Symbol:
Igsf10
Name:
immunoglobulin superfamily, member 10
RGD ID:
735030
Description:
Involved in tissue regeneration. Acts upstream of or within ossification. Predicted to be active in extracellular region. Orthologous to human IGSF10 (immunoglobulin superfamily member 10); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 17beta-estradiol 3-benzoate.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
bone specific CMF608; calvaria mechanical force protein 608; CMF608; immunoglobulin superfamily member 10; LOC310448
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
IGSF10 (immunoglobulin superfamily member 10) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Igsf10 (immunoglobulin superfamily, member 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Igsf10 (immunoglobulin superfamily member 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
IGSF10 (immunoglobulin superfamily member 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
IGSF10 (immunoglobulin superfamily member 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Igsf10 (immunoglobulin superfamily member 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
IGSF10 (immunoglobulin superfamily member 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
IGSF10 (immunoglobulin superfamily member 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Igsf10 (immunoglobulin superfamily member 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MXRA5 (matrix remodeling associated 5) HGNC
OrthoDB
Homo sapiens (human):
ERLIN2 (ER lipid raft associated 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
IGSF10 (immunoglobulin superfamily member 10)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Igsf10 (immunoglobulin superfamily, member 10)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
igsf10 (immunoglobulin superfamily, member 10)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
igsf10
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 145,725,868 - 145,754,850 (-) NCBI GRCr8 mRatBN7.2 2 143,575,710 - 143,605,044 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 143,576,070 - 143,604,773 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 150,215,446 - 150,244,161 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 148,327,870 - 148,356,620 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 142,960,281 - 142,989,031 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 149,535,199 - 149,564,180 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 149,533,151 - 149,564,113 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 168,967,564 - 168,996,524 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 148,704,646 - 148,734,103 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 148,654,608 - 148,684,073 (-) NCBI Celera 2 138,000,516 - 138,029,209 (-) NCBI Celera Cytogenetic Map 2 q26 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Igsf10 Rat 1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene multiple interactions ISO RGD:1622038 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Igsf10 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of IGSF10 mRNA CTD PMID:17557909 Igsf10 Rat 17beta-estradiol increases expression ISO RGD:1622038 6480464 Estradiol results in increased expression of IGSF10 mRNA CTD PMID:19484750 Igsf10 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of IGSF10 mRNA CTD PMID:32145629 Igsf10 Rat 17beta-estradiol multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of IGSF10 mRNA CTD PMID:32741896 Igsf10 Rat 17beta-estradiol 3-benzoate multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of IGSF10 mRNA CTD PMID:32741896 Igsf10 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO RGD:1622038 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Igsf10 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO RGD:1622038 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Igsf10 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO RGD:1352652 6480464 2,5,2',5'-tetrachlorobiphenyl analog results in increased expression of IGSF10 mRNA CTD PMID:36804509 Igsf10 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of IGSF10 mRNA CTD PMID:33387578 Igsf10 Rat 2,4,4'-trichlorobiphenyl multiple interactions ISO RGD:1622038 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Igsf10 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:1352652 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Igsf10 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1622038 6480464 bisphenol S results in increased expression of IGSF10 mRNA CTD PMID:30951980 Igsf10 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of IGSF10 mRNA CTD PMID:24780913 Igsf10 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of IGSF10 mRNA CTD PMID:30047161 Igsf10 