Symbol:
MAFG
Name:
MAF bZIP transcription factor G
RGD ID:
1352039
HGNC Page
HGNC:6781
Description:
Enables identical protein binding activity and sequence-specific double-stranded DNA binding activity. Predicted to be involved in regulation of epidermal cell differentiation and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within adult behavior; in utero embryonic development; and regulation of cell population proliferation. Part of RNA polymerase II transcription regulator complex.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
basic leucine zipper transcription factor MafG; hMAF; MGC13090; MGC20149; transcription factor MafG; v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog G
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Mus musculus (house mouse):
Mafg (v-maf musculoaponeurotic fibrosarcoma oncogene family, protein G (avian)) HGNC
Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Mafg (MAF bZIP transcription factor G) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):
Mafg (MAF bZIP transcription factor G) NCBI
Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):
MAFG (MAF bZIP transcription factor G) NCBI
Ortholog
Canis lupus familiaris (dog):
MAFG (MAF bZIP transcription factor G) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Mafg (MAF bZIP transcription factor G) NCBI
Ortholog
Sus scrofa (pig):
MAFG (MAF bZIP transcription factor G) HGNC
Ensembl, NCBI, OrthoDB
Chlorocebus sabaeus (green monkey):
MAFG (MAF bZIP transcription factor G) NCBI
Ortholog
Heterocephalus glaber (naked mole-rat):
Mafg (MAF bZIP transcription factor G) NCBI
Ortholog
Other homologs 2
Mus musculus (house mouse):
Mafk (v-maf musculoaponeurotic fibrosarcoma oncogene family, protein K (avian)) HGNC
OrthoDB
Canis lupus familiaris (dog):
MAFK (MAF bZIP transcription factor K) HGNC
OrthoDB
Sus scrofa (pig):
MAFK (MAF bZIP transcription factor K) HGNC
OrthoDB
Rattus norvegicus (Norway rat):
Ms4a4c-ps1 (membrane-spanning 4-domains, subfamily A, member 4C, pseudogene 1) HGNC
OMA
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Mafg (MAF bZIP transcription factor G)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Mafg (v-maf musculoaponeurotic fibrosarcoma oncogene family, protein G (avian))
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
mafga (v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog Ga)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
mafgb (v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog Gb)
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|ZFIN)
Caenorhabditis elegans (roundworm):
maf-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
maf-S
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus laevis (African clawed frog):
mafg.L
Alliance
DIOPT (Xenbase)
Xenopus tropicalis (tropical clawed frog):
mafg
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Allele / Splice:
See ClinVar data
Latest Assembly:
GRCh38 - Human Genome Assembly GRCh38
Position:
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 81,918,270 - 81,931,244 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 81,918,270 - 81,927,735 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 79,876,146 - 79,885,611 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 77,469,438 - 77,478,879 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 76,480,214 - 76,489,629 (-) NCBI Celera Cytogenetic Map 17 q25.3 NCBI HuRef 17 75,277,766 - 75,297,553 (-) NCBI HuRef CHM1_1 17 79,962,349 - 79,971,791 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 82,785,430 - 82,798,403 (-) NCBI T2T-CHM13v2.0
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
MAFG Human (-)-epigallocatechin 3-gallate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of MAFG mRNA CTD PMID:22079256 MAFG Human (E)-cinnamyl alcohol increases expression EXP 6480464 cinnamyl alcohol results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human 1,2-dimethylhydrazine increases expression ISO Mafg (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of MAFG mRNA CTD PMID:22206623 MAFG Human 1-chloro-2,4-dinitrobenzene increases expression EXP 6480464 Dinitrochlorobenzene results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human 17alpha-ethynylestradiol increases expression ISO Mafg (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of MAFG mRNA CTD PMID:17942748 MAFG Human 17alpha-ethynylestradiol increases expression ISO Mafg (Rattus norvegicus) 6480464 Ethinyl Estradiol results in increased expression of MAFG mRNA CTD PMID:29097150 MAFG Human 17alpha-ethynylestradiol multiple interactions ISO Mafg (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MAFG mRNA CTD PMID:17942748 MAFG Human 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mafg (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MAFG mRNA CTD PMID:21570461 and PMID:24058054 MAFG Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Mafg (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAFG mRNA CTD PMID:33387578 MAFG Human 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Mafg (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of MAFG mRNA CTD PMID:34747641 MAFG Human 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Mafg (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of MAFG mRNA CTD PMID:37172768 MAFG Human 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MAFG mRNA CTD PMID:26238291 MAFG Human 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mafg (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MAFG mRNA CTD PMID:17942748 MAFG Human 2,6-dinitrotoluene affects expression ISO Mafg (Rattus norvegicus) 6480464 2 and 6-dinitrotoluene affects the expression of MAFG mRNA CTD PMID:21346803 MAFG Human 2-hydroxypropanoic acid increases expression