Symbol:
Mafk
Name:
v-maf musculoaponeurotic fibrosarcoma oncogene family, protein K (avian)
RGD ID:
730843
MGI Page
MGI
Description:
Enables DNA-binding transcription factor activity and transcription cis-regulatory region binding activity. Acts upstream of or within regulation of DNA-templated transcription. Located in nucleus. Is expressed in several structures, including central nervous system; early conceptus; eye; genitourinary system; and immune system. Orthologous to human MAFK (MAF bZIP transcription factor K).
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
AW061068; erythroid transcription factor NF-E2 p18 subunit; NF-E; NF-E2; Nfe2; Nfe2u; nuclear factor, erythroid derived 2, ubiquitous; p18 NF-E2; transcription factor MafK
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MAFK (MAF bZIP transcription factor K) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Mafk (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Mafk (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MAFK (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MAFK (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mafk (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MAFK (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MAFK (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Mafk (MAF bZIP transcription factor K) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MAFG (MAF bZIP transcription factor G) HGNC
OrthoDB
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Mafk (MAF bZIP transcription factor K)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MAFK (MAF bZIP transcription factor K)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mafk (v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog K)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
maf-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
maf-S
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
mafk
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 139,777,291 - 139,788,409 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 139,777,268 - 139,788,408 (+) Ensembl GRCm39 Ensembl GRCm38 5 139,791,536 - 139,802,653 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 139,791,513 - 139,802,653 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 140,267,490 - 140,278,606 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 140,044,010 - 140,055,126 (+) NCBI MGSCv36 mm8 Celera 5 136,846,479 - 136,857,581 (+) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 78.81 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mafk Mouse (E)-cinnamyl alcohol increases expression ISO MAFK (Homo sapiens) 6480464 cinnamyl alcohol results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MAFK mRNA CTD PMID:22206623 Mafk Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of MAFK mRNA CTD PMID:22206623 Mafk Mouse 1-chloro-2,4-dinitrobenzene increases expression ISO MAFK (Homo sapiens) 6480464 Dinitrochlorobenzene results in increased expression of MAFK mRNA CTD PMID:17374397 and PMID:20566472 Mafk Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of MAFK mRNA CTD PMID:17942748 Mafk Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MAFK mRNA CTD PMID:19770486 more ... Mafk Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Mafk (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAFK mRNA CTD PMID:32109520 Mafk Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to MAFK gene] CTD PMID:28213091 Mafk Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MAFK mRNA CTD PMID:21570461 Mafk Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Mafk (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of MAFK mRNA CTD PMID:21215274 and PMID:33387578 Mafk Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mafk (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of MAFK mRNA CTD PMID:22298810 Mafk Mouse 2,4-dinitrotoluene affects expression ISO Mafk (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of MAFK mRNA CTD PMID:21346803 Mafk Mouse 2,6-dinitrotoluene affects expression ISO Mafk (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of MAFK mRNA CTD PMID:21346803 Mafk Mouse 2-palmitoylglycerol increases expression ISO MAFK (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of MAFK mRNA CTD PMID:37199045 Mafk Mouse 4-(ethoxymethylene)-2-phenyloxazol-5-one increases expression ISO MAFK (Homo sapiens) 6480464 Oxazolone results in increased expression of MAFK mRNA CTD PMID:17374397 Mafk Mouse 6-propyl-2-thiouracil increases expression ISO Mafk (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of MAFK mRNA CTD PMID:24780913 Mafk Mouse acrolein multiple interactions ISO MAFK (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of MAFK mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of MAFK mRNA CTD PMID:32699268 Mafk Mouse acrylamide increases expression ISO Mafk (Rattus norvegicus) 6480464 Acrylamide results in increased expression of MAFK mRNA CTD PMID:28959563 Mafk Mouse acrylamide increases expression ISO MAFK (Homo sapiens) 6480464 Acrylamide results in increased expression of MAFK mRNA CTD PMID:32763439 Mafk Mouse alpha-hexylcinnamaldehyde