Symbol:
Chrng
Name:
cholinergic receptor nicotinic gamma subunit
RGD ID:
2354
Description:
Enables acetylcholine-gated monoatomic cation-selective channel activity. Involved in monoatomic cation transport and skeletal muscle contraction. Part of acetylcholine-gated channel complex. Human ortholog(s) of this gene implicated in contractures, pterygia, and spondylocarpotarsal fusion syndrome. Orthologous to human CHRNG (cholinergic receptor nicotinic gamma subunit); PARTICIPATES IN acetylcholine signaling pathway via nicotinic acetylcholine receptor; INTERACTS WITH acetylcholine; acrylamide; ammonium chloride.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
acetylcholine receptor subunit gamma; AChR gamma subunit; ACHRG; cholinergic receptor, nicotinic gamma; cholinergic receptor, nicotinic, gamma; cholinergic receptor, nicotinic, gamma (muscle); cholinergic receptor, nicotinic, gamma polypeptide
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CHRNG (cholinergic receptor nicotinic gamma subunit) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther
Mus musculus (house mouse):
Chrng (cholinergic receptor, nicotinic, gamma polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Chrng (cholinergic receptor nicotinic gamma subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
CHRNG (cholinergic receptor nicotinic gamma subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CHRNG (cholinergic receptor nicotinic gamma subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Chrng (cholinergic receptor nicotinic gamma subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CHRNG (cholinergic receptor nicotinic gamma subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CHRNG (cholinergic receptor nicotinic gamma subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Chrng (cholinergic receptor nicotinic gamma subunit) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
EIF4E2 (eukaryotic translation initiation factor 4E family member 2) HGNC
EggNOG, Inparanoid, OrthoDB
Homo sapiens (human):
ADD3 (adducin 3) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
CHRNG (cholinergic receptor nicotinic gamma subunit)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Chrng (cholinergic receptor, nicotinic, gamma polypeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
chrng (cholinergic receptor, nicotinic, gamma)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
chrng
Alliance
DIOPT (OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 95,325,984 - 95,332,092 (+) NCBI GRCr8 mRatBN7.2 9 87,878,085 - 87,884,193 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 87,878,085 - 87,914,482 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 96,302,189 - 96,308,180 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 101,438,448 - 101,444,435 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 99,806,343 - 99,812,449 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 94,302,218 - 94,308,591 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 9 94,023,731 - 94,032,190 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 86,012,089 - 86,018,199 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 86,195,507 - 86,201,618 (+) NCBI Celera 9 85,291,469 - 85,297,460 (+) NCBI Celera Cytogenetic Map 9 q35 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
1.
Multiple inhibitory actions of lidocaine on Torpedo nicotinic acetylcholine receptors transplanted to Xenopus oocytes.
Alberola-Die A, etal., J Neurochem. 2011 Jun;117(6):1009-19. doi: 10.1111/j.1471-4159.2011.07271.x. Epub 2011 May 10.
2.
Mammalian nicotinic acetylcholine receptors: from structure to function.
Albuquerque EX, etal., Physiol Rev. 2009 Jan;89(1):73-120. doi: 10.1152/physrev.00015.2008.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
8.
Online Mendelian Inheritance in Man, OMIM (TM).
Online Mendelian Inheritance in Man, OMIM (TM).
9.
A novel mode-of-action mediated by the fetal muscle nicotinic acetylcholine receptor resulting in developmental toxicity in rats.
Rasoulpour RJ, etal., Toxicol Sci. 2012 Jun;127(2):522-34. doi: 10.1093/toxsci/kfs118. Epub 2012 Mar 29.
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
14.
Refined structure of the nicotinic acetylcholine receptor at 4A resolution.
Unwin N, J Mol Biol. 2005 Mar 4;346(4):967-89. doi: 10.1016/j.jmb.2004.12.031. Epub 2005 Jan 25.
15.
Primary structure and functional expression of the alpha-, beta-, gamma-, delta- and epsilon-subunits of the acetylcholine receptor from rat muscle.
Witzemann V, etal., Eur J Biochem 1990 Dec 12;194(2):437-48.
16.
The neuromuscular junction: selective remodeling of synaptic regulators at the nerve/muscle interface.
Witzemann V, etal., Mech Dev. 2013 Jun-Aug;130(6-8):402-11. doi: 10.1016/j.mod.2012.09.004. Epub 2012 Sep 29.
