Cdc37 (cell division cycle 37, HSP90 cochaperone)

Gene: Cdc37 (cell division cycle 37, HSP90 cochaperone) Rattus norvegicus

Analyze

Symbol:

Cdc37

Name:

cell division cycle 37, HSP90 cochaperone

RGD ID:

71006

Description:

Enables protein kinase binding activity; protein-folding chaperone binding activity; and transcription corepressor binding activity. Predicted to be involved in several processes, including positive regulation of mitophagy in response to mitochondrial depolarization; protein folding; and protein stabilization. Predicted to act upstream of or within regulation of type I interferon-mediated signaling pathway and regulation of type II interferon-mediated signaling pathway. Located in ruffle membrane. Part of protein-containing complex. Orthologous to human CDC37 (cell division cycle 37, HSP90 cochaperone); PARTICIPATES IN protein kinase C (PKC) signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2-acetamidofluorene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CDC37 (cell division cycle 37 S. cerevisiae homolog); cell division cycle 37; cell division cycle 37 homolog; cell division cycle 37 homolog (S. cerevisiae); hsp90 chaperone protein kinase-targeting subunit; hsp90 co-chaperone Cdc37; p50Cdc37

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CDC37 (cell division cycle 37, HSP90 cochaperone)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cdc37 (cell division cycle 37)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cdc37 (cell division cycle 37, HSP90 cochaperone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CDC37 (cell division cycle 37, HSP90 cochaperone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CDC37 (cell division cycle 37, HSP90 cochaperone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cdc37 (cell division cycle 37, HSP90 cochaperone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CDC37 (cell division cycle 37, HSP90 cochaperone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CDC37 (cell division cycle 37, HSP90 cochaperone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cdc37 (cell division cycle 37, HSP90 cochaperone)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CDC37 (cell division cycle 37, HSP90 cochaperone)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cdc37 (cell division cycle 37)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cdc37 (cell division cycle 37 homolog (S. cerevisiae))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CDC37	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Cdc37	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	K07E8.6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	cdc-37	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cdc37	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	27,954,292 - 27,966,935 (-)	NCBI		GRCr8
mRatBN7.2	8	19,677,400 - 19,690,761 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	19,671,938 - 19,690,809 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	23,697,528 - 23,710,151 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	21,995,388 - 22,008,011 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	19,907,795 - 19,920,433 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	22,160,922 - 22,173,797 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	22,154,067 - 22,173,804 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	22,217,096 - 22,229,971 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	20,164,150 - 20,176,763 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	20,164,149 - 20,176,763 (-)	NCBI
Celera	8	21,072,564 - 21,085,065 (-)	NCBI		Celera
Cytogenetic Map	8	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

14-Deoxy-11,12-didehydroandrographolide (ISO)

17alpha-ethynylestradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2-acetamidofluorene (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

acetylsalicylic acid (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzene (ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP)

bortezomib (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

cerium trichloride (ISO)

chloropicrin (ISO)

cisplatin (ISO)

clofibrate (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

coumarin (ISO)

diarsenic trioxide (ISO)

diazinon (EXP,ISO)

dimethylarsinic acid (EXP)

disodium selenite (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

FR900359 (ISO)

geldanamycin (ISO)

hydralazine (ISO)

isoprenaline (EXP)

ivermectin (ISO)

lead(0) (ISO)

Mesaconitine (EXP)

methidathion (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

nickel dichloride (EXP)

niclosamide (ISO)

nitroglycerin (EXP)

oxaliplatin (ISO)

palbociclib (ISO)

paracetamol (ISO)

platycodin D (ISO)

quercetin (ISO)

SB 431542 (ISO)

sodium dichromate (EXP)

tamoxifen (ISO)

temozolomide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of mitophagy in response to mitochondrial depolarization (IEA,ISO)

post-transcriptional regulation of gene expression (IEA,ISO)

protein folding (IBA,IEA)

protein stabilization (IBA,IEA)

regulation of type I interferon-mediated signaling pathway (IEA,ISO)

regulation of type II interferon-mediated signaling pathway (IEA,ISO)