EXP 6480464 Lactic Acid results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human 2-tert-butylhydroquinone decreases expression EXP 6480464 2-tert-butylhydroquinone results in decreased expression of MAFG mRNA CTD PMID:35724838 MAFG Human 3,4-methylenedioxymethamphetamine affects expression ISO Mafg (Rattus norvegicus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine affects the expression of MAFG mRNA CTD PMID:30071829 MAFG Human 4,4'-sulfonyldiphenol decreases expression ISO Mafg (Mus musculus) 6480464 bisphenol S results in decreased expression of MAFG mRNA CTD PMID:39298647 MAFG Human 4-amino-2,6-dinitrotoluene affects expression ISO Mafg (Rattus norvegicus) 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of MAFG mRNA CTD PMID:21346803 MAFG Human 4-hydroxynon-2-enal increases expression ISO Mafg (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of MAFG mRNA CTD PMID:19191707 MAFG Human acrolein multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of MAFG mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of MAFG mRNA CTD PMID:32699268 MAFG Human acrolein affects expression ISO Mafg (Rattus norvegicus) 6480464 Acrolein affects the expression of MAFG mRNA CTD PMID:38090360 MAFG Human acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of MAFG mRNA CTD PMID:32763439 MAFG Human all-trans-retinoic acid increases expression EXP 6480464 Tretinoin results in increased expression of MAFG mRNA CTD PMID:23724009 MAFG Human alpha-hexylcinnamaldehyde increases expression EXP 6480464 hexyl cinnamic aldehyde results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human alpha-pinene multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of MAFG mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of MAFG mRNA CTD PMID:32699268 MAFG Human amiodarone increases expression EXP 6480464 Amiodarone results in increased expression of MAFG mRNA CTD PMID:19774075 and PMID:36586010 MAFG Human ammonium chloride affects expression ISO Mafg (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of MAFG mRNA CTD PMID:16483693 MAFG Human andrographolide decreases expression EXP 6480464 andrographolide results in decreased expression of MAFG mRNA CTD PMID:35724838 MAFG Human aristolochic acid A increases expression EXP 6480464 aristolochic acid I results in increased expression of MAFG mRNA CTD PMID:33212167 MAFG Human arotinoid acid multiple interactions EXP 6480464 [4-(2-(5 more ... CTD PMID:34480604 MAFG Human azoxystrobin decreases expression EXP 6480464 azoxystrobin results in decreased expression of MAFG mRNA CTD PMID:33512557 MAFG Human Bandrowski's base increases expression EXP 6480464 Bandrowski's base results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human Bardoxolone methyl affects expression EXP 6480464 bardoxolone methyl affects the expression of MAFG mRNA CTD PMID:34480604 MAFG Human Bardoxolone methyl decreases expression EXP 6480464 bardoxolone methyl results in decreased expression of MAFG mRNA CTD PMID:35724838 MAFG Human benzene decreases expression EXP 6480464 Benzene results in decreased expression of MAFG mRNA CTD PMID:33064461 MAFG Human benzo[a]pyrene increases expression ISO Mafg (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of MAFG mRNA CTD PMID:21569818 and PMID:21715664 MAFG Human benzo[a]pyrene increases methylation EXP 6480464 Benzo(a)pyrene results in increased methylation of MAFG 3' UTR more ... CTD PMID:27901495 MAFG Human benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of MAFG mRNA CTD PMID:22316170 and PMID:26238291 MAFG Human benzoic acid increases expression EXP 6480464 Benzoic Acid results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human beta-naphthoflavone increases expression EXP 6480464 beta-Naphthoflavone results in increased expression of MAFG mRNA CTD PMID:32151702 and PMID:32858204 MAFG Human bisphenol A increases expression ISO Mafg (Rattus norvegicus) 6480464 bisphenol A results in increased expression of MAFG mRNA CTD PMID:25181051 MAFG Human bisphenol A decreases expression ISO Mafg (Mus musculus) 6480464 bisphenol A results in decreased expression of MAFG mRNA CTD PMID:32156529 MAFG Human bisphenol A multiple interactions EXP 6480464 [[ginger extract results in increased abundance of Oils and Volatile] which co-treated with bisphenol A] affects the expression of MAFG protein CTD PMID:33376534 MAFG Human bisphenol A decreases expression ISO Mafg (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of MAFG mRNA CTD PMID:34947998 MAFG Human bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of MAFG protein CTD PMID:33376534 MAFG Human bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MAFG mRNA CTD PMID:29275510 MAFG Human bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of MAFG mRNA CTD PMID:30903817 MAFG Human bisphenol A increases methylation ISO Mafg (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of MAFG gene CTD PMID:28505145 MAFG Human bisphenol A affects methylation ISO Mafg (Mus musculus) 6480464 bisphenol A affects the methylation of MAFG promoter CTD PMID:27334623 MAFG Human bortezomib increases expression EXP 6480464 Bortezomib results in increased expression of MAFG mRNA CTD PMID:20977926 MAFG Human butan-1-ol multiple interactions EXP 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in increased expression of MAFG mRNA CTD PMID:29432896 MAFG Human cadmium atom multiple interactions ISO Mafg (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MAFG mRNA CTD PMID:37325564 MAFG Human cadmium dichloride increases expression ISO Mafg (Rattus norvegicus) 6480464 Cadmium Chloride results in increased expression of MAFG mRNA CTD PMID:19010381 more ... MAFG Human cadmium dichloride multiple interactions ISO Mafg (Mus