increases expression ISO MAFK (Homo sapiens) 6480464 hexyl cinnamic aldehyde results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Mouse alpha-pinene multiple interactions ISO MAFK (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of MAFK mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of MAFK mRNA CTD PMID:32699268 Mafk Mouse ammonium chloride affects expression ISO Mafk (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of MAFK mRNA CTD PMID:16483693 Mafk Mouse amphetamine increases expression ISO Mafk (Rattus norvegicus) 6480464 Amphetamine results in increased expression of MAFK mRNA CTD PMID:30779732 Mafk Mouse aristolochic acid A increases expression ISO MAFK (Homo sapiens) 6480464 aristolochic acid I results in increased expression of MAFK mRNA CTD PMID:33212167 Mafk Mouse arsenous acid affects methylation ISO MAFK (Homo sapiens) 6480464 Arsenic Trioxide affects the methylation of MAFK promoter CTD PMID:26046465 Mafk Mouse Bandrowski's base increases expression ISO MAFK (Homo sapiens) 6480464 Bandrowski's base results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Mouse benzene decreases expression ISO MAFK (Homo sapiens) 6480464 Benzene results in decreased expression of MAFK mRNA CTD PMID:33064461 Mafk Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of MAFK mRNA CTD PMID:19770486 more ... Mafk Mouse benzo[a]pyrene increases methylation ISO MAFK (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MAFK promoter CTD PMID:27901495 Mafk Mouse benzo[a]pyrene affects methylation ISO MAFK (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MAFK 5' UTR CTD PMID:27901495 Mafk Mouse beta-lapachone increases expression ISO MAFK (Homo sapiens) 6480464 beta-lapachone results in increased expression of MAFK mRNA CTD PMID:38218311 Mafk Mouse beta-naphthoflavone multiple interactions ISO Mafk (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of MAFK mRNA CTD PMID:18164116 Mafk Mouse bis(2-chloroethyl) sulfide multiple interactions EXP 6480464 Dimercaprol inhibits the reaction [Mustard Gas results in increased expression of MAFK mRNA] CTD PMID:16377760 Mafk Mouse bis(2-chloroethyl) sulfide increases expression EXP 6480464 Mustard Gas results in increased expression of MAFK mRNA CTD PMID:15674843 and PMID:16377760 Mafk Mouse bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MAFK mRNA CTD PMID:39150890 Mafk Mouse bisphenol A increases expression ISO Mafk (Rattus norvegicus) 6480464 bisphenol A results in increased expression of MAFK mRNA CTD PMID:25181051 Mafk Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MAFK mRNA CTD PMID:34585602 Mafk Mouse bisphenol A decreases expression ISO Mafk (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of MAFK mRNA CTD PMID:30816183 and PMID:32528016 Mafk Mouse bisphenol A decreases expression ISO MAFK (Homo sapiens) 6480464 bisphenol A results in decreased expression of MAFK mRNA CTD PMID:29275510 Mafk Mouse bisphenol A affects expression ISO MAFK (Homo sapiens) 6480464 bisphenol A affects the expression of MAFK mRNA CTD PMID:30903817 Mafk Mouse bisphenol A decreases methylation EXP 6480464 bisphenol A results in decreased methylation of MAFK promoter CTD PMID:27312807 Mafk Mouse Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MAFK mRNA CTD PMID:39150890 Mafk Mouse cadmium atom multiple interactions EXP 6480464 Cadmium inhibits the reaction [MAFK protein affects the localization of BACH2 protein] CTD PMID:14504288 Mafk Mouse cadmium atom multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MAFK mRNA CTD PMID:35301059 Mafk Mouse cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of MAFK mRNA CTD PMID:20061341 Mafk Mouse cadmium dichloride multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of MAFK mRNA CTD PMID:35301059 Mafk Mouse cadmium dichloride increases expression ISO Mafk (Rattus norvegicus) 6480464 Cadmium Chloride results in increased expression of MAFK mRNA CTD PMID:19010381 Mafk Mouse caffeine increases phosphorylation ISO MAFK (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of MAFK protein CTD PMID:35688186 Mafk Mouse chenodeoxycholic acid multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Mouse cinnamyl alcohol increases expression ISO MAFK (Homo sapiens) 6480464 cinnamyl alcohol results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Mouse cisplatin multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of MAFK mRNA CTD PMID:27392435 Mafk Mouse cisplatin decreases expression ISO MAFK (Homo sapiens) 6480464 Cisplatin results in decreased expression of MAFK mRNA CTD PMID:27392435 and PMID:27594783 Mafk Mouse clobetasol increases expression EXP 6480464 Clobetasol results in increased expression of MAFK mRNA CTD PMID:27462272 Mafk Mouse clofibrate multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of MAFK mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of MAFK mRNA] CTD PMID:17585979 Mafk Mouse clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of MAFK mRNA CTD PMID:17585979 Mafk Mouse cobalt dichloride increases expression ISO Mafk (Rattus norvegicus) 6480464 cobaltous chloride results in increased expression