Cellular Component

cytoplasm (IBA,IEA,ISO)

cytosol (IEA,ISO)

HSP90-CDC37 chaperone complex (IEA,ISO)

protein folding chaperone complex (ISO)

protein-containing complex (IDA)

ruffle membrane (IDA)

Molecular Function

heat shock protein binding (IBA,IEA,ISO)

Hsp90 protein binding (IEA,ISO)

kinase binding (ISO)

mitogen-activated protein kinase kinase kinase binding (IPI)

protein binding (IPI,ISO)

protein kinase B binding (IPI)

protein kinase binding (IEA,IPI)

protein kinase regulator activity (IEA,ISO)

protein-folding chaperone binding (IBA,IEA,IPI)

scaffold protein binding (IEA,ISO)

transcription corepressor binding (IPI)

unfolded protein binding (IBA,IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

protein kinase C (PKC) signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Canonical and kinase activity-independent mechanisms for extracellular signal-regulated kinase 5 (ERK5) nuclear translocation require dissociation of Hsp90 from the ERK5-Cdc37 complex.	Erazo T, etal., Mol Cell Biol. 2013 Apr;33(8):1671-86. doi: 10.1128/MCB.01246-12. Epub 2013 Feb 19.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Gene Data Set	MGD Curation, June 12, 2002
5.	CK2 binds, phosphorylates, and regulates its pivotal substrate Cdc37, an Hsp90-cochaperone.	Miyata Y and Nishida E, Mol Cell Biochem. 2005 Jun;274(1-2):171-9.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Protein kinase C: poised to signal.	Newton AC Am J Physiol Endocrinol Metab. 2010 Mar;298(3):E395-402. Epub 2009 Nov 24.
8.	Interaction of rat Cdc37-related protein with retinoblastoma gene product.	Ozaki T and Sakiyama S, DNA Cell Biol. 1996 Nov;15(11):975-9.
9.	Molecular cloning and cell cycle-dependent expression of a novel gene that is homologous to cdc37.	Ozaki T, etal., DNA Cell Biol 1995 Dec;14(12):1017-23.
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:9660753	PMID:10409742	PMID:12489981	PMID:15082798	PMID:15489334	PMID:16280321	PMID:17189825	PMID:17349580	PMID:18566753	PMID:19091746	PMID:20458337	PMID:21855797
PMID:25002582	PMID:26362850	PMID:29127155	PMID:29687307	PMID:30053369	PMID:36920636

Genomics

Comparative Map Data

Cdc37
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	27,954,292 - 27,966,935 (-)	NCBI		GRCr8
mRatBN7.2	8	19,677,400 - 19,690,761 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	19,671,938 - 19,690,809 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	23,697,528 - 23,710,151 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	21,995,388 - 22,008,011 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	19,907,795 - 19,920,433 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	22,160,922 - 22,173,797 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	22,154,067 - 22,173,804 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	22,217,096 - 22,229,971 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	20,164,150 - 20,176,763 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	20,164,149 - 20,176,763 (-)	NCBI
Celera	8	21,072,564 - 21,085,065 (-)	NCBI		Celera
Cytogenetic Map	8	q13	NCBI

CDC37
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	10,391,133 - 10,403,542 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	10,391,133 - 10,420,121 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	19	10,501,809 - 10,514,218 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	10,362,809 - 10,375,271 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	19	10,362,808 - 10,375,271	NCBI
Celera	19	10,396,515 - 10,408,977 (-)	NCBI		Celera
Cytogenetic Map	19	p13.2	NCBI
HuRef	19	10,081,863 - 10,094,337 (-)	NCBI		HuRef
CHM1_1	19	10,502,536 - 10,515,003 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	10,517,575 - 10,529,998 (-)	NCBI		T2T-CHM13v2.0

