Symbol:
Wfs1
Name:
wolframin ER transmembrane glycoprotein
RGD ID:
731650
MGI Page
MGI
Description:
Enables ATPase binding activity. Involved in several processes, including negative regulation of apoptotic process; protein stabilization; and regulation of protein metabolic process. Located in endoplasmic reticulum. Is expressed in several structures, including brain; craniocervical region bone; diaphragm; stomach; and vertebral axis musculature. Used to study Wolfram syndrome 1 and nonsyndromic deafness. Human ortholog(s) of this gene implicated in several diseases, including Wolfram syndrome (multiple); auditory system disease (multiple); cataract 41; diabetes mellitus (multiple); and optic atrophy (multiple). Orthologous to human WFS1 (wolframin ER transmembrane glycoprotein).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AI481085; wol; Wolfram syndrome 1 homolog; Wolfram syndrome 1 homolog (human); Wolfram syndrome 1 protein homolog; wolframin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
WFS1 (wolframin ER transmembrane glycoprotein) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Wfs1 (wolframin ER transmembrane glycoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Wfs1 (wolframin ER transmembrane glycoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
WFS1 (wolframin ER transmembrane glycoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
WFS1 (wolframin ER transmembrane glycoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Wfs1 (wolframin ER transmembrane glycoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
WFS1 (wolframin ER transmembrane glycoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
WFS1 (wolframin ER transmembrane glycoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Wfs1 (wolframin ER transmembrane glycoprotein) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Wfs1 (wolframin ER transmembrane glycoprotein)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
WFS1 (wolframin ER transmembrane glycoprotein)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
wfs1a (Wolfram syndrome 1a (wolframin))
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER|ZFIN)
Danio rerio (zebrafish):
wfs1b (Wolfram syndrome 1b (wolframin))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
wfs1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
wfs1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 37,123,448 - 37,146,326 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 37,123,448 - 37,146,549 (-) Ensembl GRCm39 Ensembl GRCm38 5 36,966,104 - 36,988,982 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 36,966,104 - 36,989,205 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 37,357,343 - 37,380,221 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 37,254,356 - 37,277,158 (-) NCBI MGSCv36 mm8 Celera 5 34,417,849 - 34,440,871 (-) NCBI Celera Cytogenetic Map 5 B3 NCBI cM Map 5 19.46 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Wfs1 Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of WFS1 mRNA CTD PMID:22206623 Wfs1 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of WFS1 mRNA CTD PMID:17942748 Wfs1 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of WFS1 mRNA CTD PMID:17942748 Wfs1 Mouse 17beta-estradiol affects expression ISO WFS1 (Homo sapiens) 6480464 Estradiol affects the expression of WFS1 mRNA CTD PMID:14699072 Wfs1 Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of WFS1 mRNA CTD PMID:39298647 Wfs1 Mouse 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO WFS1 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of WFS1 mRNA CTD PMID:29581250 Wfs1 Mouse 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO Wfs1 (Rattus norvegicus) 6480464 2 more ... CTD PMID:27291303 Wfs1 Mouse 2,2',4,4'-Tetrabromodiphenyl ether affects expression EXP 6480464 2 more ... CTD PMID:30294300 Wfs1 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of WFS1 mRNA CTD PMID:17942748 Wfs1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of WFS1 mRNA CTD PMID:21570461 Wfs1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of WFS1 mRNA CTD PMID:19933214 Wfs1 Mouse 2-methylcholine affects expression ISO WFS1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of WFS1 mRNA CTD PMID:21179406 Wfs1 Mouse 3,4-methylenedioxymethamphetamine decreases expression EXP 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of WFS1 mRNA CTD PMID:20188158 Wfs1 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO WFS1 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of WFS1 gene CTD PMID:31601247 Wfs1 Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of WFS1 gene CTD PMID:31683443 Wfs1 Mouse 6-propyl-2-thiouracil affects expression ISO Wfs1 (Rattus norvegicus) 6480464 Propylthiouracil