of MAFK mRNA CTD PMID:24386269 Mafk Mouse cobalt dichloride increases expression ISO MAFK (Homo sapiens) 6480464 cobaltous chloride results in increased expression of MAFK mRNA CTD PMID:19320972 Mafk Mouse copper(II) sulfate increases expression ISO MAFK (Homo sapiens) 6480464 Copper Sulfate results in increased expression of MAFK mRNA CTD PMID:19549813 Mafk Mouse coumarin increases phosphorylation ISO MAFK (Homo sapiens) 6480464 coumarin results in increased phosphorylation of MAFK protein CTD PMID:35688186 Mafk Mouse CU-O LINKAGE increases expression ISO MAFK (Homo sapiens) 6480464 cupric oxide results in increased expression of MAFK mRNA CTD PMID:22077320 Mafk Mouse cyclosporin A increases expression ISO MAFK (Homo sapiens) 6480464 Cyclosporine results in increased expression of MAFK mRNA CTD PMID:20106945 more ... Mafk Mouse cyclosporin A multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Mouse cyclosporin A decreases methylation ISO MAFK (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of MAFK promoter CTD PMID:27989131 Mafk Mouse DDE decreases expression ISO MAFK (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of MAFK mRNA CTD PMID:38568856 Mafk Mouse deoxycholic acid multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Mouse diarsenic trioxide affects methylation ISO MAFK (Homo sapiens) 6480464 Arsenic Trioxide affects the methylation of MAFK promoter CTD PMID:26046465 Mafk Mouse diazinon affects expression ISO Mafk (Rattus norvegicus) 6480464 Diazinon affects the expression of MAFK mRNA CTD PMID:22546817 Mafk Mouse Dibutyl phosphate affects expression ISO MAFK (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MAFK mRNA CTD PMID:37042841 Mafk Mouse dibutyl phthalate increases expression ISO Mafk (Rattus norvegicus) 6480464 Dibutyl Phthalate results in increased expression of MAFK mRNA CTD PMID:21266533 Mafk Mouse dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MAFK mRNA CTD PMID:39150890 Mafk Mouse dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of MAFK mRNA CTD PMID:17361019 and PMID:21266533 Mafk Mouse dieldrin affects expression ISO Mafk (Rattus norvegicus) 6480464 Dieldrin affects the expression of MAFK mRNA CTD PMID:22546817 Mafk Mouse diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MAFK mRNA CTD PMID:39150890 Mafk Mouse diethylstilbestrol increases expression ISO Mafk (Rattus norvegicus) 6480464 Diethylstilbestrol results in increased expression of MAFK mRNA CTD PMID:21658437 Mafk Mouse diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MAFK mRNA CTD PMID:39150890 Mafk Mouse diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] affects the expression of MAFK mRNA CTD PMID:39150890 Mafk Mouse dimercaprol multiple interactions EXP 6480464 Dimercaprol inhibits the reaction [Mustard Gas results in increased expression of MAFK mRNA] CTD PMID:16377760 Mafk Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of MAFK mRNA CTD PMID:30529165 Mafk Mouse disulfiram increases expression ISO MAFK (Homo sapiens) 6480464 Disulfiram results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Mouse dorsomorphin multiple interactions ISO MAFK (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAFK mRNA CTD PMID:27188386 Mafk Mouse endosulfan increases expression ISO Mafk (Rattus norvegicus) 6480464 Endosulfan results in increased expression of MAFK mRNA CTD PMID:29391264 Mafk Mouse eugenol increases expression ISO MAFK (Homo sapiens) 6480464 Eugenol results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Mouse fluoranthene multiple interactions EXP 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of MAFK mRNA CTD PMID:28329830 Mafk Mouse flutamide increases expression ISO Mafk (Rattus norvegicus) 6480464 Flutamide results in increased expression of MAFK mRNA CTD PMID:24136188 and PMID:24793618 Mafk Mouse folic acid multiple interactions EXP 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of MAFK mRNA CTD PMID:22206623 Mafk Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of MAFK mRNA CTD PMID:25629700 Mafk Mouse gentamycin increases expression ISO Mafk (Rattus norvegicus) 6480464 Gentamicins results in increased expression of MAFK mRNA CTD PMID:33387578 Mafk Mouse glycochenodeoxycholic acid multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Mouse glycocholic acid multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Mouse glycodeoxycholic acid multiple interactions ISO MAFK (Homo sapiens) 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Mouse glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of MAFK mRNA CTD PMID:35897073 Mafk Mouse hydroquinone O-beta-D-glucopyranoside decreases expression ISO MAFK (Homo sapiens) 6480464 Arbutin results in decreased expression of MAFK mRNA CTD PMID:17103032 Mafk Mouse isoeugenol increases expression ISO MAFK (Homo sapiens) 6480464 isoeugenol results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Mouse kojic acid decreases expression ISO MAFK (Homo sapiens) 6480464 kojic acid results in decreased expression of MAFK mRNA CTD PMID:16595896 Mafk Mouse leflunomide increases expression ISO Mafk (Rattus norvegicus) 6480464 leflunomide