Chrng Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 95,325,984 - 95,332,092 (+) NCBI GRCr8 mRatBN7.2 9 87,878,085 - 87,884,193 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 87,878,085 - 87,914,482 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 96,302,189 - 96,308,180 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 101,438,448 - 101,444,435 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 99,806,343 - 99,812,449 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 94,302,218 - 94,308,591 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_5.0 9 94,023,731 - 94,032,190 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 86,012,089 - 86,018,199 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 86,195,507 - 86,201,618 (+) NCBI Celera 9 85,291,469 - 85,297,460 (+) NCBI Celera Cytogenetic Map 9 q35 NCBI
CHRNG Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 2 232,539,692 - 232,548,115 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 2 232,539,692 - 232,548,115 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 2 233,404,402 - 233,412,825 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 2 233,112,681 - 233,119,282 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 2 233,229,962 - 233,235,931 NCBI Celera 2 227,168,752 - 227,175,352 (+) NCBI Celera Cytogenetic Map 2 q37.1 NCBI HuRef 2 225,255,337 - 225,261,938 (+) NCBI HuRef CHM1_1 2 233,410,527 - 233,417,126 (+) NCBI CHM1_1 T2T-CHM13v2.0 2 233,026,474 - 233,034,899 (+) NCBI T2T-CHM13v2.0
Chrng Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 87,133,533 - 87,139,365 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 87,132,379 - 87,140,416 (+) Ensembl GRCm39 Ensembl GRCm38 1 87,205,811 - 87,211,835 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 87,204,657 - 87,212,694 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 89,102,386 - 89,108,410 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 89,036,981 - 89,042,806 (+) NCBI MGSCv36 mm8 Celera 1 90,178,869 - 90,184,965 (+) NCBI Celera Cytogenetic Map 1 C5 NCBI cM Map 1 44.07 NCBI
Chrng Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955453 3,425,603 - 3,432,695 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955453 3,425,603 - 3,432,695 (-) NCBI ChiLan1.0 ChiLan1.0
CHRNG Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 13 135,143,072 - 135,155,792 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 2B 135,158,037 - 135,166,019 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 2B 119,770,636 - 119,779,332 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 2B 238,689,935 - 238,696,526 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 2B 238,689,935 - 238,696,526 (+) Ensembl panpan1.1 panPan2
CHRNG Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 25 44,178,149 - 44,183,623 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 25 44,178,181 - 44,183,626 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 25 44,672,778 - 44,678,205 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 25 44,435,581 - 44,441,006 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 25 44,435,581 - 44,440,890 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 25 44,361,428 - 44,366,851 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 25 44,206,722 - 44,212,147 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 25 44,361,853 - 44,367,490 (+) NCBI UU_Cfam_GSD_1.0
Chrng Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405303 186,383,042 - 186,388,768 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936525 4,550,987 - 4,556,576 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936525 4,550,987 - 4,556,574 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CHRNG Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 15 133,052,031 - 133,058,544 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 15 133,051,668 - 133,059,935 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 15 146,951,213 - 146,959,626 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CHRNG Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 10 118,558,688 - 118,566,449 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 10 118,559,230 - 118,565,610 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 80,935,848 - 80,941,756 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Chrng
.
Predicted Target Of