affects the expression of WFS1 mRNA CTD PMID:24780913 Wfs1 Mouse aconitine decreases expression ISO Wfs1 (Rattus norvegicus) 6480464 Aconitine results in decreased expression of WFS1 protein CTD PMID:33236894 Wfs1 Mouse afimoxifene multiple interactions ISO WFS1 (Homo sapiens) 6480464 afimoxifene inhibits the reaction [Estrogens results in increased expression of WFS1 mRNA] CTD PMID:21233418 Wfs1 Mouse aflatoxin B1 increases methylation ISO WFS1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of WFS1 intron CTD PMID:30157460 Wfs1 Mouse Aflatoxin B2 alpha increases methylation ISO WFS1 (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of WFS1 intron CTD PMID:30157460 Wfs1 Mouse ammonium chloride affects expression ISO Wfs1 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of WFS1 mRNA CTD PMID:16483693 Wfs1 Mouse aristolochic acid A increases expression ISO WFS1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of WFS1 mRNA CTD PMID:33212167 Wfs1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of WFS1 mRNA CTD PMID:22228805 Wfs1 Mouse benzo[a]pyrene increases methylation ISO WFS1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of WFS1 3' UTR CTD PMID:27901495 Wfs1 Mouse benzo[a]pyrene decreases methylation EXP 6480464 Benzo(a)pyrene results in decreased methylation of WFS1 intron CTD PMID:27901495 Wfs1 Mouse beta-naphthoflavone decreases expression ISO WFS1 (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of WFS1 mRNA CTD PMID:32858204 Wfs1 Mouse bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of WFS1 mRNA CTD PMID:39150890 Wfs1 Mouse bisphenol A increases expression ISO WFS1 (Homo sapiens) 6480464 bisphenol A results in increased expression of WFS1 mRNA CTD PMID:20678512 Wfs1 Mouse bisphenol A decreases expression ISO WFS1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of WFS1 protein CTD PMID:33376534 Wfs1 Mouse bisphenol A decreases expression ISO Wfs1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of WFS1 mRNA CTD PMID:30816183 more ... Wfs1 Mouse bisphenol F increases expression ISO WFS1 (Homo sapiens) 6480464 bisphenol F results in increased expression of WFS1 protein CTD PMID:34186270 Wfs1 Mouse Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of WFS1 mRNA CTD PMID:39150890 Wfs1 Mouse cadmium atom multiple interactions ISO WFS1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of WFS1 mRNA CTD PMID:35301059 Wfs1 Mouse cadmium dichloride multiple interactions ISO WFS1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of WFS1 mRNA CTD PMID:35301059 Wfs1 Mouse caffeine affects phosphorylation ISO WFS1 (Homo sapiens) 6480464 Caffeine affects the phosphorylation of WFS1 protein CTD PMID:35688186 Wfs1 Mouse carbon nanotube increases expression EXP 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Wfs1 Mouse CGP 52608 multiple interactions ISO WFS1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to WFS1 gene] CTD PMID:28238834 Wfs1 Mouse chromium(6+) affects expression EXP 6480464 chromium hexavalent ion affects the expression of WFS1 mRNA CTD PMID:28472532 Wfs1 Mouse cisplatin multiple interactions ISO WFS1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of WFS1 mRNA CTD PMID:27392435 Wfs1 Mouse clobetasol increases expression EXP 6480464 Clobetasol results in increased expression of WFS1 mRNA CTD PMID:27462272 Wfs1 Mouse copper(II) sulfate decreases expression ISO WFS1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of WFS1 mRNA CTD PMID:19549813 Wfs1 Mouse coumarin decreases phosphorylation ISO WFS1 (Homo sapiens) 6480464 coumarin results in decreased phosphorylation of WFS1 protein CTD PMID:35688186 Wfs1 Mouse Cuprizon decreases expression ISO Wfs1 (Rattus norvegicus) 6480464 Cuprizone results in decreased expression of WFS1 mRNA CTD PMID:26577399 Wfs1 Mouse cyclosporin A increases expression ISO WFS1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of WFS1 mRNA CTD PMID:20106945 and PMID:27989131 Wfs1 Mouse DDE decreases expression ISO WFS1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of WFS1 mRNA CTD PMID:38568856 Wfs1 Mouse decabromodiphenyl ether increases expression ISO Wfs1 (Rattus norvegicus) 6480464 decabromobiphenyl ether results in increased expression of WFS1 mRNA CTD PMID:23640034 Wfs1 Mouse dexamethasone increases expression ISO WFS1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of WFS1 mRNA CTD PMID:12782123 Wfs1 Mouse dexamethasone decreases expression EXP 6480464 Dexamethasone results in decreased expression of WFS1 mRNA CTD PMID:22733784 Wfs1 Mouse Dibutyl phosphate affects expression ISO WFS1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of WFS1 mRNA CTD PMID:37042841 Wfs1 Mouse dibutyl phthalate decreases expression ISO Wfs1 (Rattus norvegicus) 6480464 