results in increased expression of MAFK mRNA CTD PMID:24136188 Mafk Mouse lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of MAFK mRNA CTD PMID:10975854 Mafk Mouse methamphetamine increases expression ISO Mafk (Rattus norvegicus) 6480464 Methamphetamine results in increased expression of MAFK mRNA CTD PMID:19564919 Mafk Mouse methoxychlor increases methylation ISO Mafk (Rattus norvegicus) 6480464 Methoxychlor results in increased methylation of MAFK gene CTD PMID:23303685 Mafk Mouse methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of MAFK mRNA CTD PMID:20061341 Mafk Mouse methylmercury chloride increases expression ISO MAFK (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of MAFK mRNA CTD PMID:28001369 Mafk Mouse mono(2-ethylhexyl) phthalate increases expression ISO Mafk (Rattus norvegicus) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of MAFK mRNA CTD PMID:16809437 Mafk Mouse N-methylformamide affects expression EXP 6480464 methylformamide affects the expression of MAFK mRNA and methylformamide analog affects the expression of MAFK mRNA CTD PMID:17040096 Mafk Mouse N-nitrosodiethylamine multiple interactions ISO Mafk (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of MAFK mRNA CTD PMID:18164116 Mafk Mouse nefazodone increases expression ISO MAFK (Homo sapiens) 6480464 nefazodone results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Mouse nefazodone multiple interactions ISO MAFK (Homo sapiens) 6480464 [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFK mRNA CTD PMID:32152650 Mafk Mouse nickel dichloride affects expression ISO Mafk (Rattus norvegicus) 6480464 nickel chloride affects the expression of MAFK mRNA CTD PMID:22546817 Mafk Mouse nickel sulfate increases expression ISO MAFK (Homo sapiens) 6480464 nickel sulfate results in increased expression of MAFK mRNA CTD PMID:17374397 and PMID:20566472 Mafk Mouse nitrofen decreases expression ISO Mafk (Rattus norvegicus) 6480464 nitrofen results in decreased expression of MAFK mRNA CTD PMID:33484710 Mafk Mouse ozone multiple interactions ISO MAFK (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of MAFK mRNA more ... CTD PMID:32699268 and PMID:35430440 Mafk Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of MAFK mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of MAFK mRNA CTD PMID:34911549 Mafk Mouse paracetamol multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of MAFK mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of MAFK mRNA] CTD PMID:17585979 Mafk Mouse paracetamol increases expression ISO Mafk (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of MAFK mRNA CTD PMID:33387578 Mafk Mouse paracetamol increases expression ISO MAFK (Homo sapiens) 6480464 Acetaminophen results in increased expression of MAFK mRNA CTD PMID:29067470 Mafk Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of MAFK mRNA CTD PMID:17562736 Mafk Mouse paraquat increases expression EXP 6480464 Paraquat results in increased expression of MAFK mRNA CTD PMID:12595580 Mafk Mouse paraquat increases expression ISO Mafk (Rattus norvegicus) 6480464 Paraquat results in increased expression of MAFK mRNA CTD PMID:32680482 Mafk Mouse pentachlorophenol increases expression EXP 6480464 Pentachlorophenol results in increased expression of MAFK mRNA CTD PMID:23892564 Mafk Mouse perfluorooctanoic acid increases expression ISO Mafk (Rattus norvegicus) 6480464 perfluorooctanoic acid results in increased expression of MAFK mRNA CTD PMID:19162173 Mafk Mouse phenobarbital multiple interactions EXP 6480464 NR1I3 protein affects the reaction [Phenobarbital results in increased expression of MAFK mRNA] CTD PMID:19482888 Mafk Mouse phenobarbital affects expression ISO MAFK (Homo sapiens) 6480464 Phenobarbital affects the expression of MAFK mRNA CTD PMID:19159669 Mafk Mouse phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of MAFK mRNA CTD PMID:19482888 Mafk Mouse phenylephrine increases expression ISO Mafk (Rattus norvegicus) 6480464 Phenylephrine results in increased expression of MAFK mRNA CTD PMID:18158353 Mafk Mouse phenylmercury acetate increases expression ISO MAFK (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of MAFK mRNA CTD PMID:26272509 Mafk Mouse phenylmercury acetate multiple interactions ISO MAFK (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAFK mRNA CTD PMID:27188386 Mafk Mouse reactive oxygen species increases expression ISO MAFK (Homo sapiens) 6480464 Reactive Oxygen Species results in increased expression of MAFK mRNA CTD PMID:25800948 Mafk Mouse SB 431542 multiple interactions ISO MAFK (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAFK mRNA CTD PMID:27188386 Mafk Mouse senecionine increases expression EXP 6480464 senecionine results in increased expression of MAFK protein CTD PMID:35357534 Mafk Mouse silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of MAFK mRNA CTD PMID:19073995 and PMID:33720480 Mafk Mouse silver atom increases expression ISO MAFK (Homo sapiens) 6480464 Silver results in increased expression of MAFK mRNA CTD PMID:26014281 Mafk Mouse silver(0) increases expression ISO MAFK (Homo sapiens) 6480464 Silver