Advanced Search (OLGA)

Gene: Ddah1 (dimethylarginine dimethylaminohydrolase 1) Rattus norvegicus

Analyze

Symbol:

Ddah1

Name:

dimethylarginine dimethylaminohydrolase 1

RGD ID:

70968

Description:

Enables amino acid binding activity and dimethylargininase activity. Involved in arginine metabolic process; positive regulation of angiogenesis; and positive regulation of nitric oxide biosynthetic process. Human ortholog(s) of this gene implicated in cardiovascular system disease; coronary artery disease; and hypertension. Orthologous to human DDAH1 (dimethylarginine dimethylaminohydrolase 1); INTERACTS WITH 1-nitropropane; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DDAH-1; DDAHI; dimethylargininase-1; n(G),N(G)-dimethylarginine dimethylaminohydrolase 1; NG,NG dimethylarginine dimethylaminohydrolase; NGNG dimethylarginine dimethylaminohydrolase

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Allele / Splice:

Ddah1^em1Ywxu

Genetic Models:

SD-Ddah1^em1Ywxu

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	237,327,812 - 237,460,624 (+)	NCBI		GRCr8
mRatBN7.2	2	234,667,499 - 234,800,322 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	234,667,491 - 234,799,339 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	242,465,212 - 242,597,798 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	240,356,099 - 240,488,167 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	235,222,839 - 235,355,419 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	251,634,368 - 251,766,009 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	251,634,431 - 251,766,014 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	270,160,842 - 270,289,319 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	243,932,221 - 244,069,832 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	243,918,960 - 244,056,573 (+)	NCBI
Celera	2	226,655,820 - 226,787,619 (+)	NCBI		Celera
Cytogenetic Map	2	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddah1	Rat	cardiovascular system disease	susceptibility	ISO	RGD:1343347	1625582		RGD
Ddah1	Rat	coronary artery disease		ISO	RGD:1343347	329961317	DNA:missense mutation:cds:rs997251 (human)	RGD
Ddah1	Rat	hypertension	susceptibility	ISO	RGD:1343347	1625582		RGD
Ddah1	Rat	Pulmonary Arterial Hypertension	exacerbates	IMP	XCO:0000642	151347602	compared to wild type	RGD

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddah1	Rat	liver disease		ISO	RGD:1343347	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:19784758