Dibutyl Phthalate results in decreased expression of WFS1 mRNA CTD PMID:21266533 Wfs1 Mouse dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of WFS1 mRNA CTD PMID:39150890 Wfs1 Mouse dicrotophos increases expression ISO WFS1 (Homo sapiens) 6480464 dicrotophos results in increased expression of WFS1 mRNA CTD PMID:28302478 Wfs1 Mouse diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of WFS1 mRNA CTD PMID:39150890 Wfs1 Mouse diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of WFS1 mRNA CTD PMID:39150890 Wfs1 Mouse diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of WFS1 mRNA CTD PMID:39150890 Wfs1 Mouse endosulfan increases expression ISO Wfs1 (Rattus norvegicus) 6480464 Endosulfan results in increased expression of WFS1 mRNA CTD PMID:29391264 Wfs1 Mouse endosulfan decreases expression ISO Wfs1 (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of WFS1 mRNA CTD PMID:31464424 Wfs1 Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of WFS1 mRNA CTD PMID:30319688 Wfs1 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of WFS1 mRNA CTD PMID:30319688 Wfs1 Mouse fluoxetine decreases expression ISO Wfs1 (Rattus norvegicus) 6480464 Fluoxetine results in decreased expression of WFS1 mRNA CTD PMID:17033635 Wfs1 Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of WFS1 mRNA CTD PMID:22206623 Wfs1 Mouse FR900359 decreases phosphorylation ISO WFS1 (Homo sapiens) 6480464 FR900359 results in decreased phosphorylation of WFS1 protein CTD PMID:37730182 Wfs1 Mouse fulvestrant multiple interactions ISO WFS1 (Homo sapiens) 6480464 [bisphenol S co-treated with Fulvestrant] results in decreased methylation of WFS1 gene CTD PMID:31601247 Wfs1 Mouse ivermectin decreases expression ISO WFS1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of WFS1 protein CTD PMID:32959892 Wfs1 Mouse kainic acid increases expression EXP 6480464 Kainic Acid results in increased expression of WFS1 mRNA CTD PMID:17997037 Wfs1 Mouse ketamine increases expression ISO Wfs1 (Rattus norvegicus) 6480464 Ketamine results in increased expression of WFS1 mRNA CTD PMID:20080153 Wfs1 Mouse lead(0) affects expression ISO WFS1 (Homo sapiens) 6480464 Lead affects the expression of WFS1 mRNA CTD PMID:28903495 Wfs1 Mouse maneb multiple interactions EXP 6480464 [Maneb co-treated with Paraquat] results in decreased expression of WFS1 mRNA CTD PMID:36117858 Wfs1 Mouse methidathion increases expression EXP 6480464 methidathion results in increased expression of WFS1 mRNA CTD PMID:34813904 Wfs1 Mouse N,N-diethyl-m-toluamide multiple interactions ISO Wfs1 (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of WFS1 gene CTD PMID:33148267 Wfs1 Mouse nitrofen decreases expression ISO Wfs1 (Rattus norvegicus) 6480464 nitrofen results in decreased expression of WFS1 mRNA CTD PMID:26720608 Wfs1 Mouse ozone increases expression ISO Wfs1 (Rattus norvegicus) 6480464 Ozone results in increased expression of WFS1 protein CTD PMID:33146391 Wfs1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of WFS1 mRNA CTD PMID:17562736 Wfs1 Mouse paracetamol increases expression ISO Wfs1 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of WFS1 mRNA CTD PMID:33387578 Wfs1 Mouse paracetamol increases expression ISO WFS1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of WFS1 mRNA CTD PMID:29067470 Wfs1 Mouse paraquat multiple interactions EXP 6480464 [Maneb co-treated with Paraquat] results in decreased expression of WFS1 mRNA CTD PMID:36117858 Wfs1 Mouse perfluorooctanoic acid decreases expression ISO WFS1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of WFS1 protein CTD PMID:26879310 Wfs1 Mouse permethrin multiple interactions ISO Wfs1 (Rattus norvegicus) 6480464 [Permethrin co-treated with DEET] results in decreased methylation of WFS1 gene CTD PMID:33148267 Wfs1 Mouse pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of WFS1 mRNA CTD PMID:20059764 Wfs1 Mouse pirinixic acid multiple interactions ISO WFS1 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of WFS1 mRNA CTD PMID:19710929 Wfs1 Mouse pirinixic acid multiple interactions EXP 6480464 PPARA protein promotes the reaction [pirinixic acid results in decreased expression of WFS1 mRNA] CTD PMID:20059764 Wfs1 Mouse potassium dichromate decreases expression ISO WFS1 (Homo sapiens) 6480464 Potassium Dichromate results in decreased expression of WFS1 protein CTD PMID:23718831 Wfs1 Mouse propanal increases expression ISO WFS1 (Homo sapiens) 6480464 propionaldehyde results in increased expression of WFS1 mRNA CTD PMID:26079696 Wfs1 Mouse resveratrol increases expression EXP 6480464 resveratrol results in increased expression of WFS1 protein CTD PMID:25505154 Wfs1 Mouse silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of WFS1 mRNA CTD