Rat 7,12-dimethyltetraphene decreases expression EXP 6480464 9,10-Dimethyl-1,2-benzanthracene results in decreased expression of IGSF10 mRNA CTD PMID:19480007 Igsf10 Rat benzo[a]pyrene decreases expression ISO RGD:1352652 6480464 Benzo(a)pyrene results in decreased expression of IGSF10 mRNA CTD PMID:20106945|PMID:32234424 Igsf10 Rat benzo[a]pyrene increases methylation ISO RGD:1352652 6480464 Benzo(a)pyrene results in increased methylation of IGSF10 promoter CTD PMID:27901495 Igsf10 Rat benzo[a]pyrene decreases expression ISO RGD:1622038 6480464 Benzo(a)pyrene results in decreased expression of IGSF10 mRNA CTD PMID:21569818 Igsf10 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of IGSF10 mRNA CTD PMID:25181051 Igsf10 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of IGSF10 mRNA CTD PMID:33296240 Igsf10 Rat bisphenol A multiple interactions ISO RGD:1352652 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Igsf10 Rat bisphenol F increases expression ISO RGD:1622038 6480464 bisphenol F results in increased expression of IGSF10 mRNA CTD PMID:30951980 Igsf10 Rat butanal decreases expression ISO RGD:1352652 6480464 butyraldehyde results in decreased expression of IGSF10 mRNA CTD PMID:26079696 Igsf10 Rat carbon nanotube decreases expression ISO RGD:1622038 6480464 Nanotubes, Carbon analog results in decreased expression of IGSF10 mRNA; Nanotubes, Carbon results in decreased more ... CTD PMID:25554681 Igsf10 Rat clobetasol decreases expression ISO RGD:1622038 6480464 Clobetasol results in decreased expression of IGSF10 mRNA CTD PMID:27462272 Igsf10 Rat clotrimazole decreases expression EXP 6480464 Clotrimazole results in decreased expression of IGSF10 mRNA CTD PMID:30047161 Igsf10 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of IGSF10 mRNA CTD PMID:26577399 Igsf10 Rat cyclosporin A decreases expression ISO RGD:1352652 6480464 Cyclosporine results in decreased expression of IGSF10 mRNA CTD PMID:20106945 Igsf10 Rat dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of IGSF10 mRNA CTD PMID:20032058 Igsf10 Rat dexamethasone multiple interactions ISO RGD:1352652 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Igsf10 Rat dexamethasone multiple interactions EXP 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of IGSF10 mRNA] CTD PMID:20032058 Igsf10 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of IGSF10 mRNA CTD PMID:37077353 Igsf10 Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of IGSF10 mRNA CTD PMID:37567419 Igsf10 Rat diquat decreases expression ISO RGD:1622038 6480464 Diquat results in decreased expression of IGSF10 mRNA CTD PMID:36851058 Igsf10 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of IGSF10 mRNA CTD PMID:25152437 Igsf10 Rat dorsomorphin multiple interactions ISO RGD:1352652 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Igsf10 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of IGSF10 mRNA CTD PMID:29391264 Igsf10 Rat folic acid decreases expression ISO RGD:1622038 6480464 Folic Acid results in decreased expression of IGSF10 mRNA CTD PMID:25629700 Igsf10 Rat furan increases expression EXP 6480464 furan results in increased expression of IGSF10 mRNA CTD PMID:27387713 Igsf10 Rat graphene oxide decreases expression ISO RGD:1622038 6480464 graphene oxide results in decreased expression of IGSF10 mRNA CTD PMID:33227293 Igsf10 Rat heparin multiple interactions EXP 6480464 Heparin inhibits the reaction [[Lipopolysaccharides co-treated with Ranitidine] results in increased expression of IGSF10 mRNA] CTD PMID:16401727 Igsf10 Rat indometacin multiple interactions ISO RGD:1352652 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Igsf10 Rat iron dichloride decreases expression ISO RGD:1352652 6480464 ferrous chloride results in decreased expression of IGSF10 mRNA CTD PMID:35984750 Igsf10 Rat ketoconazole decreases expression EXP 6480464 Ketoconazole results in decreased expression of IGSF10 mRNA CTD PMID:37077353 Igsf10 Rat lipopolysaccharide multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of IGSF10 mRNA; Heparin inhibits the reaction more ... CTD PMID:16401727 Igsf10 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of IGSF10 mRNA CTD PMID:30047161 Igsf10 Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of IGSF10 mRNA CTD PMID:31378766 Igsf10 Rat microcystin-LR increases expression EXP 6480464 cyanoginosin LR results in increased expression of IGSF10 mRNA CTD PMID:34740672 Igsf10 Rat mono(2-ethylhexyl) phthalate increases expression ISO RGD:1352652 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of IGSF10 mRNA CTD PMID:36695872 Igsf10 Rat N-Nitrosopyrrolidine increases expression ISO RGD:1352652 6480464 N-Nitrosopyrrolidine results in increased expression of IGSF10 mRNA CTD PMID:32234424 Igsf10 Rat