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddah1	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:736772	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DDAH1 mRNA	CTD	PMID:36331819
Ddah1	Rat	1-nitropropane	decreases expression	EXP		6480464	1-nitropropane results in decreased expression of DDAH1 mRNA	CTD	PMID:17070881
Ddah1	Rat	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of DDAH1 mRNA	CTD	PMID:17557909
Ddah1	Rat	17beta-estradiol	affects expression	ISO	RGD:1343347	6480464	Estradiol affects the expression of DDAH1 mRNA	CTD	PMID:22574217
Ddah1	Rat	17beta-estradiol	affects expression	ISO	RGD:736772	6480464	Estradiol affects the expression of DDAH1 mRNA	CTD	PMID:39298647
Ddah1	Rat	17beta-estradiol	affects expression	EXP		6480464	Estradiol affects the expression of DDAH1 mRNA	CTD	PMID:32145629
Ddah1	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1343347	6480464	[Estradiol co-treated with Progesterone] results in increased expression of DDAH1 mRNA; [Estradiol co-treated with TGFB1 more ...	CTD	PMID:20660070\|PMID:30165855
Ddah1	Rat	17beta-estradiol	increases expression	ISO	RGD:736772	6480464	Estradiol results in increased expression of DDAH1 mRNA	CTD	PMID:19484750
Ddah1	Rat	2,3,4,7,8-Pentachlorodibenzofuran	decreases expression	EXP		6480464	2,3,4,7,8-pentachlorodibenzofuran results in decreased expression of DDAH1 mRNA	CTD	PMID:21724226
Ddah1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of DDAH1 mRNA	CTD	PMID:22298810\|PMID:34747641
Ddah1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:736772	6480464	Tetrachlorodibenzodioxin affects the expression of DDAH1 mRNA	CTD	PMID:21570461
Ddah1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1343347	6480464	Tetrachlorodibenzodioxin results in decreased expression of DDAH1 mRNA	CTD	PMID:20106945\|PMID:21632981
Ddah1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of DDAH1 mRNA	CTD	PMID:21215274\|PMID:32109520
Ddah1	Rat	2,4-diaminotoluene	increases expression	EXP		6480464	2,4-diaminotoluene results in increased expression of DDAH1 mRNA	CTD	PMID:17070881
Ddah1	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2,4-dinitrotoluene affects the expression of DDAH1 mRNA	CTD	PMID:21346803
Ddah1	Rat	2,6-diaminotoluene	increases expression	EXP		6480464	2,6-diaminotoluene results in increased expression of DDAH1 mRNA	CTD	PMID:17070881
Ddah1	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2,6-dinitrotoluene affects the expression of DDAH1 mRNA	CTD	PMID:21346803
Ddah1	Rat	2-acetamidofluorene	increases expression	EXP		6480464	2-Acetylaminofluorene results in increased expression of DDAH1 mRNA	CTD	PMID:17070881
Ddah1	Rat	2-nitro-p-phenylenediamine	increases expression	EXP		6480464	2-nitro-4-phenylenediamine results in increased expression of DDAH1 mRNA	CTD	PMID:17070881
Ddah1	Rat	2-nitrofluorene	increases expression	EXP		6480464	2-nitrofluorene results in increased expression of DDAH1 mRNA	CTD	PMID:15890375
Ddah1	Rat	2-nitropropane	increases expression	EXP		6480464	2-nitropropane results in increased expression of DDAH1 mRNA	CTD	PMID:17070881
Ddah1	Rat	3,4-methylenedioxymethamphetamine	affects expression	EXP		6480464	N-Methyl-3,4-methylenedioxyamphetamine affects the expression of DDAH1 mRNA	CTD	PMID:30071829
Ddah1	Rat	3-chloropropane-1,2-diol	increases expression	EXP		6480464	alpha-Chlorohydrin results in increased expression of DDAH1 mRNA	CTD	PMID:28522335
Ddah1	Rat	3H-1,2-dithiole-3-thione	increases expression	EXP		6480464	1,2-dithiol-3-thione results in increased expression of DDAH1 mRNA	CTD	PMID:19162173
Ddah1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1343347	6480464	bisphenol S results in increased expression of DDAH1 protein	CTD	PMID:34186270
Ddah1	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Ddah1	Rat	4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one	increases expression	EXP		6480464	4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of DDAH1 mRNA	CTD	PMID:15890375
Ddah1	Rat	4-acetylaminofluorene	decreases expression	EXP		6480464	4-acetylaminofluorene results in decreased expression of DDAH1 mRNA	CTD	PMID:17070881
Ddah1	Rat	4-amino-2,6-dinitrotoluene	affects expression	EXP		6480464	4-amino-2,6-dinitrotoluene affects the expression of DDAH1 mRNA	CTD	PMID:21346803
Ddah1	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:736772	6480464	Fenretinide results in increased expression of DDAH1 mRNA	CTD	PMID:28973697
Ddah1	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:736772	6480464	Fenretinide results in decreased expression of DDAH1 mRNA	CTD	PMID:28973697
Ddah1	Rat	4-nitro-1,2-phenylenediamine	increases expression	EXP		6480464	1,2-diamino-4-nitrobenzene results in increased expression of DDAH1 mRNA	CTD	PMID:17070881
Ddah1	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of DDAH1 mRNA	CTD	PMID:24780913
Ddah1	Rat	acetamide	decreases expression	EXP		6480464	acetamide results in decreased expression of DDAH1 mRNA	CTD	PMID:31881176
Ddah1	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of DDAH1 mRNA	CTD	PMID:28959563
Ddah1	Rat	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of DDAH1 mRNA	CTD	PMID:15890375
Ddah1	Rat	aflatoxin B1	decreases methylation	ISO	RGD:1343347	6480464	Aflatoxin B1 results in decreased methylation of DDAH1 gene	CTD	PMID:27153756