PMID:23221170 Wfs1 Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of WFS1 mRNA CTD PMID:27339419 and PMID:31919559 Wfs1 Mouse thapsigargin increases expression ISO WFS1 (Homo sapiens) 6480464 Thapsigargin results in increased expression of WFS1 mRNA CTD PMID:22378314 Wfs1 Mouse thiram increases expression ISO WFS1 (Homo sapiens) 6480464 Thiram results in increased expression of WFS1 mRNA CTD PMID:38568856 Wfs1 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of WFS1 gene CTD PMID:35295148 Wfs1 Mouse tolcapone affects binding ISO Wfs1 (Rattus norvegicus) 6480464 tolcapone binds to WFS1 protein CTD PMID:19783845 Wfs1 Mouse tunicamycin increases expression EXP 6480464 Tunicamycin results in increased expression of WFS1 mRNA CTD PMID:17127020 Wfs1 Mouse tunicamycin increases expression ISO WFS1 (Homo sapiens) 6480464 Tunicamycin results in increased expression of WFS1 mRNA CTD PMID:22378314 Wfs1 Mouse valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of WFS1 mRNA and Valproic Acid results in increased expression of WFS1 protein CTD PMID:19125190 and PMID:21427059 Wfs1 Mouse valproic acid affects expression ISO WFS1 (Homo sapiens) 6480464 Valproic Acid affects the expression of WFS1 mRNA CTD PMID:25979313 Wfs1 Mouse valproic acid increases expression ISO WFS1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of WFS1 mRNA CTD PMID:23179753 and PMID:29154799 Wfs1 Mouse valproic acid multiple interactions EXP 6480464 Valproic Acid inhibits the reaction [WFS1 protein binds to HSP90B1 protein] CTD PMID:19125190 Wfs1 Mouse vinclozolin increases expression ISO Wfs1 (Rattus norvegicus) 6480464 vinclozolin results in increased expression of WFS1 mRNA CTD PMID:22570695 Wfs1 Mouse vinclozolin decreases expression ISO Wfs1 (Rattus norvegicus) 6480464 vinclozolin results in decreased expression of WFS1 mRNA CTD PMID:23034163
Imported Annotations - KEGG (archival)
1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (ISO) aconitine (ISO) afimoxifene (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) ammonium chloride (ISO) aristolochic acid A (ISO) benzo[a]pyrene (EXP,ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) bisphenol F (ISO) Butylbenzyl phthalate (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (EXP) CGP 52608 (ISO) chromium(6+) (EXP) cisplatin (ISO) clobetasol (EXP) copper(II) sulfate (ISO) coumarin (ISO) Cuprizon (ISO) cyclosporin A (ISO) DDE (ISO) decabromodiphenyl ether (ISO) dexamethasone (EXP,ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dicrotophos (ISO) diethyl phthalate (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) endosulfan (ISO) ethanol (EXP) fluoxetine (ISO) folic acid (EXP) FR900359 (ISO) fulvestrant (ISO) ivermectin (ISO) kainic acid (EXP) ketamine (ISO) lead(0) (ISO) maneb (EXP) methidathion (EXP) N,N-diethyl-m-toluamide (ISO) nitrofen (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP) perfluorooctanoic acid (ISO) permethrin (ISO) pirinixic acid (EXP,ISO) potassium dichromate (ISO) propanal (ISO) resveratrol (EXP) silicon dioxide (EXP) tetrachloromethane (EXP) thapsigargin (ISO) thiram (ISO) titanium dioxide (EXP) tolcapone (ISO) tunicamycin (EXP,ISO) valproic acid (EXP,ISO) vinclozolin (ISO)
Biological Process
calcium ion homeostasis (IBA,ISO,ISS) endoplasmic reticulum calcium ion homeostasis (ISO,ISS) endoplasmic reticulum unfolded protein response (IBA,IMP,TAS) ER overload response (IEA) ERAD pathway (IMP,ISO) glucose homeostasis (ISO,ISS) intrinsic apoptotic signaling pathway (IDA,IMP) kidney development (ISO,ISS) negative regulation of apoptotic process (ISO,ISS) negative regulation of ATF6-mediated unfolded protein response (IEA,ISO) negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway (IMP) negative regulation of intrinsic apoptotic signaling pathway (IDA) negative regulation of neuron apoptotic process (ISO,ISS) negative regulation of programmed cell death (ISO,ISS) negative regulation of response to endoplasmic reticulum stress (ISO,ISS) negative regulation of transcription by RNA polymerase II (IEA,ISO) negative regulation of translation (IMP,TAS) negative regulation of type B pancreatic cell apoptotic process (IMP,ISO) nervous system process (ISO,ISS) olfactory behavior (IEA,ISO) pancreas development (IEA,ISO) positive regulation of calcium ion transport (ISO,ISS) positive regulation of ERAD pathway (IMP,TAS) positive regulation of growth (IMP) positive regulation of protein metabolic process (ISO,ISS) positive regulation of protein ubiquitination (IMP,ISO) protein stabilization (IMP,ISO,ISS) regulation of cell cycle (NAS) renal water homeostasis (ISO,ISS) response to endoplasmic reticulum stress (IDA,ISO) sensory perception of sound (ISO,ISS) visual perception (ISO,ISS,NAS)
1.