results in increased expression of MAFK mRNA CTD PMID:26014281 Mafk Mouse sodium arsenite increases expression ISO MAFK (Homo sapiens) 6480464 sodium arsenite results in increased expression of MAFK mRNA CTD PMID:20886546 and PMID:38568856 Mafk Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of MAFK mRNA CTD PMID:16014739 Mafk Mouse sodium arsenite multiple interactions EXP 6480464 sodium arsenite promotes the reaction [[NFE2L2 protein binds to MAFK protein] which binds to NQO1 promoter] CTD PMID:16785233 Mafk Mouse Soman increases expression ISO Mafk (Rattus norvegicus) 6480464 Soman results in increased expression of MAFK mRNA CTD PMID:19281266 Mafk Mouse tacrolimus hydrate increases expression EXP 6480464 Tacrolimus results in increased expression of MAFK mRNA CTD PMID:23958496 Mafk Mouse tamoxifen increases expression EXP 6480464 Tamoxifen results in increased expression of MAFK mRNA CTD PMID:17555576 Mafk Mouse tert-butyl hydroperoxide increases methylation ISO MAFK (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased methylation of MAFK gene CTD PMID:27509014 Mafk Mouse tert-butyl hydroperoxide increases expression ISO MAFK (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of MAFK mRNA CTD PMID:27509014 Mafk Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of MAFK mRNA CTD PMID:31919559 Mafk Mouse thioacetamide increases expression ISO Mafk (Rattus norvegicus) 6480464 Thioacetamide results in increased expression of MAFK mRNA CTD PMID:23411599 and PMID:34492290 Mafk Mouse thiram increases expression ISO MAFK (Homo sapiens) 6480464 Thiram results in increased expression of MAFK mRNA CTD PMID:38568856 Mafk Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of MAFK mRNA CTD PMID:27760801 Mafk Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of MAFK promoter CTD PMID:35295148 Mafk Mouse trans-isoeugenol increases expression ISO MAFK (Homo sapiens) 6480464 isoeugenol results in increased expression of MAFK mRNA CTD PMID:20566472 Mafk Mouse trichloroethene increases expression ISO Mafk (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of MAFK mRNA CTD PMID:33387578 Mafk Mouse triphenyl phosphate affects expression ISO MAFK (Homo sapiens) 6480464 triphenyl phosphate affects the expression of MAFK mRNA CTD PMID:37042841 Mafk Mouse triptonide increases expression EXP 6480464 triptonide results in increased expression of MAFK mRNA CTD PMID:33045310 Mafk Mouse urethane increases expression ISO MAFK (Homo sapiens) 6480464 Urethane results in increased expression of MAFK mRNA CTD PMID:28818685 Mafk Mouse valdecoxib increases expression ISO Mafk (Rattus norvegicus) 6480464 valdecoxib results in increased expression of MAFK mRNA CTD PMID:24136188 Mafk Mouse valproic acid increases methylation ISO MAFK (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MAFK gene CTD PMID:29154799 Mafk Mouse valproic acid increases expression ISO MAFK (Homo sapiens) 6480464 Valproic Acid results in increased expression of MAFK mRNA CTD PMID:28001369 Mafk Mouse xylitol increases expression ISO MAFK (Homo sapiens) 6480464 Xylitol results in increased expression of MAFK mRNA CTD PMID:32275922 Mafk Mouse zinc atom multiple interactions ISO MAFK (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of MAFK mRNA CTD PMID:18593933 Mafk Mouse zinc(0) multiple interactions ISO MAFK (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of MAFK mRNA CTD PMID:18593933
(E)-cinnamyl alcohol (ISO) 1,2-dimethylhydrazine (EXP) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2,6-dinitrotoluene (ISO) 2-palmitoylglycerol (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 6-propyl-2-thiouracil (ISO) acrolein (ISO) acrylamide (ISO) alpha-hexylcinnamaldehyde (ISO) alpha-pinene (ISO) ammonium chloride (ISO) amphetamine (ISO) aristolochic acid A (ISO) arsenous acid (ISO) Bandrowski's base (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bis(2-chloroethyl) sulfide (EXP) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) Butylbenzyl phthalate (EXP) cadmium atom (EXP,ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) chenodeoxycholic acid (ISO) cinnamyl alcohol (ISO) cisplatin (ISO) clobetasol (EXP) clofibrate (EXP) cobalt dichloride (ISO) copper(II) sulfate (ISO) coumarin (ISO) CU-O LINKAGE (ISO) cyclosporin A (ISO) DDE (ISO) deoxycholic acid (ISO) diarsenic trioxide (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dieldrin (ISO) diethyl phthalate (EXP) diethylstilbestrol (ISO) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) dimercaprol (EXP) dioxygen (EXP) disulfiram (ISO) dorsomorphin (ISO) endosulfan (ISO) eugenol (ISO) fluoranthene (EXP) flutamide (ISO) folic acid (EXP) gentamycin (ISO) glycochenodeoxycholic acid (ISO) glycocholic acid (ISO) glycodeoxycholic acid (ISO) glyphosate (EXP) hydroquinone O-beta-D-glucopyranoside (ISO) isoeugenol (ISO) kojic acid (ISO) leflunomide (ISO) lipopolysaccharide (EXP) methamphetamine (ISO) methoxychlor (ISO) methylmercury chloride (EXP,ISO) mono(2-ethylhexyl) phthalate (ISO) N-methylformamide (EXP) N-nitrosodiethylamine (ISO) nefazodone (ISO) nickel dichloride (ISO) nickel sulfate (ISO) nitrofen (ISO) ozone (EXP,ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) pentachlorophenol (EXP) perfluorooctanoic acid (ISO) phenobarbital (EXP,ISO) phenylephrine (ISO) phenylmercury acetate (ISO) reactive oxygen species (ISO) SB 431542 (ISO) senecionine (EXP) silicon dioxide (EXP) silver atom (ISO) silver(0) (ISO) sodium arsenite (EXP,ISO) Soman (ISO) tacrolimus hydrate (EXP) tamoxifen (EXP) tert-butyl hydroperoxide (ISO) tetrachloromethane (EXP) thioacetamide (ISO) thiram (ISO) titanium dioxide (EXP) trans-isoeugenol (ISO) trichloroethene (ISO) triphenyl phosphate (ISO) triptonide (EXP) urethane (ISO) valdecoxib (ISO) valproic acid (ISO) xylitol (ISO) zinc atom (ISO) zinc(0) (ISO)