N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of IGSF10 mRNA; Heparin inhibits the reaction more ... CTD PMID:16401727 Igsf10 Rat nickel atom decreases expression ISO RGD:1352652 6480464 Nickel results in decreased expression of IGSF10 mRNA CTD PMID:25583101 Igsf10 Rat okadaic acid increases expression ISO RGD:1352652 6480464 Okadaic Acid results in increased expression of IGSF10 mRNA CTD PMID:38832940 Igsf10 Rat ozone multiple interactions ISO RGD:1622038 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased more ... CTD PMID:27106289|PMID:34911549 Igsf10 Rat paracetamol affects expression ISO RGD:1622038 6480464 Acetaminophen affects the expression of IGSF10 mRNA CTD PMID:17562736 Igsf10 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of IGSF10 mRNA CTD PMID:32680482 Igsf10 Rat PCB138 multiple interactions ISO RGD:1622038 6480464 [2,4,4'-trichlorobiphenyl co-treated with 2,5,2',5'-tetrachlorobiphenyl co-treated with 2,4,5,2',5'-pentachlorobiphenyl co-treated with 2,2',3',4,4',5-hexachlorobiphenyl co-treated with 2,4,5,2',4',5'-hexachlorobiphenyl co-treated with more ... CTD PMID:25510870 Igsf10 Rat pioglitazone multiple interactions ISO RGD:1622038 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of IGSF10 mRNA CTD PMID:27935865 Igsf10 Rat ranitidine multiple interactions EXP 6480464 [Lipopolysaccharides co-treated with Ranitidine] results in increased expression of IGSF10 mRNA; Heparin inhibits the reaction more ... CTD PMID:16401727 Igsf10 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of IGSF10 mRNA CTD PMID:28374803 Igsf10 Rat rotenone increases expression ISO RGD:1352652 6480464 Rotenone results in increased expression of IGSF10 mRNA CTD PMID:29955902 Igsf10 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO RGD:1352652 6480464 S-(1,2-dichlorovinyl)cysteine results in decreased expression of IGSF10 mRNA CTD PMID:33725128|PMID:35811015 Igsf10 Rat SB 431542 multiple interactions ISO RGD:1352652 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Igsf10 Rat silicon dioxide decreases expression ISO RGD:1352652 6480464 Silicon Dioxide analog results in decreased expression of IGSF10 mRNA CTD PMID:25895662 Igsf10 Rat sodium arsenite increases expression ISO RGD:1622038 6480464 sodium arsenite results in increased expression of IGSF10 mRNA CTD PMID:37682722 Igsf10 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of IGSF10 mRNA CTD PMID:30047161 Igsf10 Rat testosterone multiple interactions EXP 6480464 [estradiol 3-benzoate co-treated with [Testosterone co-treated with Estradiol]] results in increased expression of IGSF10 mRNA; more ... CTD PMID:20032058|PMID:32741896 Igsf10 Rat titanium dioxide decreases expression ISO RGD:1622038 6480464 titanium dioxide results in decreased expression of IGSF10 mRNA CTD PMID:27760801 Igsf10 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of IGSF10 mRNA CTD PMID:33387578 Igsf10 Rat trichostatin A increases expression ISO RGD:1352652 6480464 trichostatin A results in increased expression of IGSF10 mRNA CTD PMID:24935251 Igsf10 Rat valproic acid increases expression ISO RGD:1352652 6480464 Valproic Acid results in increased expression of IGSF10 mRNA CTD PMID:24383497|PMID:24935251|PMID:26272509 Igsf10 Rat valproic acid multiple interactions ISO RGD:1352652 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386
1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-estradiol 3-benzoate (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4,4'-trichlorobiphenyl (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) butanal (ISO) carbon nanotube (ISO) clobetasol (ISO) clotrimazole (EXP) Cuprizon (EXP) cyclosporin A (ISO) dexamethasone (EXP,ISO) diethylstilbestrol (EXP) dimethylarsinic acid (EXP) diquat (ISO) diuron (EXP) dorsomorphin (ISO) endosulfan (EXP) folic acid (ISO) furan (EXP) graphene oxide (ISO) heparin (EXP) indometacin (ISO) iron dichloride (ISO) ketoconazole (EXP) lipopolysaccharide (EXP) methimazole (EXP) methylmercury chloride (EXP) microcystin-LR (EXP) mono(2-ethylhexyl) phthalate (ISO) N-Nitrosopyrrolidine (ISO) N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP) nickel atom (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (ISO) paraquat (EXP) PCB138 (ISO) pioglitazone (ISO) ranitidine (EXP) rotenone (EXP,ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulfadimethoxine (EXP) testosterone (EXP) titanium dioxide (ISO) trichloroethene (EXP) trichostatin A (ISO) valproic acid (ISO)