Missense variations of the gene responsible for Wolfram syndrome (WFS1/wolframin) in Japanese: possible contribution of the Arg456His mutation to type 1 diabetes as a nonautoimmune genetic basis.
Awata T, etal., Biochem Biophys Res Commun. 2000 Feb 16;268(2):612-6.
2.
Mutations in the Wolfram syndrome 1 gene (WFS1) are a common cause of low frequency sensorineural hearing loss.
Bespalova IN, etal., Hum Mol Genet. 2001 Oct 15;10(22):2501-8.
3.
A WFS1 haplotype consisting of the minor alleles of rs752854, rs10010131, and rs734312 shows a protective role against type 2 diabetes in Russian patients.
Chistiakov DA, etal., Rev Diabet Stud. 2010 Winter;7(4):285-92. doi: 10.1900/RDS.2010.7.285. Epub 2011 Feb 10.
4.
The wolframin His611Arg polymorphism influences medication overuse headache.
Di Lorenzo C, etal., Neurosci Lett. 2007 Sep 13;424(3):179-84. Epub 2007 Aug 6.
5.
WFS1 mutations in Spanish patients with diabetes mellitus and deafness.
Domenech E, etal., Eur J Hum Genet. 2002 Jul;10(7):421-6.
6.
Testing of diabetes-associated WFS1 polymorphisms in the Diabetes Prevention Program.
Florez JC, etal., Diabetologia. 2008 Mar;51(3):451-7. Epub 2007 Dec 4.
7.
Replication of the association between variants in WFS1 and risk of type 2 diabetes in European populations.
Franks PW, etal., Diabetologia. 2008 Mar;51(3):458-63. Epub 2007 Nov 27.
8.
A gene encoding a transmembrane protein is mutated in patients with diabetes mellitus and optic atrophy (Wolfram syndrome).
Inoue H, etal., Nat Genet. 1998 Oct;20(2):143-8.
9.
Disruption of the WFS1 gene in mice causes progressive beta-cell loss and impaired stimulus-secretion coupling in insulin secretion.
Ishihara H, etal., Hum Mol Genet. 2004 Jun 1;13(11):1159-70. Epub 2004 Mar 31.
10.
WFS1 gene as a putative biomarker for development of post-traumatic syndrome in an animal model.
Kesner Y, etal., Mol Psychiatry. 2009 Jan;14(1):86-94. Epub 2007 Oct 30.
11.
WFS1 variants in Finnish patients with diabetes mellitus, sensorineural hearing impairment or optic atrophy, and in suicide victims.
Kytovuori L, etal., J Hum Genet. 2013 Aug;58(8):495-500. doi: 10.1038/jhg.2013.29. Epub 2013 Apr 18.
12.
Evidence for linkage on chromosome 4p16.1 in Type 1 diabetes Danish families and complete mutation scanning of the WFS1 (Wolframin) gene.
Larsen ZM, etal., Diabet Med. 2004 Mar;21(3):218-22.
13.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
14.
MGDs mouse GO annotations
MGD data from the GO Consortium
15.
MGD IEA
MGD IEA
16.
Association studies of genetic variation in the WFS1 gene and type 2 diabetes in U.K. populations.
Minton JA, etal., Diabetes. 2002 Apr;51(4):1287-90.
17.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
18.
CDKAL1 rs7756992 is associated with diabetic retinopathy in a Chinese population with type 2 diabetes.
Peng D, etal., Sci Rep. 2017 Aug 18;7(1):8812. doi: 10.1038/s41598-017-09010-w.
19.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
20.
Wfs1- deficient rats develop primary symptoms of Wolfram syndrome: insulin-dependent diabetes, optic nerve atrophy and medullary degeneration.