Ddah1	Rat	aflatoxin B1	decreases expression	ISO	RGD:736772	6480464	Aflatoxin B1 results in decreased expression of DDAH1 mRNA	CTD	PMID:19770486
Ddah1	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:1343347	6480464	Tretinoin results in decreased expression of DDAH1 mRNA	CTD	PMID:23724009
Ddah1	Rat	all-trans-retinoic acid	multiple interactions	ISO	RGD:736772	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of DDAH1 mRNA	CTD	PMID:36189433
Ddah1	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:1343347	6480464	Tretinoin results in increased expression of DDAH1 mRNA	CTD	PMID:33167477
Ddah1	Rat	Allylamine	increases expression	EXP		6480464	Allylamine results in increased expression of DDAH1 mRNA	CTD	PMID:15910882
Ddah1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of DDAH1 mRNA	CTD	PMID:16483693
Ddah1	Rat	aristolochic acid A	decreases expression	ISO	RGD:1343347	6480464	aristolochic acid I results in decreased expression of DDAH1 mRNA	CTD	PMID:33212167
Ddah1	Rat	atrazine	decreases expression	EXP		6480464	Atrazine results in decreased expression of DDAH1 mRNA	CTD	PMID:36841081
Ddah1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:736772	6480464	Benzo(a)pyrene results in decreased expression of DDAH1 mRNA	CTD	PMID:19770486\|PMID:21569818\|PMID:21715664
Ddah1	Rat	benzo[a]pyrene	decreases methylation	ISO	RGD:1343347	6480464	Benzo(a)pyrene results in decreased methylation of DDAH1 exon	CTD	PMID:27901495
Ddah1	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1343347	6480464	Benzo(a)pyrene results in increased methylation of DDAH1 3' UTR	CTD	PMID:27901495
Ddah1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:1343347	6480464	Benzo(a)pyrene affects the methylation of DDAH1 5' UTR; Benzo(a)pyrene affects the methylation of DDAH1 promoter	CTD	PMID:27901495
Ddah1	Rat	benzo[a]pyrene	multiple interactions	ISO	RGD:736772	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Ddah1	Rat	benzo[a]pyrene	increases expression	ISO	RGD:736772	6480464	Benzo(a)pyrene results in increased expression of DDAH1 mRNA	CTD	PMID:22610609
Ddah1	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RGD:1343347	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of DDAH1 mRNA	CTD	PMID:20018196
Ddah1	Rat	benzo[b]fluoranthene	affects expression	ISO	RGD:736772	6480464	benzo(b)fluoranthene affects the expression of DDAH1 mRNA	CTD	PMID:26377693
Ddah1	Rat	benzo[b]fluoranthene	multiple interactions	ISO	RGD:736772	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Ddah1	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:736772	6480464	Diethylhexyl Phthalate results in decreased expression of DDAH1 mRNA	CTD	PMID:34319233
Ddah1	Rat	bisphenol A	affects expression	EXP		6480464	bisphenol A affects the expression of DDAH1 mRNA	CTD	PMID:25181051\|PMID:32145629
Ddah1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of DDAH1 mRNA	CTD	PMID:35192832
Ddah1	Rat	bisphenol A	increases expression	ISO	RGD:1343347	6480464	bisphenol A results in increased expression of DDAH1 protein	CTD	PMID:37567409
Ddah1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Ddah1	Rat	bisphenol A	increases methylation	ISO	RGD:1343347	6480464	bisphenol A results in increased methylation of DDAH1 gene	CTD	PMID:31601247
Ddah1	Rat	bisphenol A	decreases expression	ISO	RGD:736772	6480464	bisphenol A results in decreased expression of DDAH1 mRNA	CTD	PMID:33221593
Ddah1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of DDAH1 mRNA	CTD	PMID:34947998
Ddah1	Rat	bisphenol A	decreases expression	ISO	RGD:1343347	6480464	bisphenol A results in decreased expression of DDAH1 mRNA	CTD	PMID:29275510
Ddah1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of DDAH1 gene	CTD	PMID:28505145
Ddah1	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Ddah1	Rat	butan-1-ol	multiple interactions	ISO	RGD:1343347	6480464	[[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic more ...	CTD	PMID:29432896
Ddah1	Rat	cadmium dichloride	increases expression	ISO	RGD:1343347	6480464	Cadmium Chloride results in increased expression of DDAH1 protein	CTD	PMID:24527689
Ddah1	Rat	cadmium dichloride	decreases expression	ISO	RGD:1343347	6480464	Cadmium Chloride results in decreased expression of DDAH1 mRNA	CTD	PMID:38568856
Ddah1	Rat	carbamazepine	affects expression	ISO	RGD:1343347	6480464	Carbamazepine affects the expression of DDAH1 mRNA	CTD	PMID:25979313
Ddah1	Rat	carbon nanotube	decreases expression	ISO	RGD:736772	6480464	Nanotubes, Carbon analog results in decreased expression of DDAH1 mRNA; Nanotubes, Carbon results in decreased more ...	CTD	PMID:25620056
Ddah1	Rat	carbon nanotube	increases expression	ISO	RGD:736772	6480464	Nanotubes, Carbon analog results in increased expression of DDAH1 mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681
Ddah1	Rat	chromium trinitrate	decreases expression	ISO	RGD:736772	6480464	chromium nitrate results in decreased expression of DDAH1 protein	CTD	PMID:22144121
Ddah1	Rat	chromium(6+)	affects expression	ISO	RGD:736772	6480464	chromium hexavalent ion affects the expression of DDAH1 mRNA	CTD	PMID:28472532
Ddah1	Rat	chromium(6+)	multiple interactions	ISO	RGD:1343347	6480464	[zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression more ...	CTD	PMID:38479592