Igsf10 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 145,725,868 - 145,754,850 (-) NCBI GRCr8 mRatBN7.2 2 143,575,710 - 143,605,044 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 143,576,070 - 143,604,773 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 150,215,446 - 150,244,161 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 148,327,870 - 148,356,620 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 142,960,281 - 142,989,031 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 149,535,199 - 149,564,180 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 149,533,151 - 149,564,113 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 168,967,564 - 168,996,524 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 148,704,646 - 148,734,103 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 148,654,608 - 148,684,073 (-) NCBI Celera 2 138,000,516 - 138,029,209 (-) NCBI Celera Cytogenetic Map 2 q26 NCBI
IGSF10 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 151,432,432 - 151,619,925 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 151,425,384 - 151,461,061 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 151,153,991 - 151,257,104 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 152,637,167 - 152,659,187 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 152,637,174 - 152,659,195 NCBI Celera 3 149,572,109 - 149,594,842 (-) NCBI Celera Cytogenetic Map 3 q25.1 NCBI HuRef 3 148,533,138 - 148,555,872 (-) NCBI HuRef CHM1_1 3 151,116,911 - 151,139,641 (-) NCBI CHM1_1 T2T-CHM13v2.0 3 154,193,223 - 154,376,990 (-) NCBI T2T-CHM13v2.0
Igsf10 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 59,224,156 - 59,256,836 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 59,224,156 - 59,251,815 (-) Ensembl GRCm39 Ensembl GRCm38 3 59,316,735 - 59,344,438 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 59,316,735 - 59,344,394 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 59,120,657 - 59,148,178 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 59,404,664 - 59,432,185 (-) NCBI MGSCv36 mm8 Celera 3 59,004,000 - 59,031,501 (-) NCBI Celera Cytogenetic Map 3 D NCBI cM Map 3 29.03 NCBI
Igsf10 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955448 2,528,703 - 2,557,656 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955448 2,532,973 - 2,557,650 (-) NCBI ChiLan1.0 ChiLan1.0
IGSF10 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 149,334,202 - 149,362,921 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 149,339,410 - 149,361,474 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 148,461,331 - 148,488,696 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 156,033,528 - 156,056,003 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 156,030,099 - 156,056,003 (-) Ensembl panpan1.1 panPan2
IGSF10 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 23 46,002,163 - 46,058,656 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 23 46,002,308 - 46,059,936 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 23 45,866,591 - 45,923,482 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 23 46,628,844 - 46,685,867 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 23 46,629,318 - 46,687,214 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 23 46,217,698 - 46,274,621 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 23 46,269,685 - 46,326,605 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 23 46,546,832 - 46,603,735 (-) NCBI UU_Cfam_GSD_1.0
Igsf10 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 90,079,550 - 90,109,254 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936758 1,660,313 - 1,686,404 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936758 1,660,254 - 1,686,404 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
IGSF10 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 91,625,431 - 91,679,079 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 91,625,421 - 91,679,494 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 99,845,339 - 99,881,443 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IGSF10 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 15 39,200,244 - 39,266,759 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 15 39,240,849 - 39,265,142 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 12,055,884 - 12,081,599 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Igsf10
.
Predicted Target Of