Plaas M, etal., Sci Rep. 2017 Aug 31;7(1):10220. doi: 10.1038/s41598-017-09392-x.
21.
Identification of p.A684V missense mutation in the WFS1 gene as a frequent cause of autosomal dominant optic atrophy and hearing impairment.
Rendtorff ND, etal., Am J Med Genet A. 2011 Jun;155A(6):1298-313. doi: 10.1002/ajmg.a.33970. Epub 2011 Apr 28.
22.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
23.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
24.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
25.
Preventive treatment with liraglutide protects against development of glucose intolerance in a rat model of Wolfram syndrome.
Toots M, etal., Sci Rep. 2018 Jul 5;8(1):10183. doi: 10.1038/s41598-018-28314-z.
26.
The microtubule interacting drug candidate NAP protects against kainic acid toxicity in a rat model of epilepsy.
Zemlyak I, etal., J Neurochem. 2009 Dec;111(5):1252-63. doi: 10.1111/j.1471-4159.2009.06415.x. Epub 2009 Oct 3.
Wfs1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 37,123,448 - 37,146,326 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 37,123,448 - 37,146,549 (-) Ensembl GRCm39 Ensembl GRCm38 5 36,966,104 - 36,988,982 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 36,966,104 - 36,989,205 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 37,357,343 - 37,380,221 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 37,254,356 - 37,277,158 (-) NCBI MGSCv36 mm8 Celera 5 34,417,849 - 34,440,871 (-) NCBI Celera Cytogenetic Map 5 B3 NCBI cM Map 5 19.46 NCBI
WFS1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 6,269,850 - 6,303,265 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 6,269,849 - 6,303,265 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 6,271,577 - 6,304,992 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 6,322,478 - 6,355,893 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 6,389,648 - 6,423,064 NCBI Celera 4 6,172,234 - 6,205,670 (+) NCBI Celera Cytogenetic Map 4 p16.1 NCBI HuRef 4 6,205,316 - 6,238,436 (+) NCBI HuRef CHM1_1 4 6,269,525 - 6,302,942 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 6,243,866 - 6,277,297 (+) NCBI T2T-CHM13v2.0
Wfs1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 78,035,205 - 78,059,718 (+) NCBI GRCr8 mRatBN7.2 14 73,810,478 - 73,834,993 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 73,810,404 - 73,835,602 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 78,251,934 - 78,276,445 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 79,492,790 - 79,517,297 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 75,937,753 - 75,962,260 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 78,640,707 - 78,665,224 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 78,640,620 - 78,665,966 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 78,606,172 - 78,630,689 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 14 79,379,680 - 79,404,003 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 14 79,389,637 - 79,406,394 (+) NCBI Celera 14 72,756,725 - 72,781,236 (+) NCBI Celera Cytogenetic Map 14 q21 NCBI
Wfs1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955514 3,902,454 - 3,924,610 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955514 3,902,508 - 3,924,281 (-) NCBI ChiLan1.0 ChiLan1.0
WFS1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 6,541,382 - 6,574,914 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 6,470,175 - 6,503,684 (+) NCBI NHGRI_mPanPan1 PanPan1.1 4 6,345,960 - 6,379,094 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 6,345,864 - 6,379,287 (+) Ensembl panpan1.1 panPan2
WFS1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 38,451,722 - 38,466,481 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 38,451,710 - 38,475,827 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 38,428,703 - 38,449,916 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 38,942,257 - 38,963,449 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 38,942,257 - 38,968,827 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 38,633,035 - 38,659,609 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 38,742,939 - 38,764,184 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 39,217,791 - 39,239,032 (-) NCBI UU_Cfam_GSD_1.0
Wfs1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 64,638,197 - 64,663,281 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936477 18,339,827 - 18,364,998 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936477 18,339,915 - 18,364,973 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
WFS1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 4,362,680 - 4,385,273 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 4,362,678 - 4,405,185 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 2,954,118 - 2,962,286 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
WFS1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 27 42,404,028 - 42,437,988 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 27 42,404,084 - 42,438,005 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666047 89,197,417 - 89,231,280 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Wfs1
.