musculus) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of MAFG mRNA CTD PMID:37325564 MAFG Human cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of MAFG mRNA CTD PMID:11162468 more ... MAFG Human cadmium sulfate increases expression EXP 6480464 cadmium sulfate results in increased expression of MAFG mRNA CTD PMID:12064557 and PMID:21783983 MAFG Human cannabidiol increases expression EXP 6480464 Cannabidiol results in increased expression of MAFG mRNA CTD PMID:31518892 MAFG Human CGP 52608 multiple interactions EXP 6480464 CGP 52608 promotes the reaction [RORA protein binds to MAFG gene] CTD PMID:28238834 MAFG Human chenodeoxycholic acid multiple interactions EXP 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA CTD PMID:32152650 MAFG Human CHIR 99021 multiple interactions EXP 6480464 [4-(2-(5 more ... CTD PMID:34480604 MAFG Human chloroacetaldehyde increases expression EXP 6480464 chloroacetaldehyde results in increased expression of MAFG mRNA CTD PMID:25596134 MAFG Human chloroprene increases expression ISO Mafg (Mus musculus) 6480464 Chloroprene results in increased expression of MAFG mRNA CTD PMID:23125180 MAFG Human chlorpyrifos decreases expression ISO Mafg (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of MAFG mRNA CTD PMID:37019170 MAFG Human cinnamyl alcohol increases expression EXP 6480464 cinnamyl alcohol results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human cisplatin increases expression EXP 6480464 Cisplatin results in increased expression of MAFG mRNA CTD PMID:33545341 MAFG Human clodronic acid increases expression EXP 6480464 Clodronic Acid results in increased expression of MAFG mRNA CTD PMID:25596134 MAFG Human clofibrate decreases expression ISO Mafg (Mus musculus) 6480464 Clofibrate results in decreased expression of MAFG mRNA CTD PMID:17585979 MAFG Human cobalt dichloride increases expression EXP 6480464 cobaltous chloride results in increased expression of MAFG mRNA CTD PMID:19320972 MAFG Human copper atom multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in increased expression of MAFG mRNA and [Organoselenium Compounds binds to Copper] which results in increased expression of MAFG mRNA CTD PMID:20971185 and PMID:25167922 MAFG Human copper(0) multiple interactions EXP 6480464 [NSC 689534 binds to Copper] which results in increased expression of MAFG mRNA and [Organoselenium Compounds binds to Copper] which results in increased expression of MAFG mRNA CTD PMID:20971185 and PMID:25167922 MAFG Human copper(II) chloride increases expression EXP 6480464 cupric chloride results in increased expression of MAFG mRNA CTD PMID:17211630 and PMID:38568856 MAFG Human copper(II) sulfate increases expression EXP 6480464 Copper Sulfate results in increased expression of MAFG mRNA CTD PMID:19549813 MAFG Human cortisol multiple interactions EXP 6480464 [4-(2-(5 more ... CTD PMID:34480604 MAFG Human CU-O LINKAGE increases expression EXP 6480464 cupric oxide results in increased expression of MAFG mRNA CTD PMID:22077320 MAFG Human cyclosporin A increases expression EXP 6480464 Cyclosporine results in increased expression of MAFG mRNA CTD PMID:20106945 more ... MAFG Human cyclosporin A multiple interactions EXP 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA CTD PMID:32152650 MAFG Human cyclosporin A decreases expression ISO Mafg (Rattus norvegicus) 6480464 Cyclosporine results in decreased expression of MAFG mRNA CTD PMID:25596134 MAFG Human DDE decreases expression EXP 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of MAFG mRNA CTD PMID:38568856 MAFG Human deoxycholic acid multiple interactions EXP 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA CTD PMID:32152650 MAFG Human dibutyl phthalate increases expression ISO Mafg (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of MAFG mRNA CTD PMID:21266533 MAFG Human dicrotophos increases expression EXP 6480464 dicrotophos results in increased expression of MAFG mRNA CTD PMID:28302478 MAFG Human diethyl malate increases expression EXP 6480464 diethyl malate results in increased expression of MAFG mRNA CTD PMID:38498338 MAFG Human diethyl maleate increases expression EXP 6480464 diethyl maleate results in increased expression of MAFG mRNA CTD PMID:33545341 and PMID:34480604 MAFG Human dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of MAFG mRNA CTD PMID:25596134 MAFG Human disodium selenite decreases expression EXP 6480464 Sodium Selenite results in decreased expression of MAFG mRNA CTD PMID:18175754 MAFG Human disulfiram increases expression EXP 6480464 Disulfiram results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human dorsomorphin multiple interactions EXP 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 MAFG Human doxorubicin decreases expression ISO Mafg (Mus musculus) 6480464 Doxorubicin results in decreased expression of MAFG mRNA CTD PMID:19277126 MAFG Human doxorubicin decreases expression EXP 6480464 Doxorubicin results in decreased expression of MAFG mRNA CTD PMID:29803840 MAFG Human endosulfan increases expression ISO Mafg (Rattus norvegicus) 6480464 Endosulfan results in increased expression of MAFG mRNA CTD PMID:29391264 MAFG Human eugenol increases expression EXP 6480464 Eugenol results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human fenofibrate decreases expression ISO Mafg (Rattus norvegicus) 6480464 Fenofibrate results in decreased expression of MAFG mRNA CTD PMID:25596134 MAFG Human fenofibrate increases expression EXP 6480464 Fenofibrate results in increased expression of MAFG mRNA CTD PMID:25596134 MAFG Human fenthion decreases expression ISO Mafg (Mus musculus) 6480464 Fenthion results in decreased expression of MAFG mRNA CTD PMID:34813904 MAFG Human flutamide increases expression ISO Mafg (Rattus