Mafk Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 139,777,291 - 139,788,409 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 139,777,268 - 139,788,408 (+) Ensembl GRCm39 Ensembl GRCm38 5 139,791,536 - 139,802,653 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 139,791,513 - 139,802,653 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 140,267,490 - 140,278,606 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 140,044,010 - 140,055,126 (+) NCBI MGSCv36 mm8 Celera 5 136,846,479 - 136,857,581 (+) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 78.81 NCBI
MAFK Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 1,530,702 - 1,543,043 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 1,530,702 - 1,543,043 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 1,570,338 - 1,582,679 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 1,536,894 - 1,549,205 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 7 1,343,608 - 1,354,151 NCBI Celera 7 1,537,624 - 1,549,935 (+) NCBI Celera Cytogenetic Map 7 p22.3 NCBI HuRef 7 1,499,263 - 1,503,161 (+) NCBI HuRef CHM1_1 7 1,569,960 - 1,582,262 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 1,642,830 - 1,655,171 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 1,622,776 - 1,635,087 (+) NCBI
Mafk Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 19,948,473 - 19,970,351 (-) NCBI GRCr8 mRatBN7.2 12 14,834,628 - 14,856,414 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 14,833,984 - 14,837,048 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 12 14,832,249 - 14,858,888 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 15,643,621 - 15,654,344 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 16,267,374 - 16,278,097 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 15,292,794 - 15,303,525 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 16,923,989 - 16,934,706 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 16,923,990 - 16,934,706 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 18,914,796 - 18,936,523 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 15,312,420 - 15,323,137 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 15,342,348 - 15,353,065 (-) NCBI Celera 12 16,593,511 - 16,604,228 (-) NCBI Celera Cytogenetic Map 12 q11 NCBI
Mafk Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955460 9,155,713 - 9,167,291 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955460 9,155,713 - 9,167,291 (+) NCBI ChiLan1.0 ChiLan1.0
MAFK Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 6,480,254 - 6,492,566 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 54,804,956 - 54,817,267 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 1,778,862 - 1,791,163 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 1,902,411 - 1,909,774 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 1,904,031 - 1,909,774 (+) Ensembl panpan1.1 panPan2
MAFK Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 15,421,918 - 15,426,650 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 15,424,095 - 15,425,594 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 16,889,609 - 16,901,307 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 15,547,885 - 15,559,587 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 15,547,886 - 15,559,718 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 15,350,661 - 15,362,365 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 15,277,453 - 15,289,141 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 15,564,445 - 15,576,148 (-) NCBI UU_Cfam_GSD_1.0
Mafk Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 143,353,784 - 143,364,317 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936754 1,651,704 - 1,656,549 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936754 1,652,412 - 1,656,570 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAFK Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 1,030,858 - 1,033,671 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 1,023,366 - 1,034,855 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 1,138,008 - 1,149,711 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MAFK Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 20,057,386 - 20,070,020 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 20,060,001 - 20,061,170 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666090 1,647,542 - 1,659,816 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mafk
.