Count of predictions: 72 Count of miRNA genes: 66 Interacting mature miRNAs: 70 Transcripts: ENSRNOT00000018628 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 2293671 Bss44 Bone structure and strength QTL 44 10.97 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 2 43162366 148478373 Rat 631566 Bp90 Blood pressure QTL 90 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 102803808 147803808 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 6907363 Bp357 Blood pressure QTL 357 4.1 0.002 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 129540907 174540907 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1358360 Sradr2 Stress Responsive Adrenal Weight QTL 2 10.24 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 2 129164097 152195315 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 1581578 Cm49 Cardiac mass QTL 49 4.9 0.01 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 127447387 143657569 Rat 1549828 Bp258 Blood pressure QTL 258 0.03 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 142323368 150650069 Rat 631198 Cm22 Cardiac mass QTL 22 4.3 0.0008 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 76539322 150540526 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1302794 Stl27 Serum triglyceride level QTL 27 4.4 0.0001 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 2 25413423 143657569 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 12879844 Kidm62 Kidney mass QTL 62 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 142323368 146786035 Rat 1358901 Cm38 Cardiac mass QTL 38 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1359030 Bp277 Blood pressure QTL 277 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 185876470 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 12879841 Cm87 Cardiac mass QTL 87 0.026 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 2 142323368 146786035 Rat 1581502 Esta3 Estrogen-induced thymic atrophy QTL 3 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 136916935 189599348 Rat 12879842 Cm88 Cardiac mass QTL 88 0.042 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 2 142323368 146786035 Rat 1358899 Kidm23 Kidney mass QTL 23 3.88 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 12879843 Am3 Aortic mass QTL 3 0.016 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 2 142323368 146786035 Rat 1358908 Bw49 Body weight QTL 49 3.36 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1582257 Gluco21 Glucose level QTL 21 3.1 0.0035 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 118111229 157142209 Rat 1358910 Kidm27 Kidney mass QTL 27 5.77 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358911 Kidm28 Kidney mass QTL 28 5.42 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1358904 Cm39 Cardiac mass QTL 39 2.26 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 157142209 Rat 1359035 Bp276 Blood pressure QTL 276 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 114837527 143657569 Rat 8662836 Vetf8 Vascular elastic tissue fragility QTL 8 0.66 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 104559726 149559726 Rat 1358887 Bw50 Body weight QTL 50 2.39 body mass (VT:0001259) body weight (CMO:0000012) 2 25413652 157142078 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 5135226 Leukc2 Leukocyte quantity QTL 2 eosinophil quantity (VT:0002602) blood eosinophil count (CMO:0000033) 2 118111229 149559726 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 2299162 Iddm32 Insulin dependent diabetes mellitus QTL 32 2.36 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 2 78665616 143657569 Rat 1358894 Kidm24 Kidney mass QTL 24 4.03 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 25413423 157142209 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 7488933 Bp368 Blood pressure QTL 368 0.004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 142323368 147803808 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 738007 Anxrr7 Anxiety related response QTL 7 4.4 exploratory behavior trait (VT:0010471) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 118189491 163189491 Rat 9685068 Swd7 Spike wave discharge measurement QTL 7 3.2 0.01 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge rate (CMO:0001739) 2 141656606 147588984 Rat 2293835 Kiddil5 Kidney dilation QTL 5 3.8 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 157142209 Rat 1581552 Pur12 Proteinuria QTL 12 5.19 0.0009 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 2 112103657 148076632 Rat 1558653 Prcr1 Prostate cancer resistance QTL 1 5 prostate integrity trait (VT:0010571) area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899) 2 72532993 157142209 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 2293843 Kiddil6 Kidney dilation QTL 6 3.1 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 42804607 182042367 Rat 1354594 Despr10 Despair related QTL 10 2e-06 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 2 114654253 159654253 Rat 152025206 Hrtrt23 Heart rate QTL 23 5.98 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 152025204 Hrtrt22 Heart rate QTL 22 5.6 heart pumping trait (VT:2000009) 2 28484589 169504100 Rat 1354601 Slep1 Serum leptin concentration QTL 1 5.39 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 2 43171017 184114403 Rat
RH134080