norvegicus) 6480464 Flutamide results in increased expression of MAFG mRNA CTD PMID:24136188 MAFG Human folic acid decreases expression ISO Mafg (Mus musculus) 6480464 Folic Acid results in decreased expression of MAFG mRNA CTD PMID:25629700 MAFG Human gentamycin increases expression ISO Mafg (Rattus norvegicus) 6480464 Gentamicins results in increased expression of MAFG mRNA CTD PMID:33387578 MAFG Human geraniol increases expression EXP 6480464 geraniol results in increased expression of MAFG mRNA CTD PMID:27683099 MAFG Human glycochenodeoxycholic acid multiple interactions EXP 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA CTD PMID:32152650 MAFG Human glycocholic acid multiple interactions EXP 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA CTD PMID:32152650 MAFG Human glycodeoxycholic acid multiple interactions EXP 6480464 [Cyclosporine co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA and [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA CTD PMID:32152650 MAFG Human hexane increases expression EXP 6480464 n-hexane results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human hydrogen peroxide affects expression EXP 6480464 Hydrogen Peroxide affects the expression of MAFG mRNA CTD PMID:20044591 MAFG Human hydrogen peroxide increases expression EXP 6480464 Hydrogen Peroxide results in increased expression of MAFG mRNA CTD PMID:12414654 MAFG Human hypochlorous acid increases expression EXP 6480464 Hypochlorous Acid results in increased expression of MAFG mRNA CTD PMID:18156441 MAFG Human ibuprofen decreases expression ISO Mafg (Rattus norvegicus) 6480464 Ibuprofen results in decreased expression of MAFG mRNA CTD PMID:25596134 MAFG Human ifosfamide increases expression EXP 6480464 Ifosfamide results in increased expression of MAFG mRNA CTD PMID:25596134 MAFG Human iron dichloride increases expression EXP 6480464 ferrous chloride results in increased expression of MAFG mRNA CTD PMID:35984750 MAFG Human isoeugenol increases expression EXP 6480464 isoeugenol results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human L-ascorbic acid multiple interactions EXP 6480464 [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of MAFG mRNA CTD PMID:34480604 MAFG Human L-ascorbic acid 2-phosphate multiple interactions EXP 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of MAFG mRNA CTD PMID:34480604 MAFG Human lead diacetate increases expression EXP 6480464 lead acetate results in increased expression of MAFG mRNA CTD PMID:38568856 MAFG Human lead(0) decreases expression EXP 6480464 Lead results in decreased expression of MAFG mRNA CTD PMID:19921347 MAFG Human lead(0) increases expression EXP 6480464 Lead results in increased expression of MAFG mRNA CTD PMID:37386098 MAFG Human leflunomide increases expression EXP 6480464 leflunomide results in increased expression of MAFG mRNA CTD PMID:28988120 MAFG Human lithocholic acid multiple interactions EXP 6480464 Lithocholic Acid results in increased expression of and results in increased activity of MAFG protein more ... CTD PMID:20146260 MAFG Human menadione increases expression EXP 6480464 Vitamin K 3 results in increased expression of MAFG mRNA CTD PMID:12414654 MAFG Human menadione affects expression EXP 6480464 Vitamin K 3 affects the expression of MAFG mRNA CTD PMID:20044591 MAFG Human mercury dibromide increases expression EXP 6480464 mercuric bromide results in increased expression of MAFG mRNA CTD PMID:26272509 MAFG Human mercury dibromide multiple interactions EXP 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAFG mRNA CTD PMID:27188386 MAFG Human metformin increases expression ISO Mafg (Rattus norvegicus) 6480464 Metformin results in increased expression of MAFG mRNA CTD PMID:25596134 MAFG Human methidathion decreases expression ISO Mafg (Mus musculus) 6480464 methidathion results in decreased expression of MAFG mRNA CTD PMID:34813904 MAFG Human methyl methanesulfonate increases expression EXP 6480464 Methyl Methanesulfonate results in increased expression of MAFG mRNA CTD PMID:23649840 MAFG Human methyl salicylate increases expression EXP 6480464 methyl salicylate results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human methylmercury chloride increases expression ISO Mafg (Mus musculus) 6480464 methylmercuric chloride results in increased expression of MAFG mRNA CTD PMID:20061341 MAFG Human methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of MAFG mRNA CTD PMID:23179753 and PMID:28001369 MAFG Human methylparaben increases expression EXP 6480464 methylparaben results in increased expression of MAFG mRNA CTD PMID:31745603 MAFG Human nefazodone multiple interactions EXP 6480464 [nefazodone co-treated with Glycochenodeoxycholic Acid co-treated with Deoxycholic Acid co-treated with Chenodeoxycholic Acid co-treated with Glycodeoxycholic Acid co-treated with Glycocholic Acid] results in increased expression of MAFG mRNA CTD PMID:32152650 MAFG Human nefazodone increases expression EXP 6480464 nefazodone results in increased expression of MAFG mRNA CTD PMID:32152650 MAFG Human nickel sulfate increases expression EXP 6480464 nickel sulfate results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human ochratoxin A increases expression EXP 6480464 ochratoxin A results in increased expression of MAFG mRNA CTD PMID:32905824 MAFG Human organoselenium compound multiple interactions EXP 6480464 [Organoselenium Compounds binds to Copper] which results in increased expression of MAFG mRNA CTD PMID:25167922 MAFG Human ozone multiple interactions EXP 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of MAFG mRNA more ... CTD PMID:32699268 and PMID:35430440 MAFG Human p-chloromercuribenzoic acid increases expression EXP 6480464 p-Chloromercuribenzoic Acid results