Predicted Target Of
Count of predictions: 1842 Count of miRNA genes: 541 Interacting mature miRNAs: 682 Transcripts: ENSMUST00000018287, ENSMUST00000110836, ENSMUST00000151577 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
27226719 Tibw6_m tibia width 6, proximal, 16 week (mouse) 5 72857343 139985755 Mouse 1301363 Pbwg13_m postnatal body weight growth 13 (mouse) Not determined 5 125133457 151758149 Mouse 1301715 Elmaz2_m elevated maze behavior 2 (mouse) Not determined 5 125178229 141700466 Mouse 1301362 Prnr1_m prion resistance 1 (mouse) Not determined 5 89418876 146787935 Mouse 10412191 Bbaa24_m B.burgdorferi-associated arthritis 24 (mouse) Not determined 5 119945037 141700466 Mouse 1300913 Bwefm_m body weight females and males day 10 (mouse) Not determined 5 109439348 143439459 Mouse 13464143 Bbaa2b_m B.burgdorferi-associated arthritis 2b (mouse) 5 133052969 140709801 Mouse 4141081 Nidd7k_m Nidd7 on KK-A (mouse) Not determined 119945037 149347326 Mouse 11528552 Scram1_m spinal cord resistance to astrocytoma modifier 1 (mouse) 5 121455402 151758149 Mouse 1300827 Cora1_m correlation in cytokine production 1 (mouse) Not determined 5 115156883 149157015 Mouse 10043890 Trigq4_m triglyceride QTL 4 (mouse) Not determined 5 107906299 141906412 Mouse 1302079 Lbw3_m lupus NZB x NZW 3 (mouse) Not determined 5 124700335 151758149 Mouse 13504737 Ifvrq5_m influenza virus resistance QTL 5 (mouse) 5 139509801 151658149 Mouse 1301986 Bpq4_m blood pressure QTL 4 (mouse) Not determined 5 121555236 151758149 Mouse 13504735 Ifvrq7_m influenza virus resistance QTL 7 (mouse) 5 139509801 151658149 Mouse 1301857 Bglq14_m body growth late QTL 14 (mouse) Not determined 5 118948964 151758149 Mouse 12880406 Jcdq2_m joint cartilage degeneration QTL 2 (mouse) 5 129787831 151758149 Mouse 4142473 Chlq11_m circulating hormone level QTL 11 (mouse) Not determined 5 107906299 141906412 Mouse 13464251 Ahl21_m age related hearing loss, early onset 21 (mouse) 5 109167240 143167381 Mouse 1301226 Bbaa2_m B.burgdorferi-associated arthritis 2 (mouse) Not determined 5 115156883 149157015 Mouse 10412197 Bbaa25_m B.burgdorferi-associated arthritis 25 (mouse) Not determined 5 109167240 143167381 Mouse 4141218 Ath24_m atherosclerosis 24 (mouse) Not determined 129520084 151758149 Mouse 11049557 Lmr26_m leishmaniasis resistance 26 (mouse) 5 133925558 151758149 Mouse 13464243 Ahl20_m age related hearing loss, early onset 20 (mouse) 5 107906299 141906412 Mouse
AW061068
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 139,802,271 - 139,802,409 UniSTS GRCm38 MGSCv37 5 140,278,225 - 140,278,363 UniSTS GRCm37 Celera 5 136,857,200 - 136,857,338 UniSTS Cytogenetic Map 5 G2 UniSTS cM Map 5 79.8 UniSTS Whitehead/MRC_RH 5 1681.24 UniSTS
D5Dcr1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 139,794,767 - 139,794,865 UniSTS GRCm38 MGSCv37 5 140,270,721 - 140,270,819 UniSTS GRCm37 Celera 5 136,849,708 - 136,849,794 UniSTS Cytogenetic Map 5 G2 UniSTS cM Map 5 UniSTS
D42124
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 139,800,889 - 139,801,022 UniSTS GRCm38 MGSCv37 5 140,276,843 - 140,276,976 UniSTS GRCm37 Celera 5 136,855,818 - 136,855,951 UniSTS Cytogenetic Map 5 G2 UniSTS cM Map 5 79.8 UniSTS Whitehead/MRC_RH 5 1682.77 UniSTS
Mafk
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 139,799,153 - 139,800,534 UniSTS GRCm38 MGSCv37 5 140,275,107 - 140,276,488 UniSTS GRCm37 Celera 5 136,854,082 - 136,855,463 UniSTS Cytogenetic Map 5 G2 UniSTS cM Map 5 79.8 UniSTS cM Map 5 81.0 UniSTS
PMC203348P1
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 139,800,106 - 139,800,481 UniSTS GRCm38 MGSCv37 5 140,276,060 - 140,276,435 UniSTS GRCm37 Celera 5 136,855,035 - 136,855,410 UniSTS Cytogenetic Map 5 G2 UniSTS cM Map 5 79.8 UniSTS