Ddah1	Rat	chrysene	multiple interactions	ISO	RGD:736772	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Ddah1	Rat	cisplatin	multiple interactions	ISO	RGD:1343347	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of DDAH1 mRNA	CTD	PMID:27392435
Ddah1	Rat	clofibrate	increases expression	EXP		6480464	Clofibrate results in increased expression of DDAH1 protein	CTD	PMID:16470657
Ddah1	Rat	cobalt dichloride	decreases expression	ISO	RGD:1343347	6480464	cobaltous chloride results in decreased expression of DDAH1 mRNA	CTD	PMID:19320972
Ddah1	Rat	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of DDAH1 mRNA	CTD	PMID:24386269
Ddah1	Rat	copper atom	multiple interactions	ISO	RGD:736772	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression more ...	CTD	PMID:15467011
Ddah1	Rat	copper(0)	multiple interactions	ISO	RGD:736772	6480464	[ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression more ...	CTD	PMID:15467011
Ddah1	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1343347	6480464	Copper Sulfate results in decreased expression of DDAH1 mRNA	CTD	PMID:19549813
Ddah1	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of DDAH1 mRNA	CTD	PMID:27523638
Ddah1	Rat	cyclosporin A	decreases expression	ISO	RGD:1343347	6480464	Cyclosporine results in decreased expression of DDAH1 mRNA	CTD	PMID:20106945
Ddah1	Rat	cyclosporin A	decreases expression	ISO	RGD:736772	6480464	Cyclosporine results in decreased expression of DDAH1 mRNA	CTD	PMID:19770486
Ddah1	Rat	dexamethasone	increases expression	ISO	RGD:1343347	6480464	Dexamethasone results in increased expression of DDAH1 mRNA	CTD	PMID:25047013
Ddah1	Rat	dibenz[a,h]anthracene	increases expression	ISO	RGD:736772	6480464	1,2,5,6-dibenzanthracene results in increased expression of DDAH1 mRNA	CTD	PMID:26377693
Ddah1	Rat	dibutyl phthalate	increases expression	ISO	RGD:736772	6480464	Dibutyl Phthalate results in increased expression of DDAH1 mRNA	CTD	PMID:21266533
Ddah1	Rat	diethylstilbestrol	increases expression	EXP		6480464	Diethylstilbestrol results in increased expression of DDAH1 mRNA	CTD	PMID:15890375
Ddah1	Rat	dioxygen	multiple interactions	ISO	RGD:736772	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of DDAH1 mRNA; [sulforaphane more ...	CTD	PMID:30529165
Ddah1	Rat	diuron	decreases expression	EXP		6480464	Diuron results in decreased expression of DDAH1 mRNA	CTD	PMID:21551480
Ddah1	Rat	dorsomorphin	multiple interactions	ISO	RGD:1343347	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Ddah1	Rat	doxorubicin	decreases expression	ISO	RGD:1343347	6480464	Doxorubicin results in decreased expression of DDAH1 mRNA	CTD	PMID:29803840
Ddah1	Rat	ethanol	increases expression	ISO	RGD:736772	6480464	Ethanol results in increased expression of DDAH1 mRNA	CTD	PMID:30319688
Ddah1	Rat	flavonoids	increases expression	EXP		6480464	Flavonoids results in increased expression of DDAH1 mRNA	CTD	PMID:18035473
Ddah1	Rat	flutamide	decreases expression	EXP		6480464	Flutamide results in decreased expression of DDAH1 mRNA	CTD	PMID:24136188
Ddah1	Rat	folic acid	multiple interactions	ISO	RGD:736772	6480464	Folic Acid inhibits the reaction [AGT protein results in increased expression of DDAH1 mRNA]; Folic more ...	CTD	PMID:24386282
Ddah1	Rat	folic acid	decreases expression	ISO	RGD:736772	6480464	Folic Acid results in decreased expression of DDAH1 mRNA	CTD	PMID:25629700
Ddah1	Rat	formaldehyde	decreases expression	ISO	RGD:1343347	6480464	Formaldehyde results in decreased expression of DDAH1 mRNA; Formaldehyde results in decreased expression of DDAH1 more ...	CTD	PMID:17938736\|PMID:24140967\|PMID:27664576
Ddah1	Rat	furan	increases expression	EXP		6480464	furan results in increased expression of DDAH1 mRNA	CTD	PMID:26194646
Ddah1	Rat	glyphosate	decreases expression	ISO	RGD:736772	6480464	Glyphosate results in decreased expression of DDAH1 protein	CTD	PMID:37208198
Ddah1	Rat	hydroquinone	decreases expression	ISO	RGD:1343347	6480464	hydroquinone results in decreased expression of DDAH1 mRNA	CTD	PMID:31256213
Ddah1	Rat	indometacin	multiple interactions	EXP		6480464	Irbesartan inhibits the reaction [Indomethacin results in decreased expression of DDAH1 mRNA]; Ranitidine inhibits the more ...	CTD	PMID:29523851
Ddah1	Rat	indometacin	decreases expression	EXP		6480464	Indomethacin results in decreased expression of DDAH1 mRNA	CTD	PMID:29523851
Ddah1	Rat	inulin	multiple interactions	ISO	RGD:736772	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of DDAH1 mRNA	CTD	PMID:36331819
Ddah1	Rat	irbesartan	multiple interactions	EXP		6480464	Irbesartan inhibits the reaction [Indomethacin results in decreased expression of DDAH1 mRNA]	CTD	PMID:29523851
Ddah1	Rat	ivermectin	decreases expression	ISO	RGD:1343347	6480464	Ivermectin results in decreased expression of DDAH1 protein	CTD	PMID:32959892
Ddah1	Rat	lead diacetate	increases expression	ISO	RGD:736772	6480464	lead acetate results in increased expression of DDAH1 mRNA	CTD	PMID:20680508
Ddah1	Rat	lead diacetate	increases expression	EXP		6480464	lead acetate results in increased expression of DDAH1 mRNA	CTD	PMID:11578147
Ddah1	Rat	lead(0)	affects expression	ISO	RGD:1343347	6480464	Lead affects the expression of DDAH1 mRNA	CTD	PMID:28903495
Ddah1	Rat	maneb	multiple interactions	ISO	RGD:736772	6480464	[Maneb co-treated with Paraquat] results in decreased expression of DDAH1 mRNA	CTD	PMID:36117858