in increased expression of MAFG mRNA CTD PMID:26272509 MAFG Human p-chloromercuribenzoic acid multiple interactions EXP 6480464 [NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAFG mRNA CTD PMID:27188386 MAFG Human paracetamol increases expression ISO Mafg (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of MAFG mRNA CTD PMID:33387578 MAFG Human paraquat increases expression EXP 6480464 Paraquat results in increased expression of MAFG mRNA CTD PMID:35182771 MAFG Human pentachlorophenol increases expression ISO Mafg (Mus musculus) 6480464 Pentachlorophenol results in increased expression of MAFG mRNA CTD PMID:23892564 MAFG Human phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of MAFG mRNA CTD PMID:19159669 MAFG Human phenylmercury acetate increases expression EXP 6480464 Phenylmercuric Acetate results in increased expression of MAFG mRNA CTD PMID:26272509 MAFG Human phenylmercury acetate multiple interactions EXP 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MAFG mRNA CTD PMID:27188386 MAFG Human phlorizin decreases expression ISO Mafg (Mus musculus) 6480464 Phlorhizin results in decreased expression of MAFG mRNA CTD PMID:22538082 MAFG Human phorone affects expression ISO Mafg (Rattus norvegicus) 6480464 phorone affects the expression of MAFG mRNA CTD PMID:18198479 MAFG Human picoxystrobin decreases expression EXP 6480464 picoxystrobin results in decreased expression of MAFG mRNA CTD PMID:33512557 MAFG Human potassium chromate multiple interactions EXP 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of MAFG mRNA CTD PMID:22079256 MAFG Human potassium chromate increases expression EXP 6480464 potassium chromate(VI) results in increased expression of MAFG mRNA CTD PMID:22079256 MAFG Human propan-2-ol increases expression EXP 6480464 2-Propanol results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human propiconazole decreases expression ISO Mafg (Mus musculus) 6480464 propiconazole results in decreased expression of MAFG mRNA CTD PMID:21278054 MAFG Human quercetin increases expression EXP 6480464 Quercetin results in increased expression of MAFG mRNA CTD PMID:21632981 MAFG Human rac-lactic acid increases expression EXP 6480464 Lactic Acid results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human reactive oxygen species affects expression EXP 6480464 Reactive Oxygen Species affects the expression of MAFG mRNA CTD PMID:25800948 MAFG Human rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of MAFG mRNA CTD PMID:33512557 MAFG Human rotenone increases expression EXP 6480464 Rotenone results in increased expression of MAFG mRNA CTD PMID:36586010 MAFG Human S-(1,2-dichlorovinyl)-L-cysteine increases expression EXP 6480464 S-(1 and 2-dichlorovinyl)cysteine results in increased expression of MAFG mRNA CTD PMID:33725128 MAFG Human S-adenosyl-L-methioninate multiple interactions EXP 6480464 S-Adenosylmethionine inhibits the reaction [Lithocholic Acid results in increased expression of MAFG protein] and S-Adenosylmethionine promotes the reaction [Ursodeoxycholic Acid inhibits the reaction [Lithocholic Acid results in increased expression of MAFG protein]] CTD PMID:20146260 MAFG Human S-adenosyl-L-methionine multiple interactions EXP 6480464 S-Adenosylmethionine inhibits the reaction [Lithocholic Acid results in increased expression of MAFG protein] and S-Adenosylmethionine promotes the reaction [Ursodeoxycholic Acid inhibits the reaction [Lithocholic Acid results in increased expression of MAFG protein]] CTD PMID:20146260 MAFG Human SB 431542 multiple interactions EXP 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:34480604 MAFG Human silver atom increases expression EXP 6480464 Silver results in increased expression of MAFG mRNA CTD PMID:26014281 MAFG Human silver(0) increases expression EXP 6480464 Silver results in increased expression of MAFG mRNA CTD PMID:26014281 MAFG Human sodium arsenite increases activity EXP 6480464 sodium arsenite results in increased activity of MAFG protein CTD PMID:12220541 MAFG Human sodium arsenite multiple interactions EXP 6480464 sodium arsenite promotes the reaction [MAFG protein binds to HSF1 promoter] and sodium arsenite promotes the reaction [MAFG protein binds to HSF1 protein] CTD PMID:30309986 MAFG Human sodium arsenite decreases expression ISO Mafg (Mus musculus) 6480464 sodium arsenite results in decreased expression of MAFG mRNA CTD PMID:19822182 MAFG Human sodium arsenite multiple interactions ISO Mafg (Mus musculus) 6480464 sodium arsenite promotes the reaction [[NFE2L2 protein binds to MAFG protein] which binds to NQO1 promoter] CTD PMID:16785233 MAFG Human sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of MAFG mRNA CTD PMID:11162468 more ... MAFG Human sodium dodecyl sulfate increases expression EXP 6480464 Sodium Dodecyl Sulfate results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human sulforaphane increases expression EXP 6480464 sulforaphane results in increased expression of MAFG mRNA CTD PMID:31838189 MAFG Human sulforaphane affects expression EXP 6480464 sulforaphane affects the expression of MAFG mRNA CTD PMID:35724838 MAFG Human sunitinib increases expression EXP 6480464 Sunitinib results in increased expression of MAFG mRNA CTD PMID:31533062 MAFG Human tert-butyl hydroperoxide increases methylation EXP 6480464 tert-Butylhydroperoxide results in increased methylation of MAFG gene CTD PMID:27509014 MAFG Human tert-butyl hydroperoxide increases expression EXP 6480464 tert-Butylhydroperoxide results in increased expression of MAFG mRNA CTD PMID:12414654 and PMID:27509014 MAFG Human thiram increases expression EXP 6480464 Thiram results in increased expression of MAFG mRNA CTD PMID:38568856 MAFG Human titanium dioxide increases expression ISO