Cdc37
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	21,050,727 - 21,061,230 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	21,044,518 - 21,061,278 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	21,139,431 - 21,149,934 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	21,133,222 - 21,149,982 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	20,942,985 - 20,954,350 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	20,888,943 - 20,900,308 (-)	NCBI		MGSCv36	mm8
Celera	9	18,407,255 - 18,418,620 (-)	NCBI		Celera
Cytogenetic Map	9	A3	NCBI
cM Map	9	7.72	NCBI

Cdc37
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	1,641,236 - 1,651,288 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955495	1,642,467 - 1,651,288 (-)	NCBI	ChiLan1.0	ChiLan1.0

CDC37
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	15,309,229 - 15,322,930 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	14,307,842 - 14,321,343 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	9,942,644 - 9,955,112 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	10,606,246 - 10,618,702 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	10,606,246 - 10,618,702 (-)	Ensembl	panpan1.1		panPan2

CDC37
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	50,727,702 - 50,738,197 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	50,727,749 - 50,736,269 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	50,598,319 - 50,608,815 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	51,249,729 - 51,260,450 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	51,249,761 - 51,260,446 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	50,456,068 - 50,466,564 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	50,885,097 - 50,895,593 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	51,125,770 - 51,136,267 (+)	NCBI		UU_Cfam_GSD_1.0

Cdc37
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	209,633,499 - 209,643,541 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936659	711,117 - 721,260 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936659	711,165 - 721,207 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CDC37
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	69,201,579 - 69,225,994 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	69,202,695 - 69,212,909 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	69,534,504 - 69,544,718 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CDC37
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	9,427,220 - 9,439,469 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	9,427,191 - 9,439,913 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666074	10,563,853 - 10,576,327 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cdc37
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	2,521,272 - 2,535,475 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624828	2,523,761 - 2,533,387 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cdc37
51 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	80
Count of miRNA genes:	64
Interacting mature miRNAs:	71
Transcripts:	ENSRNOT00000042314
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590084	Insglur5	Insulin/glucose ratio QTL 5	18.54	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	8	1	24597739	Rat
2317882	Alcrsp24	Alcohol response QTL 24	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	8	1	25902202	Rat
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	2097640	47097640	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	2097640	47097640	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	2097640	47097640	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	2097640	47097640	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	4705810	49705810	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	4705810	49705810	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	4705810	49705810	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
1357398	Slep3	Serum leptin concentration QTL 3	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
2302367	Slep5	Serum leptin concentration QTL 5	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	9712463	41866876	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053743	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080700	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB097113	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061720	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473993	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D26564	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000042314 ⟹ ENSRNOP00000051248

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	19,678,121 - 19,690,739 (-)	Ensembl
Rnor_6.0 Ensembl	8	22,160,922 - 22,173,797 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000079949 ⟹ ENSRNOP00000072578

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	19,671,938 - 19,690,809 (-)	Ensembl
Rnor_6.0 Ensembl	8	22,154,067 - 22,173,804 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000112085 ⟹ ENSRNOP00000076743

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	19,678,121 - 19,690,809 (-)	Ensembl

RefSeq Acc Id:

NM_053743 ⟹ NP_446195

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	27,954,294 - 27,966,930 (-)	NCBI
mRatBN7.2	8	19,678,123 - 19,690,759 (-)	NCBI
Rnor_6.0	8	22,160,922 - 22,173,797 (-)	NCBI
Rnor_5.0	8	22,217,096 - 22,229,971 (-)	NCBI
RGSC_v3.4	8	20,164,150 - 20,176,763 (-)	RGD
Celera	8	21,072,564 - 21,085,065 (-)	RGD

