU08 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQSPAFREDLECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPINDLPGADTS
hide sequence
RefSeq Acc Id:
NP_001307523 ⟸ NM_001320594
- Peptide Label:
isoform c
- UniProtKB:
Q53FL4 (UniProtKB/TrEMBL)
- Sequence:
MKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPINDLPGADTSSYVKGEKLTRCKLASLYRLVDLFGWAHLANTYISVRISKEQDHIIIIPRGLSFSEATASNLVKVNIIGEVVDQGSTNL
hide sequence
RefSeq Acc Id:
XP_024303567 ⟸ XM_024447799
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQSPAFREDLECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPINDLPGADTS
hide sequence
RefSeq Acc Id:
XP_024303571 ⟸ XM_024447803
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQSPAFREDLECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPINDLPGADTS
hide sequence
RefSeq Acc Id:
XP_024303565 ⟸ XM_024447797
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQS
hide sequence
RefSeq Acc Id:
XP_024303574 ⟸ XM_024447806
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQS
hide sequence
RefSeq Acc Id:
XP_024303569 ⟸ XM_024447801
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQSPAFREDLECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPINDLPGADTS
hide sequence
RefSeq Acc Id:
XP_024303575 ⟸ XM_024447807
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQSPAFREDLECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPINDLPGADTS
hide sequence
RefSeq Acc Id:
XP_024303563 ⟸ XM_024447795
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQS
hide sequence
RefSeq Acc Id:
XP_024303572 ⟸ XM_024447804
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQS
hide sequence
RefSeq Acc Id:
XP_024303564 ⟸ XM_024447796
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQSPAFREDLECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPINDLPGADTS
hide sequence
RefSeq Acc Id:
XP_024303573 ⟸ XM_024447805
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQSPAFREDLECLIQEQMKKGHNPTGLLALQQIADYIMANSFSGFSSPPLSLGMVTPINDLPGADTS
hide sequence
RefSeq Acc Id:
XP_024303568 ⟸ XM_024447800
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQS
hide sequence
RefSeq Acc Id:
XP_024303562 ⟸ XM_024447794
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQS
hide sequence
RefSeq Acc Id:
XP_024303566 ⟸ XM_024447798
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQS
hide sequence
RefSeq Acc Id:
XP_024303570 ⟸ XM_024447802
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
- Sequence:
MSSDASQGVITTPPPPSMPHKERYFDRINENDPEYIRERNMSPDLRQDFNMMEQRKRVTQILQS
hide sequence
Ensembl Acc Id:
ENSP00000353286 ⟸ ENST00000360162
Ensembl Acc Id:
ENSP00000277900 ⟸ ENST00000277900
Ensembl Acc Id:
ENSP00000348381 ⟸ ENST00000356080
RefSeq Acc Id:
XP_047280544 ⟸ XM_047424588
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047280546 ⟸ XM_047424590
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047280543 ⟸ XM_047424587
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047280551 ⟸ XM_047424595
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047280545 ⟸ XM_047424589
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047280549 ⟸ XM_047424593
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047280547 ⟸ XM_047424591
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047280550 ⟸ XM_047424594
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047280548 ⟸ XM_047424592
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_047280553 ⟸ XM_047424597
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_054220743 ⟸ XM_054364768
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220752 ⟸ XM_054364777
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220749 ⟸ XM_054364774
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220747 ⟸ XM_054364772
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220762 ⟸ XM_054364787
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220746 ⟸ XM_054364771
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220760 ⟸ XM_054364785
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220756 ⟸ XM_054364781
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220753 ⟸ XM_054364778
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220764 ⟸ XM_054364789
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220751 ⟸ XM_054364776
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220763 ⟸ XM_054364788
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220742 ⟸ XM_054364767
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220759 ⟸ XM_054364784
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220745 ⟸ XM_054364770
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220758 ⟸ XM_054364783
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220750 ⟸ XM_054364775
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220748 ⟸ XM_054364773
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220744 ⟸ XM_054364769
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220757 ⟸ XM_054364782
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220761 ⟸ XM_054364786
- Peptide Label:
isoform X2
- UniProtKB:
Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220755 ⟸ XM_054364780
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220754 ⟸ XM_054364779
- Peptide Label:
isoform X1
- UniProtKB:
Q9UEY8 (UniProtKB/Swiss-Prot), Q92773 (UniProtKB/Swiss-Prot), Q5VU09 (UniProtKB/Swiss-Prot), O43243 (UniProtKB/Swiss-Prot), D3DRA8 (UniProtKB/Swiss-Prot), Q9UEY7 (UniProtKB/Swiss-Prot), Q5VU08 (UniProtKB/TrEMBL), Q59EK1 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_054220765 ⟸ XM_054364790
- Peptide Label:
isoform X3
RGD ID: 6787320 Promoter ID: HG_KWN:11132 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, CD4+TCell_2Hour, HeLa_S3, Jurkat, K562, Lymphoblastoid, NB4 Transcripts: NM_001121, NM_016824, OTTHUMT00000050292, OTTHUMT00000050293, OTTHUMT00000050294, OTTHUMT00000050297, OTTHUMT00000050301, OTTHUMT00000050302, OTTHUMT00000050303 Position: Human Assembly Chr Position (strand) Source Build 36 10 111,757,066 - 111,758,167 (+) MPROMDB
RGD ID: 6787318 Promoter ID: HG_KWN:11134 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Jurkat, K562, Lymphoblastoid, NB4 Transcripts: OTTHUMT00000050298, OTTHUMT00000050299 Position: Human Assembly Chr Position (strand) Source Build 36 10 111,826,374 - 111,826,874 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-01
ADD3
adducin 3
ADD3
adducin 3 (gamma)
Symbol and/or name change
5135510 APPROVED