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 2 145,744,573 - 145,744,765 (+) Marker Load Pipeline mRatBN7.2 2 143,594,767 - 143,594,959 (+) MAPPER mRatBN7.2 Rnor_6.0 2 149,553,891 - 149,554,082 NCBI Rnor6.0 Rnor_5.0 2 168,986,267 - 168,986,458 UniSTS Rnor5.0 RGSC_v3.4 2 148,723,338 - 148,723,529 UniSTS RGSC3.4 Celera 2 138,019,204 - 138,019,395 UniSTS RH 3.4 Map 2 880.9 UniSTS Cytogenetic Map 2 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000018628 ⟹ ENSRNOP00000018629
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 143,576,070 - 143,604,773 (-) Ensembl Rnor_6.0 Ensembl 2 149,535,484 - 149,564,113 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000086186 ⟹ ENSRNOP00000069220
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 2 149,533,151 - 149,563,905 (-) Ensembl
RefSeq Acc Id:
NM_198768 ⟹ NP_942063
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 145,725,878 - 145,754,579 (-) NCBI mRatBN7.2 2 143,576,068 - 143,604,773 (-) NCBI Rnor_6.0 2 149,535,199 - 149,563,896 (-) NCBI Rnor_5.0 2 168,967,564 - 168,996,524 (-) NCBI RGSC_v3.4 2 148,704,646 - 148,734,103 (-) RGD Celera 2 138,000,516 - 138,029,209 (-) RGD
Sequence:
GTCCAGAAAAAGGAAAGTGCTGGAGGGGAGTGGGGACAAAAGCAGCGACCAAGTGAATGTCACTTCAGTGACTGAGGCCAGGCAAAACGCGCGGGAAGGATTTTGTGTAGCTTGGGACCCTTTCATAG
hide sequence
RefSeq Acc Id:
XM_017590862 ⟹ XP_017446351
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 145,725,868 - 145,754,850 (-) NCBI mRatBN7.2 2 143,575,710 - 143,605,043 (-) NCBI Rnor_6.0 2 149,535,212 - 149,564,180 (-) NCBI
Sequence:
CAAACGCGCAAGCGAGCCTGAGCCTGCGTTGGCGCTGGTGGTCCCCGGGTCGATGGCCCGCCCA
hide sequence
RefSeq Acc Id:
XM_039102264 ⟹ XP_038958192
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 145,725,868 - 145,754,636 (-) NCBI mRatBN7.2 2 143,575,710 - 143,604,833 (-) NCBI
RefSeq Acc Id:
XM_039102265 ⟹ XP_038958193
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 145,725,868 - 145,754,850 (-) NCBI mRatBN7.2 2 143,575,710 - 143,605,044 (-) NCBI
RefSeq Acc Id:
XM_039102266 ⟹ XP_038958194
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 145,725,868 - 145,754,850 (-) NCBI mRatBN7.2 2 143,575,710 - 143,605,044 (-) NCBI
RefSeq Acc Id:
XM_039102267 ⟹ XP_038958195
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 145,725,868 - 145,754,850 (-) NCBI mRatBN7.2 2 143,575,710 - 143,605,044 (-) NCBI
RefSeq Acc Id:
XM_039102268 ⟹ XP_038958196
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 145,725,868 - 145,745,878 (-) NCBI mRatBN7.2 2 143,575,710 - 143,596,697 (-) NCBI
RefSeq Acc Id:
NP_942063 ⟸ NM_198768
- Peptide Label:
precursor
- UniProtKB:
Q6WRH9 (UniProtKB/Swiss-Prot), G3V7S1 (UniProtKB/TrEMBL), A6JVK7 (UniProtKB/TrEMBL)
- Sequence:
MQVRGREVSGLLISLTAVCLVVTPGSRACPRRCACYVPTEVHCTFRYLTSIPDGIPANVERINLGYNSLTRLTENDFDGLSKLELLMLHSNGIHRVSDKTFSGLQSLQVLKMSYNKVQIIRKDTFYGL
hide sequence
RefSeq Acc Id:
XP_017446351 ⟸ XM_017590862
- Peptide Label:
isoform X2
- UniProtKB:
Q6WRH9 (UniProtKB/Swiss-Prot), G3V7S1 (UniProtKB/TrEMBL), A6JVK7 (UniProtKB/TrEMBL)
- Sequence:
MQVRGREVSGLLISLTAVCLVVTPGSRACPRRCACYVPTEVHCTFRYLTSIPDGIPANVERINL
hide sequence
Ensembl Acc Id:
ENSRNOP00000018629 ⟸ ENSRNOT00000018628
Ensembl Acc Id:
ENSRNOP00000069220 ⟸ ENSRNOT00000086186
RefSeq Acc Id:
XP_038958195 ⟸ XM_039102267
- Peptide Label:
isoform X1
- UniProtKB:
Q6WRH9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038958194 ⟸ XM_039102266
- Peptide Label:
isoform X1
- UniProtKB:
Q6WRH9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038958193 ⟸ XM_039102265
- Peptide Label:
isoform X1
- UniProtKB:
Q6WRH9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038958192 ⟸ XM_039102264
- Peptide Label:
isoform X1
- UniProtKB:
Q6WRH9 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_038958196 ⟸ XM_039102268
- Peptide Label:
isoform X3
- UniProtKB:
Q6WRH9 (UniProtKB/Swiss-Prot)
RGD ID: 13691350 Promoter ID: EPDNEW_R1874 Type: initiation region Name: Igsf10_1 Description: immunoglobulin superfamily, member 10 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 149,564,087 - 149,564,147 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2005-11-17
Igsf10
immunoglobulin superfamily, member 10
Name updated
1299863 APPROVED
2004-09-10
Igsf10
bone specific CMF608
LOC310448
Symbol and Name updated
1299863 APPROVED
Note Type
Note
Reference
gene_domains
contains an N-terminal signal peptide, six leucine-rich repeats, and 12 immunoglobulin-like repeats, 10 of which are clustered in the C-terminus
1302504
gene_expression
highest expression in mesenchymal osteochondroprogenitors with fibroblast-like morphology found in the perichondral fibrous ring of La Croix, periosteum, endosteum of normal bone as well as in the activated periosteum and early fibrous callus generated postfracture
1302504
gene_regulation
is up-regulated in response to mechanical force and appears to be down-regulated prior to terminal differentiation
1302504