Mafg (Mus musculus) 6480464 titanium dioxide results in increased expression of MAFG mRNA CTD PMID:23131501 MAFG Human trans-isoeugenol increases expression EXP 6480464 isoeugenol results in increased expression of MAFG mRNA CTD PMID:20566472 MAFG Human Tributyltin oxide increases expression EXP 6480464 bis(tri-n-butyltin)oxide results in increased expression of MAFG mRNA CTD PMID:21601586 MAFG Human trichloroethene increases expression ISO Mafg (Rattus norvegicus) 6480464 Trichloroethylene results in increased expression of MAFG mRNA CTD PMID:33387578 MAFG Human triclosan increases methylation EXP 6480464 Triclosan results in increased methylation of MAFG gene CTD PMID:34523531 MAFG Human troglitazone decreases expression ISO Mafg (Rattus norvegicus) 6480464 troglitazone results in decreased expression of MAFG mRNA CTD PMID:25596134 MAFG Human tunicamycin increases expression EXP 6480464 Tunicamycin results in increased expression of MAFG mRNA CTD PMID:36586010 MAFG Human urethane increases expression EXP 6480464 Urethane results in increased expression of MAFG mRNA CTD PMID:28818685 MAFG Human ursodeoxycholic acid multiple interactions EXP 6480464 S-Adenosylmethionine promotes the reaction [Ursodeoxycholic Acid inhibits the reaction [Lithocholic Acid results in increased expression of MAFG protein]] and Ursodeoxycholic Acid inhibits the reaction [Lithocholic Acid results in increased expression of MAFG protein] CTD PMID:20146260 MAFG Human valproic acid affects expression ISO Mafg (Mus musculus) 6480464 Valproic Acid affects the expression of MAFG mRNA CTD PMID:17292431 MAFG Human valproic acid increases expression EXP 6480464 Valproic Acid results in increased expression of MAFG mRNA CTD PMID:28001369 MAFG Human valproic acid increases methylation EXP 6480464 Valproic Acid results in increased methylation of MAFG gene CTD PMID:29154799 MAFG Human valproic acid affects expression EXP 6480464 Valproic Acid affects the expression of MAFG mRNA CTD PMID:25979313 MAFG Human XAV939 multiple interactions EXP 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA protein binds to INHBA protein]] results in increased expression of MAFG mRNA and [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with FGF1 protein co-treated with WNT3A protein co-treated with HGF protein] co-treated with [INHBA protein binds to INHBA protein]] results in decreased expression of MAFG mRNA CTD PMID:34480604 MAFG Human zinc atom multiple interactions EXP 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of MAFG mRNA CTD PMID:18593933 MAFG Human zinc dichloride increases expression EXP 6480464 zinc chloride results in increased expression of MAFG mRNA CTD PMID:11162468 MAFG Human zinc(0) multiple interactions EXP 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of MAFG mRNA CTD PMID:18593933
(-)-epigallocatechin 3-gallate (EXP) (E)-cinnamyl alcohol (EXP) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (EXP) 17alpha-ethynylestradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,6-dinitrotoluene (ISO) 2-hydroxypropanoic acid (EXP) 2-tert-butylhydroquinone (EXP) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (ISO) 4-hydroxynon-2-enal (ISO) acrolein (EXP,ISO) acrylamide (EXP) all-trans-retinoic acid (EXP) alpha-hexylcinnamaldehyde (EXP) alpha-pinene (EXP) amiodarone (EXP) ammonium chloride (ISO) andrographolide (EXP) aristolochic acid A (EXP) arotinoid acid (EXP) azoxystrobin (EXP) Bandrowski's base (EXP) Bardoxolone methyl (EXP) benzene (EXP) benzo[a]pyrene (EXP,ISO) benzoic acid (EXP) beta-naphthoflavone (EXP) bisphenol A (EXP,ISO) bortezomib (EXP) butan-1-ol (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) cadmium sulfate (EXP) cannabidiol (EXP) CGP 52608 (EXP) chenodeoxycholic acid (EXP) CHIR 99021 (EXP) chloroacetaldehyde (EXP) chloroprene (ISO) chlorpyrifos (ISO) cinnamyl alcohol (EXP) cisplatin (EXP) clodronic acid (EXP) clofibrate (ISO) cobalt dichloride (EXP) copper atom (EXP) copper(0) (EXP) copper(II) chloride (EXP) copper(II) sulfate (EXP) cortisol (EXP) CU-O LINKAGE (EXP) cyclosporin A (EXP,ISO) DDE (EXP) deoxycholic acid (EXP) dibutyl phthalate (ISO) dicrotophos (EXP) diethyl malate (EXP) diethyl maleate (EXP) dioxygen (EXP) disodium selenite (EXP) disulfiram (EXP) dorsomorphin (EXP) doxorubicin (EXP,ISO) endosulfan (ISO) eugenol (EXP) fenofibrate (EXP,ISO) fenthion (ISO) flutamide (ISO) folic acid (ISO) gentamycin (ISO) geraniol (EXP) glycochenodeoxycholic acid (EXP) glycocholic acid (EXP) glycodeoxycholic acid (EXP) hexane (EXP) hydrogen peroxide (EXP) hypochlorous acid (EXP) ibuprofen (ISO) ifosfamide (EXP) iron dichloride (EXP) isoeugenol (EXP) L-ascorbic acid (EXP) L-ascorbic acid 2-phosphate (EXP) lead diacetate (EXP) lead(0) (EXP) leflunomide (EXP) lithocholic acid (EXP) menadione (EXP) mercury dibromide (EXP) metformin (ISO) methidathion (ISO) methyl methanesulfonate (EXP) methyl salicylate (EXP) methylmercury chloride (EXP,ISO) methylparaben (EXP) nefazodone (EXP) nickel sulfate (EXP) ochratoxin A (EXP) organoselenium compound (EXP) ozone (EXP) p-chloromercuribenzoic acid (EXP) paracetamol (ISO) paraquat (EXP) pentachlorophenol (ISO) phenobarbital (EXP) phenylmercury acetate (EXP) phlorizin (ISO) phorone (ISO) picoxystrobin (EXP) potassium chromate (EXP) propan-2-ol (EXP) propiconazole (ISO) quercetin (EXP) rac-lactic acid (EXP) reactive oxygen species (EXP) rotenone (EXP) S-(1,2-dichlorovinyl)-L-cysteine (EXP) S-adenosyl-L-methioninate (EXP) S-adenosyl-L-methionine (EXP) SB 431542 (EXP) silver atom (EXP) silver(0) (EXP) sodium arsenite (EXP,ISO) sodium dodecyl sulfate (EXP) sulforaphane (EXP) sunitinib (EXP) tert-butyl hydroperoxide (EXP) thiram (EXP) titanium dioxide (ISO) trans-isoeugenol (EXP) Tributyltin oxide (EXP) trichloroethene (ISO) triclosan (EXP) troglitazone (ISO) tunicamycin (EXP) urethane (EXP) ursodeoxycholic acid (EXP) valproic acid (EXP,ISO) XAV939 (EXP) zinc atom (EXP) zinc dichloride (EXP) zinc(0) (EXP)