Ddah1	Rat	manganese atom	multiple interactions	ISO	RGD:736772	6480464	Paroxetine inhibits the reaction [Manganese deficiency results in decreased expression of DDAH1 protein]	CTD	PMID:21312047
Ddah1	Rat	manganese atom	decreases expression	ISO	RGD:736772	6480464	Manganese deficiency results in decreased expression of DDAH1 protein	CTD	PMID:21312047
Ddah1	Rat	manganese(0)	decreases expression	ISO	RGD:736772	6480464	Manganese deficiency results in decreased expression of DDAH1 protein	CTD	PMID:21312047
Ddah1	Rat	manganese(0)	multiple interactions	ISO	RGD:736772	6480464	Paroxetine inhibits the reaction [Manganese deficiency results in decreased expression of DDAH1 protein]	CTD	PMID:21312047
Ddah1	Rat	melatonin	multiple interactions	EXP		6480464	Melatonin inhibits the reaction [Methotrexate results in decreased expression of DDAH1 protein]	CTD	PMID:36890697
Ddah1	Rat	methamphetamine	affects expression	EXP		6480464	Methamphetamine affects the expression of DDAH1 protein	CTD	PMID:17904249
Ddah1	Rat	methapyrilene	increases expression	EXP		6480464	Methapyrilene results in increased expression of DDAH1 mRNA	CTD	PMID:15890375
Ddah1	Rat	methapyrilene	decreases expression	EXP		6480464	Methapyrilene results in decreased expression of DDAH1 mRNA	CTD	PMID:30467583
Ddah1	Rat	methotrexate	decreases expression	EXP		6480464	Methotrexate results in decreased expression of DDAH1 protein	CTD	PMID:36890697
Ddah1	Rat	methotrexate	multiple interactions	EXP		6480464	Melatonin inhibits the reaction [Methotrexate results in decreased expression of DDAH1 protein]	CTD	PMID:36890697
Ddah1	Rat	methylmercury chloride	increases expression	ISO	RGD:1343347	6480464	methylmercuric chloride results in increased expression of DDAH1 mRNA	CTD	PMID:23179753\|PMID:28001369
Ddah1	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:736772	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of DDAH1 mRNA	CTD	PMID:36189433
Ddah1	Rat	N-nitrosodimethylamine	increases expression	EXP		6480464	Dimethylnitrosamine results in increased expression of DDAH1 mRNA	CTD	PMID:15890375
Ddah1	Rat	N-nitrosomorpholine	increases expression	EXP		6480464	N-nitrosomorpholine results in increased expression of DDAH1 protein	CTD	PMID:19716841
Ddah1	Rat	N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine	multiple interactions	EXP		6480464	Ranitidine inhibits the reaction [Indomethacin results in decreased expression of DDAH1 mRNA]	CTD	PMID:29523851
Ddah1	Rat	nitrobenzenes	decreases expression	EXP		6480464	Nitrobenzenes analog results in decreased expression of DDAH1 mRNA	CTD	PMID:19784758
Ddah1	Rat	p-toluidine	increases expression	EXP		6480464	4-toluidine results in increased expression of DDAH1 mRNA	CTD	PMID:27638505
Ddah1	Rat	paracetamol	decreases expression	EXP		6480464	Acetaminophen results in decreased expression of DDAH1 mRNA	CTD	PMID:19784758\|PMID:33387578
Ddah1	Rat	paracetamol	affects expression	ISO	RGD:736772	6480464	Acetaminophen affects the expression of DDAH1 mRNA	CTD	PMID:17562736
Ddah1	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of DDAH1 mRNA	CTD	PMID:19784758
Ddah1	Rat	paracetamol	affects expression	EXP		6480464	Acetaminophen affects the expression of DDAH1 mRNA	CTD	PMID:19784758
Ddah1	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of DDAH1 mRNA	CTD	PMID:20388547
Ddah1	Rat	paraquat	multiple interactions	ISO	RGD:736772	6480464	[Maneb co-treated with Paraquat] results in decreased expression of DDAH1 mRNA	CTD	PMID:36117858
Ddah1	Rat	paroxetine	multiple interactions	ISO	RGD:736772	6480464	Paroxetine inhibits the reaction [Manganese deficiency results in decreased expression of DDAH1 protein]	CTD	PMID:21312047
Ddah1	Rat	perfluorododecanoic acid	increases expression	EXP		6480464	perfluorododecanoic acid results in increased expression of DDAH1 protein	CTD	PMID:26168851
Ddah1	Rat	perfluorooctane-1-sulfonic acid	decreases expression	EXP		6480464	perfluorooctane sulfonic acid results in decreased expression of DDAH1 mRNA	CTD	PMID:19162173
Ddah1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:736772	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of DDAH1 mRNA; [perfluorooctane sulfonic more ...	CTD	PMID:36331819
Ddah1	Rat	phenobarbital	decreases expression	EXP		6480464	Phenobarbital results in decreased expression of DDAH1 mRNA	CTD	PMID:19162173
Ddah1	Rat	phenobarbital	decreases expression	ISO	RGD:736772	6480464	Phenobarbital results in decreased expression of DDAH1 mRNA	CTD	PMID:19270015\|PMID:19482888\|PMID:23091169
Ddah1	Rat	phenylmercury acetate	increases expression	ISO	RGD:1343347	6480464	Phenylmercuric Acetate results in increased expression of DDAH1 mRNA	CTD	PMID:26272509
Ddah1	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:1343347	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Ddah1	Rat	pioglitazone	multiple interactions	ISO	RGD:736772	6480464	[N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of DDAH1 mRNA	CTD	PMID:27935865
Ddah1	Rat	piperonyl butoxide	increases expression	EXP		6480464	Piperonyl Butoxide results in increased expression of DDAH1 mRNA	CTD	PMID:15890375
Ddah1	Rat	pirinixic acid	increases expression	EXP		6480464	pirinixic acid results in increased expression of DDAH1 mRNA	CTD	PMID:15890375\|PMID:19162173
Ddah1	Rat	pirinixic acid	increases expression	ISO	RGD:736772	6480464	pirinixic acid results in increased expression of DDAH1 mRNA	CTD	PMID:18301758\|PMID:23811191