Sequence:

show sequence

CGAGCGGACTCTCTAGCCCTTGTGGGTCCCTGTTCAGCGCCCGGCCGTGTGGAGACCCGGGAGC
CAGTCCGGGCCTCCGAGGCGAAGATGGTGGACTACAGCGTTTGGGATCACATCGAGGTGTCGGA
CGATGAGGACGAGACGCACCCCAACATAGACACGGCCAGCCTGTTCCGCTGGCGGCACCAGGCC
CGGGTGGAACGCATGGAACAGTTTCAGAAGGAGAAAGAAGAACTGGACCGGGGCTGCCGGGAAT
GCAAGCGCAAGGTAGCCGAGTTCCAGCGCAAGCTGAAGGAACTGGAAGTGGCTGAGGGTGGTGG
CCAGGTGGAGCTTGAGCGGCTTCGAGCGGAGGCACAGCAGCTGCGCAAGGAGGAGCGAACTGGG
AGCAGAAGCTGGAGGACATGCGGCAAAAAGGAGAAGAACATGCCCTGGAATGTGGACACACTCA
GCAAAGATGGCTTCAGCAAGAGCATGGTCAATACCAAGCCTGAGAAGGCAGAGGAAGACTCAGA
GGAGGCAAGGGAGCAGAAACACAAGACCTTCGTTGAAAAATACGAGAAACAGATCAAACATTTC
GGCATGCTCCACCGCTGGGATGACAGCCAGAAGTACCTGTCAGACAATGTCCACCTGGTGTGCG
AGGAGACAGCCAACTACCTGGTTATCTGGTGCATTGACCTGGAAGTCGAGGAGAAGTGTGCCCT
GATGGAGCAGGTGGCTCACCAGACCATGGTCATGCAGTTCATCCTGGAGTTGGCCAAGAGTCTG
AAGGTCGACCCCCGGGCCTGCTTCCGGCAGTTTTTCACCAAGATCAAGACTGCTGACCAGCAGT
ACATGGAGGGCTTCAAGTATGAACTGGAGGCCTTTAAGGAGCGTGTGCGGGGCCGCGCCAAGCT
GCGAATAGAGAAGGCCATGAAGGAGTACGAGGAGGAGGAGCGCAAGAAGAGGCTAGGCCCTGGT
GGCCTGGACCCTGTGGAGGTCTACGAATCTCTGCCTGAGGAGCTGCAGAAGTGCTTTGATGTGA
AGGATGTACAGATGCTGCAAGACGCCATCAGCAAGATGGATCCTACTGATGCCAAGTATCACAT
GCAGCGTTGCATCGATTCTGGCCTCTGGGTCCCCAACTCCAAGTCTGGTGAGGCCAAGGAGGGG
GAGGAGGCGGGCCCCGGGGACCCATTGCTGGAAGCCGTCCCCAAAGCGGGCTTCGAGAAAGACA
TCAGTGCGTGACCCTTCTCCAGAAAAGGAAACCCAGCCACCATGTCCCTAGCTCCCGACTTCTT
CACTTCTGCTGCTCCTCACGTCCTGGCCCATGGCCTGCCCCATGTCCCCTCTCCTCCGGCCTGT
CCCCAGCACTCATCAGATTCTCTGCTTCGGGTTGAGGGGCTCTGCTGTCTGCAGCCCCCCCACC
CCCATCAGCGTTATGCCAAAGTCCTGGGGGTCTGGGGAGGGGCAGCAGCTGCCAGGTTGGTCCA
CCGGGTTGGGGATACACATGTCCCCATCTGGGCAGGGTCTGTCCCTATGGGTCTATGGTCACTG
TTTCTCTTCTGTCTAGCTTTCTGTCCTGCAACTGGCAACAATGTCCAATAAACAGTTCCAGGTG
CTGG

hide sequence

RefSeq Acc Id:

XM_039080700 ⟹ XP_038936628

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	27,954,292 - 27,966,935 (-)	NCBI
mRatBN7.2	8	19,677,400 - 19,690,761 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_446195	(Get FASTA)	NCBI Sequence Viewer
	XP_038936628	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61720	(Get FASTA)	NCBI Sequence Viewer
	BAA05618	(Get FASTA)	NCBI Sequence Viewer
	BAC54286	(Get FASTA)	NCBI Sequence Viewer
	EDL78319	(Get FASTA)	NCBI Sequence Viewer
	EDL78320	(Get FASTA)	NCBI Sequence Viewer
	EDL78321	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000051248.3
	ENSRNOP00000072578.2
	ENSRNOP00000076743
	ENSRNOP00000076743.1
GenBank Protein	Q63692	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446195 ⟸ NM_053743