MAFG Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 81,918,270 - 81,931,244 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 81,918,270 - 81,927,735 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 79,876,146 - 79,885,611 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 77,469,438 - 77,478,879 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 17 76,480,214 - 76,489,629 (-) NCBI Celera Cytogenetic Map 17 q25.3 NCBI HuRef 17 75,277,766 - 75,297,553 (-) NCBI HuRef CHM1_1 17 79,962,349 - 79,971,791 (-) NCBI CHM1_1 T2T-CHM13v2.0 17 82,785,430 - 82,798,403 (-) NCBI T2T-CHM13v2.0
Mafg Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 120,515,943 - 120,525,771 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 120,515,943 - 120,524,426 (-) Ensembl GRCm39 Ensembl GRCm38 11 120,625,117 - 120,634,955 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 120,625,117 - 120,633,600 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 120,489,662 - 120,494,861 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 120,444,438 - 120,449,637 (-) NCBI MGSCv36 mm8 Celera 11 132,363,642 - 132,365,175 (-) NCBI Celera Cytogenetic Map 11 E2 NCBI cM Map 11 84.35 NCBI
Mafg Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 106,401,633 - 106,410,159 (-) NCBI GRCr8 mRatBN7.2 10 105,903,307 - 105,911,808 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 105,903,237 - 105,912,026 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 111,007,074 - 111,015,576 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 110,470,111 - 110,478,613 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 105,823,759 - 105,832,258 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 109,802,877 - 109,811,476 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 109,806,159 - 109,811,323 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 109,395,929 - 109,404,465 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 110,019,741 - 110,024,927 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 110,034,252 - 110,039,431 (-) NCBI Celera 10 104,449,965 - 104,455,151 (-) NCBI Celera Cytogenetic Map 10 q32.3 NCBI
Mafg Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955506 1,247,293 - 1,252,167 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955506 1,247,294 - 1,252,167 (+) NCBI ChiLan1.0 ChiLan1.0
MAFG Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 98,454,393 - 98,463,741 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 103,355,168 - 103,364,469 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 76,323,874 - 76,333,300 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 82,026,365 - 82,035,036 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 82,030,699 - 82,031,278 (-) Ensembl panpan1.1 panPan2
MAFG Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 368,102 - 373,825 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 9 372,216 - 372,797 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 970,324 - 975,925 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 961,543 - 967,144 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 965,535 - 966,116 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 986,697 - 992,297 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 1,113,317 - 1,118,910 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 1,191,956 - 1,200,828 (+) NCBI UU_Cfam_GSD_1.0
Mafg Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 978,486 - 986,842 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936594 5,424,940 - 5,430,097 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936594 5,425,117 - 5,430,057 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MAFG
MAFG Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 73,793,362 - 73,801,185 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 73,796,453 - 73,797,034 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 45,244,171 - 45,253,347 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mafg
.
Predicted Target Of
Count of predictions: 3422 Count of miRNA genes: 1149 Interacting mature miRNAs: 1463 Transcripts: ENST00000357736, ENST00000392366, ENST00000574686 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
D17S1450E
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 79,877,982 - 79,878,103 UniSTS GRCh37 Build 36 17 77,471,274 - 77,471,395 RGD NCBI36 Celera 17 76,482,050 - 76,482,171 RGD Cytogenetic Map 17 q25.3 UniSTS HuRef 17 75,279,603 - 75,279,724 UniSTS
MAFG__7350
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 79,879,500 - 79,880,411 UniSTS GRCh37 Build 36 17 77,472,792 - 77,473,703 RGD NCBI36 Celera 17 76,483,568 - 76,484,479 RGD HuRef 17 75,281,121 - 75,282,032 UniSTS
D17S2144
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 79,890,741 - 79,891,060 UniSTS GRCh37 Build 36 17 77,484,032 - 77,484,351 RGD NCBI36 Celera 17 76,494,781 - 76,495,100 RGD Cytogenetic Map 17 q25.3 UniSTS HuRef 17 75,291,706 - 75,292,025 UniSTS
RH78412
Human Assembly Chr Position (strand) Source JBrowse GRCh37 17 79,892,294 - 79,892,584 UniSTS GRCh37 Build 36 17 77,485,585 - 77,485,875 RGD NCBI36 Celera 17 76,496,334 - 76,496,624 RGD Cytogenetic Map 17 q25.3 UniSTS HuRef 17 75,293,259 - 75,293,549 UniSTS GeneMap99-GB4 RH Map 17 537.15 UniSTS NCBI RH Map 17 810.0 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
entire extraembryonic component
1204
2433
2788
2251
4965
1726
2351
5
622
1950
465
2269
7298
6467
53
3727
852
1743
1617
175
1
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENST00000357736 ⟹ ENSP00000350369