Ddah1	Rat	potassium chromate	decreases expression	ISO	RGD:736772	6480464	potassium chromate(VI) results in decreased expression of DDAH1 protein	CTD	PMID:22144121
Ddah1	Rat	pregnenolone 16alpha-carbonitrile	decreases expression	ISO	RGD:736772	6480464	Pregnenolone Carbonitrile results in decreased expression of DDAH1 mRNA	CTD	PMID:28903501
Ddah1	Rat	progesterone	multiple interactions	ISO	RGD:1343347	6480464	[Estradiol co-treated with Progesterone] results in increased expression of DDAH1 mRNA	CTD	PMID:20660070
Ddah1	Rat	propiconazole	decreases expression	ISO	RGD:736772	6480464	propiconazole results in decreased expression of DDAH1 mRNA	CTD	PMID:21278054
Ddah1	Rat	ranitidine	multiple interactions	EXP		6480464	Ranitidine inhibits the reaction [Indomethacin results in decreased expression of DDAH1 mRNA]	CTD	PMID:29523851
Ddah1	Rat	rotenone	affects expression	EXP		6480464	Rotenone affects the expression of DDAH1 mRNA	CTD	PMID:28374803
Ddah1	Rat	sarin	affects expression	EXP		6480464	Sarin affects the expression of DDAH1 protein	CTD	PMID:28973502
Ddah1	Rat	SB 431542	multiple interactions	ISO	RGD:1343347	6480464	[LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of DDAH1 more ...	CTD	PMID:27188386\|PMID:37664457
Ddah1	Rat	simvastatin	decreases expression	EXP		6480464	Simvastatin results in decreased expression of DDAH1 mRNA	CTD	PMID:16414398
Ddah1	Rat	sodium arsenite	increases expression	ISO	RGD:1343347	6480464	sodium arsenite results in increased expression of DDAH1 mRNA	CTD	PMID:17879257
Ddah1	Rat	sodium arsenite	increases expression	ISO	RGD:736772	6480464	sodium arsenite results in increased expression of DDAH1 protein	CTD	PMID:29044176
Ddah1	Rat	sodium arsenite	decreases expression	ISO	RGD:1343347	6480464	sodium arsenite results in decreased expression of DDAH1 mRNA	CTD	PMID:29301061
Ddah1	Rat	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of DDAH1 protein	CTD	PMID:29459688
Ddah1	Rat	sodium arsenite	affects methylation	ISO	RGD:1343347	6480464	sodium arsenite affects the methylation of DDAH1 gene	CTD	PMID:28589171
Ddah1	Rat	sulforaphane	multiple interactions	ISO	RGD:736772	6480464	[sulforaphane affects the susceptibility to Oxygen] which affects the expression of DDAH1 mRNA	CTD	PMID:30529165
Ddah1	Rat	taurine	decreases expression	ISO	RGD:1343347	6480464	Taurine results in decreased expression of DDAH1 mRNA	CTD	PMID:16579726
Ddah1	Rat	temozolomide	increases expression	ISO	RGD:1343347	6480464	Temozolomide results in increased expression of DDAH1 mRNA	CTD	PMID:31758290
Ddah1	Rat	Tesaglitazar	increases expression	EXP		6480464	tesaglitazar results in increased expression of DDAH1 mRNA	CTD	PMID:21515302
Ddah1	Rat	tetrachloromethane	increases expression	ISO	RGD:736772	6480464	Carbon Tetrachloride results in increased expression of DDAH1 mRNA	CTD	PMID:17484886
Ddah1	Rat	tetrachloromethane	decreases expression	ISO	RGD:736772	6480464	Carbon Tetrachloride results in decreased expression of DDAH1 mRNA	CTD	PMID:27339419\|PMID:31919559
Ddah1	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of DDAH1 mRNA	CTD	PMID:19784758
Ddah1	Rat	tetraphene	multiple interactions	ISO	RGD:736772	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Ddah1	Rat	thapsigargin	decreases expression	ISO	RGD:1343347	6480464	Thapsigargin results in decreased expression of DDAH1 mRNA	CTD	PMID:22378314
Ddah1	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of DDAH1 mRNA	CTD	PMID:19784758\|PMID:34492290
Ddah1	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of DDAH1 mRNA	CTD	PMID:23411599
Ddah1	Rat	titanium dioxide	increases expression	ISO	RGD:736772	6480464	titanium dioxide results in increased expression of DDAH1 mRNA	CTD	PMID:23557971\|PMID:27760801
Ddah1	Rat	titanium dioxide	increases methylation	ISO	RGD:736772	6480464	titanium dioxide results in increased methylation of DDAH1 gene	CTD	PMID:35295148
Ddah1	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of DDAH1 mRNA	CTD	PMID:33387578
Ddah1	Rat	trichostatin A	decreases expression	ISO	RGD:1343347	6480464	trichostatin A results in decreased expression of DDAH1 mRNA	CTD	PMID:26272509
Ddah1	Rat	trichostatin A	multiple interactions	ISO	RGD:1343347	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Ddah1	Rat	triclosan	decreases expression	ISO	RGD:1343347	6480464	Triclosan results in decreased expression of DDAH1 mRNA	CTD	PMID:30510588
Ddah1	Rat	triphenyl phosphate	increases expression	EXP		6480464	triphenyl phosphate results in increased expression of DDAH1 mRNA	CTD	PMID:30589522
Ddah1	Rat	valproic acid	affects expression	ISO	RGD:736772	6480464	Valproic Acid affects the expression of DDAH1 mRNA	CTD	PMID:17292431
Ddah1	Rat	valproic acid	increases expression	ISO	RGD:1343347	6480464	Valproic Acid results in increased expression of DDAH1 mRNA	CTD	PMID:23179753\|PMID:27188386\|PMID:28001369
Ddah1	Rat	valproic acid	affects expression	ISO	RGD:1343347	6480464	Valproic Acid affects the expression of DDAH1 mRNA	CTD	PMID:25979313
Ddah1	Rat	venlafaxine hydrochloride	increases expression	EXP		6480464	Venlafaxine Hydrochloride results in increased expression of DDAH1 mRNA	CTD	PMID:25423262
Ddah1	Rat	zoledronic acid	decreases expression	ISO	RGD:1343347	6480464	zoledronic acid results in decreased expression of DDAH1 mRNA	CTD	PMID:24714768