Predicted Target Of
Count of predictions: 772 Count of miRNA genes: 352 Interacting mature miRNAs: 378 Transcripts: ENSMUST00000043964, ENSMUST00000166339, ENSMUST00000167937 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
36049766 Ars22_m antibody response to SARS-CoV 22, day 29, IgG3 (mouse) 5 36957344 45457342 Mouse 4140990 Lgq6_m late growth QTL 6 (mouse) Not determined 32133234 100777931 Mouse 36049767 Ars23_m antibody response to SARS-CoV 23, day 29, Total IgG (mouse) 5 36957344 45457342 Mouse 10043995 Hbnr9_m Heligmosomoides bakeri nematode resistance 9 (mouse) Not determined 5 33488667 67488876 Mouse 1301776 Skts3_m skin tumor susceptibility 3 (mouse) Not determined 5 21667295 55667403 Mouse 1301845 Lxw4_m lupus BXSB x NZW 4 (mouse) Not determined 5 35694462 69694594 Mouse 1301403 Alcp9_m alcohol preference locus 9 (mouse) Not determined 5 31024275 65024480 Mouse 36049774 Ars16_m antibody response to SARS-CoV 16, day 7, Total IgG (mouse) 5 36957344 45457342 Mouse 36049775 Ars17_m antibody response to SARS-CoV 17, day 15, IgG2a+IgG2c (mouse) 5 36957344 45457342 Mouse 36049772 Ars20_m antibody response to SARS-CoV 20, day 15, Total IgG (mouse) 5 36957344 45457342 Mouse 36049773 Ars21_m antibody response to SARS-CoV 21, day 29, IgG2a+IgG2c (mouse) 5 36957344 45457342 Mouse 36049770 Ars14_m antibody response to SARS-CoV 14, day 7, IgG3 (mouse) 5 36957344 45457342 Mouse 36049771 Ars15_m antibody response to SARS-CoV 15, day 7, IgM (mouse) 5 36957344 45457342 Mouse 1300701 Cd8ts1_m CD8 T cell subset 1 (mouse) Not determined 5 27215348 61215451 Mouse 11353827 Hplq1_m hot plate latency 1 (mouse) 5 31570458 65570458 Mouse 36049768 Ars24_m antibody response to SARS-CoV 24, 4 days post-rechallenge, IgG3 (mouse) 5 36957344 45457342 Mouse 36049769 Ars13_m antibody response to SARS-CoV 13, day 7, IgG2a+IgG2c (mouse) 5 36957344 45457342 Mouse 36049776 Ars18_m antibody response to SARS-CoV 18, day 15, IgG3 (mouse) 5 36957344 45457342 Mouse 36049777 Ars19_m antibody response to SARS-CoV 19, day 15, IgM (mouse) 5 36957344 45457342 Mouse 4141219 W10q16_m weight 10 weeks QTL 16 (mouse) Not determined 32133234 100777931 Mouse 1301555 Alcp10_m alcohol preference locus 10 (mouse) Not determined 5 31024275 65024480 Mouse 1301170 Lith13_m lithogenic gene 13 (mouse) Not determined 5 36494486 70494598 Mouse 1301685 Estq2_m estradiol regulated response QTL 2 (mouse) Not determined 5 15634084 49634190 Mouse 11537367 Hmtb11_m hemostasis and thrombosis 11 (mouse) 5 22100823 64806579 Mouse 4141207 Imrfq1_m immune response to Factor IX QTL 1 (mouse) Not determined 5 8124117 42124239 Mouse 11537368 Hmtb10_m hemostasis and thrombosis 10 (mouse) 5 22100823 54500318 Mouse 15039371 Nmrs21_m NAFLD-associated magnetic resonance shift 21 (mouse) 5 3504823 37504823 Mouse 1301693 Sle6_m systemic lupus erythematosus susceptibility 6 (mouse) Not determined 5 8890693 87841837 Mouse 4141647 Hrvhf1_m heart rate variability, high frequency 1 (mouse) Not determined 36433423 70433423 Mouse 11049561 Lmr24e_m leishmaniasis resistance 24e (mouse) 5 35694462 69694594 Mouse 13464252 Ahl10_m age related hearing loss, early onset 10 (mouse) 5 35854568 69854714 Mouse 1357478 Kdnw1_m kidney weight 1 (mouse) Not determined 5 8915949 40529869 Mouse 1301223 Hdlq7_m HDL QTL 7 (mouse) Not determined 5 35854568 69854714 Mouse 11341716 Rvfs3_m Rift Valley fever susceptibility 3 (mouse) 5 26441234 138455402 Mouse 14696730 Kidlq1_m kidney weight, left QTL 1 (mouse) 5 13563152 47563152 Mouse 1300719 Iba5_m induction of brown adipocytes 5 (mouse) Not determined 5 20686993 54687134 Mouse 1301806 Actd2_m activity-distance traveled 2 (mouse) Not determined 5 5384520 39384652 Mouse 11049558 Lmr24b_m leishmaniasis resistance 24b (mouse) 5 35694462 69694594 Mouse 35673310 Ari4_m antibody response to influenza 4, day 15-45, IgG2b (mouse) 5 36957344 45457342 Mouse 11049559 Lmr24c_m leishmaniasis resistance 24c (mouse) 5 35694462 69694594 Mouse