- UniProtKB:

Q63692 (UniProtKB/Swiss-Prot), Q8CH95 (UniProtKB/Swiss-Prot), A0A140TAG9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRKVAEF
QRKLKELEVAEGGGQVELERLRAEAQQLRKEERTGSRSWRTCGKKEKNMPWNVDTLSKDGFSKS
MVNTKPEKAEEDSEEAREQKHKTFVEKYEKQIKHFGMLHRWDDSQKYLSDNVHLVCEETANYLV
IWCIDLEVEEKCALMEQVAHQTMVMQFILELAKSLKVDPRACFRQFFTKIKTADQQYMEGFKYE
LEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQD
AISKMDPTDAKYHMQRCIDSGLWVPNSKSGEAKEGEEAGPGDPLLEAVPKAGFEKDISA

hide sequence

RefSeq Acc Id:

ENSRNOP00000072578 ⟸ ENSRNOT00000079949

RefSeq Acc Id:

ENSRNOP00000051248 ⟸ ENSRNOT00000042314

RefSeq Acc Id:	XP_038936628 ⟸ XM_039080700
- Peptide Label:	isoform X1
- UniProtKB:	A0A140TAG9 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000076743 ⟸ ENSRNOT00000112085

Protein Domains

Cdc37 C-terminal Cdc37 Hsp90 binding Cdc37 N-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63692-F1-model_v2	AlphaFold	Q63692	1-379	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695776

Promoter ID:

EPDNEW_R6300

Type:

initiation region

Name:

Cdc37_1

Description:

cell division cycle 37

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	22,173,776 - 22,173,836	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:71006	AgrOrtholog
BioCyc Gene	G2FUF-31434	BioCyc
BioCyc Pathway	PWY66-374 [C20 prostanoid biosynthesis]	BioCyc
BioCyc Pathway Image	PWY66-374	BioCyc
Ensembl Genes	ENSRNOG00000033426	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000042314.4	UniProtKB/TrEMBL
	ENSRNOT00000079949.2	UniProtKB/TrEMBL
	ENSRNOT00000112085	ENTREZGENE
	ENSRNOT00000112085.1	UniProtKB/TrEMBL
Gene3D-CATH	1.20.58.610	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	6.10.140.250	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5598479	IMAGE-MGC_LOAD
InterPro	Cdc37	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cdc37_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cdc37_Hsp90-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cdc37_Hsp90-bd_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cdc37_N_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:114562	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72349	IMAGE-MGC_LOAD
NCBI Gene	114562	ENTREZGENE
PANTHER	HSP90 CO-CHAPERONE CDC37	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR12800	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	CDC37_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CDC37_M	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CDC37_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cdc37	PhenoGen
RatGTEx	ENSRNOG00000033426	RatGTEx
SMART	CDC37_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CDC37_M	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CDC37_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Hsp90 co-chaperone CDC37	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K3C1_RAT	UniProtKB/TrEMBL
	A0A140TAG9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5Y0C0_RAT	UniProtKB/TrEMBL
	A6JNP5_RAT	UniProtKB/TrEMBL
	A6JNP6_RAT	UniProtKB/TrEMBL
	A6JNP7_RAT	UniProtKB/TrEMBL
	CDC37_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q8CH95	ENTREZGENE
UniProt Secondary	Q8CH95	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2020-04-28	Cdc37	cell division cycle 37, HSP90 cochaperone	Cdc37	cell division cycle 37	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-01-23	Cdc37	cell division cycle 37	Cdc37	cell division cycle 37 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-07-09	Cdc37	cell division cycle 37 homolog (S. cerevisiae)			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_homology	has similarity to S. cerevisiae cdc37	70676

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

BioCyc Pathways