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddah1	Rat	arginine catabolic process	involved_in	ISO	RGD:1343347	1624291	PMID:24895913	RGD	PMID:24895913
Ddah1	Rat	arginine catabolic process	involved_in	IEA	UniProtKB:O94760\|ensembl:ENSP00000284031	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ddah1	Rat	arginine metabolic process		IDA		1625578		RGD
Ddah1	Rat	arginine metabolic process	involved_in	IBA	PANTHER:PTN000978164\|RGD:70968\|UniProtKB:O94760	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ddah1	Rat	citrulline metabolic process	involved_in	ISS	UniProtKB:O94760	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ddah1	Rat	citrulline metabolic process	involved_in	IBA	PANTHER:PTN000978164\|UniProtKB:O94760	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ddah1	Rat	citrulline metabolic process	involved_in	IEA	UniProtKB:O94760\|ensembl:ENSP00000284031	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ddah1	Rat	citrulline metabolic process	involved_in	ISO	RGD:1343347	1624291	PMID:19663506	RGD	PMID:19663506
Ddah1	Rat	negative regulation of cell population proliferation	involved_in	ISO	RGD:1343347	1624291	PMID:24895913	RGD	PMID:24895913
Ddah1	Rat	negative regulation of cell population proliferation	involved_in	IEA	UniProtKB:O94760\|ensembl:ENSP00000284031	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ddah1	Rat	negative regulation of cellular response to hypoxia	involved_in	ISO	RGD:1343347	1624291	PMID:24895913	RGD	PMID:24895913
Ddah1	Rat	negative regulation of cellular response to hypoxia	involved_in	IEA	UniProtKB:O94760\|ensembl:ENSP00000284031	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ddah1	Rat	negative regulation of vascular permeability	involved_in	ISO	RGD:1343347	1624291	PMID:24895913	RGD	PMID:24895913
Ddah1	Rat	negative regulation of vascular permeability	involved_in	IEA	UniProtKB:O94760\|ensembl:ENSP00000284031	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ddah1	Rat	positive regulation of angiogenesis		IMP		727432		RGD
Ddah1	Rat	positive regulation of nitric oxide biosynthetic process		IMP		727432		RGD
Ddah1	Rat	positive regulation of nitric oxide biosynthetic process	involved_in	IEA	UniProtKB:Q9CWS0\|ensembl:ENSMUSP00000029845	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ddah1	Rat	positive regulation of nitric oxide biosynthetic process	involved_in	ISO	RGD:736772	1624291	PMID:21493890	RGD	PMID:21493890
Ddah1	Rat	positive regulation of nitric oxide biosynthetic process	involved_in	IBA	MGI:1916469\|PANTHER:PTN000978164\|RGD:70968\|UniProtKB:P56965\|UniProtKB:Q3SX44	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ddah1	Rat	regulation of systemic arterial blood pressure	involved_in	ISO	RGD:736772	1624291	PMID:21493890	RGD	PMID:21493890
Ddah1	Rat	regulation of systemic arterial blood pressure	involved_in	IEA	UniProtKB:Q9CWS0\|ensembl:ENSMUSP00000029845	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddah1	Rat	amino acid binding		IDA		1625578		RGD
Ddah1	Rat	amino acid binding	enables	IBA	PANTHER:PTN000978164\|RGD:70968	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ddah1	Rat	dimethylargininase activity		TAS		70711		RGD
Ddah1	Rat	dimethylargininase activity	enables	IEA	RHEA:17305	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Ddah1	Rat	dimethylargininase activity	enables	IEA	UniProtKB:O94760\|ensembl:ENSP00000284031	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ddah1	Rat	dimethylargininase activity	enables	IEA	EC:3.5.3.18	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Ddah1	Rat	dimethylargininase activity	enables	IBA	MGI:1916469\|PANTHER:PTN000978164\|RGD:70968\|UniProtKB:O94760\|UniProtKB:P56965	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ddah1	Rat	dimethylargininase activity	enables	IEA	UniProtKB:Q9CWS0\|ensembl:ENSMUSP00000029845	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ddah1	Rat	dimethylargininase activity	enables	ISO	RGD:736772	1624291	MGI:5424370 PMID:21493890, PMID:37296100	RGD	PMID:21493890\|PMID:37296100
Ddah1	Rat	dimethylargininase activity	enables	ISO	RGD:1343347	1624291	PMID:19663506, PMID:37296100	RGD	PMID:19663506\|PMID:37296100
Ddah1	Rat	dimethylargininase activity	enables	ISS	UniProtKB:O94760	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ddah1	Rat	dimethylargininase activity		IDA		1625578		RGD
Ddah1	Rat	dimethylargininase activity		IDA		727432		RGD
Ddah1	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ddah1	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ddah1	Rat	increased aorta wall thickness	exacerbates	IMP	XCO:0000642	151347602		RGD
Ddah1	Rat	increased aorta wall thickness	induces	IMP		151347602	compared to wild type	RGD
Ddah1	Rat	increased heart right ventricle weight	exacerbates	IMP	XCO:0000642	151347602		RGD
Ddah1	Rat	increased right ventricle systolic pressure	induces	IMP	XCO:0000642	151347602	compared to wild type	RGD
Ddah1	Rat	oxidative stress	exacerbates	IMP	XCO:0000642	151347602		RGD
Ddah1	Rat	pulmonary fibrosis	induces	IMP	XCO:0000642	151347602	compared to wild type	RGD