Count of predictions: 39 Count of miRNA genes: 35 Interacting mature miRNAs: 38 Transcripts: ENSRNOT00000026529 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631656 Bp108 Blood pressure QTL 108 5.97 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 48598251 93598251 Rat 8662828 Vetf6 Vascular elastic tissue fragility QTL 6 3.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 9 36962359 92058970 Rat 11353957 Bmd92 Bone mineral density QTL 92 0.01 tibia mineral mass (VT:1000283) volumetric bone mineral density (CMO:0001553) 9 46114199 91114199 Rat 724515 Uae16 Urinary albumin excretion QTL 16 8 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 58163035 100929646 Rat 731171 Glom6 Glomerulus QTL 6 2.8 0.0003 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 9 64573531 109573531 Rat 724547 Cm21 Cardiac mass QTL 21 2.7 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 9 79271511 102910209 Rat 61385 Edpm9 Estrogen-dependent pituitary mass QTL 9 3.43 0.05 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 63869687 108869687 Rat 2303178 Bp334 Blood pressure QTL 334 3.7 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 79271511 91616855 Rat 724544 Uae9 Urinary albumin excretion QTL 9 4.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 9 25268044 114175309 Rat 2290450 Scl57 Serum cholesterol level QTL 57 4.15 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 9 36962359 95410867 Rat 1578760 Cm53 Cardiac mass QTL 53 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 9 56771635 101771635 Rat 11353951 Bp394 Blood pressure QTL 394 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 44649921 89649921 Rat 1581580 Uae34 Urinary albumin excretion QTL 34 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 62072275 96470995 Rat 1300134 Bp185 Blood pressure QTL 185 3.73 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 9 61381434 104821652 Rat 12879506 Pur33 Proteinuria QTL 33 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 44649921 89649921 Rat 1354626 Bvd1 Brain ventricular dilatation QTL 1 3.73 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 9 75712843 111552878 Rat 4889852 Pur26 Proteinuria QTL 26 15 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 77813894 101597663 Rat 7794784 Mcs31 Mammary carcinoma susceptibility QTL 31 2.98 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 9 77813894 111552878 Rat 731164 Uae25 Urinary albumin excretion QTL 25 3.5 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 9 25661188 100929786 Rat 10058949 Gmadr5 Adrenal mass QTL 5 2 0.014 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 9 42791513 87976209 Rat 1578757 Pur6 Proteinuria QTL 6 3.3 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 9 62072275 96470995 Rat 4889943 Bss90 Bone structure and strength QTL 90 4.1 tibia area (VT:1000281) tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722) 9 86369631 92058970 Rat
D9Got109
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 87,881,222 - 87,881,453 (+) MAPPER mRatBN7.2 Rnor_6.0 9 94,305,356 - 94,305,586 NCBI Rnor6.0 Rnor_5.0 9 94,028,948 - 94,029,178 UniSTS Rnor5.0 RGSC_v3.4 9 86,015,225 - 86,015,457 RGD RGSC3.4 RGSC_v3.4 9 86,015,227 - 86,015,457 UniSTS RGSC3.4 RGSC_v3.1 9 86,198,644 - 86,198,876 RGD Celera 9 85,294,488 - 85,294,718 UniSTS RH 2.0 Map 9 849.4 RGD Cytogenetic Map 9 q35 UniSTS
D9Wox27
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 9 87,881,304 - 87,881,532 (+) MAPPER mRatBN7.2 Rnor_6.0 9 94,305,438 - 94,305,665 NCBI Rnor6.0 Rnor_5.0 9 94,029,030 - 94,029,257 UniSTS Rnor5.0 RGSC_v3.4 9 86,015,309 - 86,015,536 UniSTS RGSC3.4 Celera 9 85,294,570 - 85,294,797 UniSTS Cytogenetic Map 9 q35 UniSTS
UniSTS:238129
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 9 95,331,151 - 95,331,904 (+) Marker Load Pipeline mRatBN7.2 9 87,883,252 - 87,884,005 (+) MAPPER mRatBN7.2 Rnor_6.0 9 94,307,651 - 94,308,403 NCBI Rnor6.0 Rnor_5.0 9 94,031,243 - 94,031,995 UniSTS Rnor5.0 RGSC_v3.4 9 86,017,259 - 86,018,011 UniSTS RGSC3.4 Celera 9 85,296,520 - 85,297,272 UniSTS Cytogenetic Map 9 q35 UniSTS
Chrng
Rat Assembly Chr Position (strand) Source JBrowse Celera 9 85,292,457 - 85,294,126 UniSTS Cytogenetic Map 9 q35 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
RefSeq Acc Id:
NM_019145 ⟹ NP_062018
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 95,325,984 - 95,332,092 (+) NCBI mRatBN7.2 9 87,878,085 - 87,884,193 (+) NCBI Rnor_6.0 9 94,302,218 - 94,308,591 (+) NCBI Rnor_5.0 9 94,023,731 - 94,032,190 (+) NCBI RGSC_v3.4 9 86,012,089 - 86,018,199 (+) RGD Celera 9 85,291,469 - 85,297,460 (+) RGD
Sequence:
CTGGTGGGGCCTGATAGAGCTGGCAGGGTTGGCTGGGAGGGGCGTGTAGGCTGACACAGGACACTCCAACCCCCCAACCCCAAGACCTGTAAAGCTACTGTCCTACTCATCACTGGGCAGAACTGAGG
hide sequence
RefSeq Acc Id:
NP_062018 ⟸ NM_019145
- Peptide Label:
precursor
- UniProtKB:
P18916 (UniProtKB/Swiss-Prot), A0A8I6A2R4 (UniProtKB/TrEMBL), A6JWL3 (UniProtKB/TrEMBL)
- Sequence:
MHGGQGPQLLLLLLATCLGAQSRNQEERLLADLMRNYDPHLRPAERDSDVVNVSLKLTLTNLISLNEREEALTTNVWIEMQWCDYRLRWDPKDYEGLWILRVPSTMVWQPDIVLGNNVDGVFEVALYC
hide sequence
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
Chrng
cholinergic receptor nicotinic gamma subunit
Chrng
cholinergic receptor, nicotinic gamma
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-12-09
Chrng
cholinergic receptor, nicotinic gamma
Chrng
cholinergic receptor, nicotinic, gamma (muscle)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2012-07-16
Chrng
cholinergic receptor, nicotinic, gamma (muscle)
Chrng
cholinergic receptor, nicotinic, gamma
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-09-29
Chrng
cholinergic receptor, nicotinic, gamma
Chrng
cholinergic receptor, nicotinic, gamma polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Chrng
cholinergic receptor, nicotinic, gamma polypeptide
Symbol and Name status set to approved
70586 APPROVED