Mafk
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 139,801,899 - 139,802,619 UniSTS GRCm38 MGSCv37 5 140,277,853 - 140,278,573 UniSTS GRCm37 Celera 5 136,856,828 - 136,857,548 UniSTS Cytogenetic Map 5 G2 UniSTS cM Map 5 81.0 UniSTS
Mafk
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 5 139,799,168 - 139,800,134 UniSTS GRCm38 MGSCv37 5 140,275,122 - 140,276,088 UniSTS GRCm37 Celera 5 136,854,097 - 136,855,063 UniSTS Cytogenetic Map 5 G2 UniSTS
Mafk
Mouse Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 5 G2 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000018287 ⟹ ENSMUSP00000018287
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 139,777,268 - 139,788,408 (+) Ensembl GRCm38.p6 Ensembl 5 139,791,513 - 139,802,653 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000110836 ⟹ ENSMUSP00000106460
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 139,783,269 - 139,788,086 (+) Ensembl GRCm38.p6 Ensembl 5 139,797,514 - 139,802,331 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000151577
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 5 139,777,289 - 139,785,255 (+) Ensembl GRCm38.p6 Ensembl 5 139,791,534 - 139,799,500 (+) Ensembl
RefSeq Acc Id:
NM_010757 ⟹ NP_034887
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 139,777,291 - 139,788,407 (+) NCBI GRCm38 5 139,791,536 - 139,802,652 (+) NCBI MGSCv37 5 140,267,490 - 140,278,606 (+) RGD Celera 5 136,846,479 - 136,857,581 (+) RGD cM Map 5 ENTREZGENE
Sequence:
TGGGGAGCCGGCGGCGGGCGGCGGGTGGCAGGGACTTGTTGTTCTTCGCCGAGTCGGAACGAGAAGTCCGAAGCGCGCAGGCGGAGACGGCGACTAAGGGGAGCGCGAGAGCAGAAGCGCTTGTGAAG
hide sequence
RefSeq Acc Id:
XM_006504653 ⟹ XP_006504716
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 5 139,777,481 - 139,788,409 (+) NCBI GRCm38 5 139,793,707 - 139,802,653 (+) NCBI
Sequence:
TTCGGGAACTGGGTAGGGGAACCCAGAGTTCGTGCACCTGCGGGAGGAGCACCCCGAAGGCCGC
hide sequence
RefSeq Acc Id:
NP_034887 ⟸ NM_010757
- UniProtKB:
Q60600 (UniProtKB/Swiss-Prot), Q61827 (UniProtKB/Swiss-Prot), Q3UP84 (UniProtKB/TrEMBL), Q3U568 (UniProtKB/TrEMBL)
- Sequence:
MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGYAASCRIKRVTQKEELERQRVELQQEVEKLARENSSMRLELDALRSKYEALQTFARTVARGPVTP
hide sequence
RefSeq Acc Id:
XP_006504716 ⟸ XM_006504653
- Peptide Label:
isoform X1
- UniProtKB:
Q60600 (UniProtKB/Swiss-Prot), Q61827 (UniProtKB/Swiss-Prot), Q3UP84 (UniProtKB/TrEMBL), Q3U568 (UniProtKB/TrEMBL)
- Sequence:
MTTNPKPNKALKVKKEAGENAPVLSDDELVSMSVRELNQHLRGLTKEEVTRLKQRRRTLKNRGY
hide sequence
Ensembl Acc Id:
ENSMUSP00000106460 ⟸ ENSMUST00000110836
Ensembl Acc Id:
ENSMUSP00000018287 ⟸ ENSMUST00000018287
RGD ID: 6888574 Promoter ID: EPDNEW_M7738 Type: initiation region Name: Mafk_1 Description: Mus musculus v-maf musculoaponeurotic fibrosarcoma oncogene family,protein K , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 5 139,791,531 - 139,791,591 EPDNEW
RGD ID: 6837853 Promoter ID: MM_KWN:44629 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000062176, OTTMUST00000062178 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 140,267,286 - 140,267,786 (+) MPROMDB
RGD ID: 6837854 Promoter ID: MM_KWN:44630 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, Kidney, Lung, MEF_B6 Transcripts: ENSMUST00000110836 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 140,272,876 - 140,274,197 (+) MPROMDB
RGD ID: 6849178 Promoter ID: MM_XEF:5746 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_2Hour, BoneMarrow_4Hour, Kidney, Lung, Spleen Transcripts: NM_001002044 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 5 140,275,929 - 140,276,429 (+) MPROMDB