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 81,918,270 - 81,927,735 (-) Ensembl
Ensembl Acc Id:
ENST00000392366 ⟹ ENSP00000376173
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 81,921,560 - 81,923,532 (-) Ensembl
Ensembl Acc Id:
ENST00000574686 ⟹ ENSP00000459634
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38.p14 Ensembl 17 81,922,798 - 81,927,708 (-) Ensembl
RefSeq Acc Id:
NM_002359 ⟹ NP_002350
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 81,918,270 - 81,927,735 (-) NCBI GRCh37 17 79,876,145 - 79,885,587 (-) ENTREZGENE Build 36 17 77,469,438 - 77,478,879 (-) NCBI Archive HuRef 17 75,277,766 - 75,297,553 (-) ENTREZGENE CHM1_1 17 79,962,349 - 79,971,791 (-) NCBI T2T-CHM13v2.0 17 82,785,430 - 82,794,894 (-) NCBI
Sequence:
ATGTGACGTCTGTGGAGCGGCGGCGGCGGCGGCGGATCCCGAGCCTGGTCCGGCCCGGCCTTCCCAGTGCGCTCGGCCCGGCCCGCGCAGGCGGCGAGTCCTCCGAGCCCCGGGCCCGGACCCCTCGC
hide sequence
RefSeq Acc Id:
NM_032711 ⟹ NP_116100
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 81,918,270 - 81,923,466 (-) NCBI GRCh37 17 79,876,145 - 79,885,587 (-) ENTREZGENE Build 36 17 77,469,438 - 77,474,701 (-) NCBI Archive HuRef 17 75,277,766 - 75,297,553 (-) ENTREZGENE CHM1_1 17 79,962,349 - 79,967,666 (-) NCBI T2T-CHM13v2.0 17 82,785,430 - 82,790,627 (-) NCBI
Sequence:
AGTTCCCCTTCTCCCGTCAGACCTTCCTGACCTCCCACCTGGTTCTCTAGGGGCAGGGTGGACAGGAAGCAGCTCAGCCCAGCCTGGGAGAGGCCAAGGGCTGCCTCCTATCAGAGAGCGCCTGCTCG
hide sequence
RefSeq Acc Id:
XM_047436068 ⟹ XP_047292024
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 81,918,270 - 81,927,211 (-) NCBI
RefSeq Acc Id:
XM_047436069 ⟹ XP_047292025
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 81,918,270 - 81,926,855 (-) NCBI
RefSeq Acc Id:
XM_047436070 ⟹ XP_047292026
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 81,918,270 - 81,931,244 (-) NCBI
RefSeq Acc Id:
XM_047436071 ⟹ XP_047292027
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 81,918,270 - 81,931,166 (-) NCBI
RefSeq Acc Id:
XM_047436072 ⟹ XP_047292028
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source GRCh38 17 81,918,270 - 81,927,424 (-) NCBI
RefSeq Acc Id:
XM_054316126 ⟹ XP_054172101
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 17 82,785,430 - 82,794,370 (-) NCBI
RefSeq Acc Id:
XM_054316127 ⟹ XP_054172102
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 17 82,785,430 - 82,794,014 (-) NCBI
RefSeq Acc Id:
XM_054316128 ⟹ XP_054172103
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 17 82,785,430 - 82,798,403 (-) NCBI
RefSeq Acc Id:
XM_054316129 ⟹ XP_054172104
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 17 82,785,430 - 82,798,325 (-) NCBI
RefSeq Acc Id:
XM_054316130 ⟹ XP_054172105
Type:
CODING
Position:
Human Assembly Chr Position (strand) Source T2T-CHM13v2.0 17 82,785,430 - 82,794,583 (-) NCBI
RefSeq Acc Id:
NP_002350 ⟸ NM_002359
- UniProtKB:
O15525 (UniProtKB/Swiss-Prot)
- Sequence:
MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFARTVARSPVAP
hide sequence
RefSeq Acc Id:
NP_116100 ⟸ NM_032711
- UniProtKB:
O15525 (UniProtKB/Swiss-Prot)
- Sequence:
MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGY
hide sequence
Ensembl Acc Id:
ENSP00000459634 ⟸ ENST00000574686
Ensembl Acc Id:
ENSP00000376173 ⟸ ENST00000392366
Ensembl Acc Id:
ENSP00000350369 ⟸ ENST00000357736
RefSeq Acc Id:
XP_047292026 ⟸ XM_047436070
- Peptide Label:
isoform X1
- UniProtKB:
O15525 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047292027 ⟸ XM_047436071
- Peptide Label:
isoform X1
- UniProtKB:
O15525 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047292028 ⟸ XM_047436072
- Peptide Label:
isoform X1
- UniProtKB:
O15525 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047292024 ⟸ XM_047436068
- Peptide Label:
isoform X1
- UniProtKB:
O15525 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_047292025 ⟸ XM_047436069
- Peptide Label:
isoform X1
- UniProtKB:
O15525 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054172103 ⟸ XM_054316128
- Peptide Label:
isoform X1
- UniProtKB:
O15525 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054172104 ⟸ XM_054316129
- Peptide Label:
isoform X1
- UniProtKB:
O15525 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054172105 ⟸ XM_054316130
- Peptide Label:
isoform X1
- UniProtKB:
O15525 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054172101 ⟸ XM_054316126
- Peptide Label:
isoform X1
- UniProtKB:
O15525 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_054172102 ⟸ XM_054316127
- Peptide Label:
isoform X1
- UniProtKB:
O15525 (UniProtKB/Swiss-Prot)
RGD ID: 6811250 Promoter ID: HG_ACW:36899 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: K562 Transcripts: MAFGANDSIRT7.AAPR07, MAFGANDSIRT7.KAPR07-UNSPLICED, MAFGANDSIRT7.RAPR07, MAFGANDSIRT7.SAPR07, MAFGANDSIRT7.UAPR07, MAFGANDSIRT7.VBAPR07 Position: Human Assembly Chr Position (strand) Source Build 36 17 77,467,726 - 77,468,226 (-) MPROMDB
RGD ID: 6794296 Promoter ID: HG_KWN:27389 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: HeLa_S3, K562, NB4 Transcripts: NM_032711 Position: Human Assembly Chr Position (strand) Source Build 36 17 77,474,724 - 77,475,224 (-) MPROMDB
RGD ID: 6794321 Promoter ID: HG_KWN:27390 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: CD4+TCell, CD4+TCell_12Hour, HeLa_S3, K562, Lymphoblastoid, NB4 Transcripts: NM_002359, NR_015454 Position: Human Assembly Chr Position (strand) Source Build 36 17 77,477,911 - 77,479,122 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-05-17
MAFG
MAF bZIP transcription factor G
v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog G
Symbol and/or name change
5135510 APPROVED
2013-07-16
MAFG
v-maf avian musculoaponeurotic fibrosarcoma oncogene homolog G
v-maf musculoaponeurotic fibrosarcoma oncogene homolog G (avian)
Symbol and/or name change
5135510 APPROVED