39.MMHAP34FLE6.seq
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 36,984,318 - 36,984,511 UniSTS GRCm38 MGSCv37 5 37,375,557 - 37,375,750 UniSTS GRCm37 Celera 5 34,436,207 - 34,436,400 UniSTS Cytogenetic Map 5 B3 UniSTS Whitehead_YAC 5 UniSTS
D18999
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 36,966,106 - 36,966,181 UniSTS GRCm38 MGSCv37 5 37,357,345 - 37,357,420 UniSTS GRCm37 Celera 5 34,417,851 - 34,417,926 UniSTS Cytogenetic Map 5 B3 UniSTS Whitehead_YAC 5 UniSTS
AI481085
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 36,966,293 - 36,966,412 UniSTS GRCm38 MGSCv37 5 37,357,532 - 37,357,651 UniSTS GRCm37 Celera 5 34,418,038 - 34,418,157 UniSTS Cytogenetic Map 5 B3 UniSTS Whitehead/MRC_RH 5 488.07 UniSTS
Wfs1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 36,966,691 - 36,966,851 UniSTS GRCm38 MGSCv37 5 37,357,930 - 37,358,090 UniSTS GRCm37 Celera 5 34,418,436 - 34,418,596 UniSTS Cytogenetic Map 5 B3 UniSTS cM Map 5 UniSTS
SHGC-59709
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 36,967,374 - 36,967,604 UniSTS GRCm38 MGSCv37 5 37,358,613 - 37,358,843 UniSTS GRCm37 Celera 5 34,419,119 - 34,419,349 UniSTS Cytogenetic Map 5 B3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000043964 ⟹ ENSMUSP00000048053
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 37,123,448 - 37,146,549 (-) Ensembl GRCm38.p6 Ensembl 5 36,966,104 - 36,989,205 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000166339 ⟹ ENSMUSP00000132404
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 37,123,451 - 37,146,277 (-) Ensembl GRCm38.p6 Ensembl 5 36,966,107 - 36,988,933 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000167937 ⟹ ENSMUSP00000125779
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 37,125,845 - 37,134,300 (-) Ensembl GRCm38.p6 Ensembl 5 36,968,501 - 36,976,956 (-) Ensembl
RefSeq Acc Id:
NM_011716 ⟹ NP_035846
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 37,123,448 - 37,146,326 (-) NCBI GRCm38 5 36,966,104 - 36,988,982 (-) ENTREZGENE MGSCv37 5 37,357,343 - 37,380,221 (-) RGD Celera 5 34,417,849 - 34,440,871 (-) RGD cM Map 5 ENTREZGENE
Sequence:
TTTCCCGGGGCCGCGCTGAATGTAGGGCCGCGCGCTCCGCCTGCTCAGCTGGCCGCTGCAATCTCCGCGGTTTCGGAGCAACTTCGCGGCGGGCTGGGAGGCCCAGCACTGCGGCCGGCAAGATGAAC
hide sequence
RefSeq Acc Id:
NP_035846 ⟸ NM_011716
- UniProtKB:
Q9Z276 (UniProtKB/Swiss-Prot), P56695 (UniProtKB/Swiss-Prot), Q3TDI2 (UniProtKB/TrEMBL), Q80UI9 (UniProtKB/TrEMBL)
- Sequence:
MNSGTPPPSPSGPPPPPAPQPQARARLNATASLEQDKIEPPRAPRPQADPSAGRSAGEAAAPEPRAPQTGSREETDRAGPMKADVEIPFEEVLEKAKAGDPKAQTEVGKHYLRLANDADEELNSCSAV
hide sequence
Ensembl Acc Id:
ENSMUSP00000132404 ⟸ ENSMUST00000166339
Ensembl Acc Id:
ENSMUSP00000125779 ⟸ ENSMUST00000167937
Ensembl Acc Id:
ENSMUSP00000048053 ⟸ ENSMUST00000043964
RGD ID: 6886556 Promoter ID: EPDNEW_M6729 Type: initiation region Name: Wfs1_1 Description: Mus musculus wolframin ER transmembrane glycoprotein , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 5 36,988,932 - 36,988,992 EPDNEW
RGD ID: 6838637 Promoter ID: MM_KWN:42069 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: NM_011716 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 37,380,056 - 37,380,556 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-03-21
Wfs1
wolframin ER transmembrane glycoprotein
Wolfram syndrome 1 homolog (human)
Symbol and/or name change
5135510 APPROVED