Disease Annotations Click to see Annotation Detail View

cardiovascular system disease (ISO)

coronary artery disease (ISO)

hypertension (ISO)

liver disease (ISO)

Pulmonary Arterial Hypertension (IMP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1-nitropropane (EXP)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,3,4,7,8-Pentachlorodibenzofuran (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-diaminotoluene (EXP)

2,4-dinitrotoluene (EXP)

2,6-diaminotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-acetamidofluorene (EXP)

2-nitro-p-phenylenediamine (EXP)

2-nitrofluorene (EXP)

2-nitropropane (EXP)

3,4-methylenedioxymethamphetamine (EXP)

3-chloropropane-1,2-diol (EXP)

3H-1,2-dithiole-3-thione (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP)

4-acetylaminofluorene (EXP)

4-amino-2,6-dinitrotoluene (EXP)

4-hydroxyphenyl retinamide (ISO)

4-nitro-1,2-phenylenediamine (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

Allylamine (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

butan-1-ol (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chromium trinitrate (ISO)

chromium(6+) (ISO)

chrysene (ISO)

cisplatin (ISO)

clofibrate (EXP)

cobalt dichloride (EXP,ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (ISO)

diethylstilbestrol (EXP)

dioxygen (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

ethanol (ISO)

flavonoids (EXP)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

glyphosate (ISO)

hydroquinone (ISO)

indometacin (EXP)

inulin (ISO)

irbesartan (EXP)

ivermectin (ISO)

lead diacetate (EXP,ISO)

lead(0) (ISO)

maneb (ISO)

manganese atom (ISO)

manganese(0) (ISO)

melatonin (EXP)

methamphetamine (EXP)

methapyrilene (EXP)

methotrexate (EXP)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

N-nitrosodimethylamine (EXP)

N-nitrosomorpholine (EXP)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP)

nitrobenzenes (EXP)

p-toluidine (EXP)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

paroxetine (ISO)

perfluorododecanoic acid (EXP)

perfluorooctane-1-sulfonic acid (EXP,ISO)

phenobarbital (EXP,ISO)

phenylmercury acetate (ISO)

pioglitazone (ISO)

piperonyl butoxide (EXP)

pirinixic acid (EXP,ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (ISO)

propiconazole (ISO)

ranitidine (EXP)

rotenone (EXP)

sarin (EXP)

SB 431542 (ISO)

simvastatin (EXP)

sodium arsenite (EXP,ISO)

sulforaphane (ISO)

taurine (ISO)

temozolomide (ISO)

Tesaglitazar (EXP)

tetrachloromethane (EXP,ISO)

tetraphene (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

triphenyl phosphate (EXP)

valproic acid (ISO)

venlafaxine hydrochloride (EXP)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

arginine catabolic process (IEA,ISO)

arginine metabolic process (IBA,IDA)

citrulline metabolic process (IBA,IEA,ISO,ISS)

negative regulation of cell population proliferation (IEA,ISO)

negative regulation of cellular response to hypoxia (IEA,ISO)

negative regulation of vascular permeability (IEA,ISO)

positive regulation of angiogenesis (IMP)

positive regulation of nitric oxide biosynthetic process (IBA,IEA,IMP,ISO)

regulation of systemic arterial blood pressure (IEA,ISO)

Molecular Function

amino acid binding (IBA,IDA)

dimethylargininase activity (IBA,IDA,IEA,ISO,ISS,TAS)

hydrolase activity (IEA)

metal ion binding (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

increased aorta wall thickness (IMP)

increased heart right ventricle weight (IMP)

increased right ventricle systolic pressure (IMP)

oxidative stress (IMP)

pulmonary fibrosis (IMP)

References

References - curated

#	Reference Title	Reference Citation
1.	AGXT2 and DDAH-1 genetic variants are highly correlated with serum ADMA and SDMA levels and with incidence of coronary artery disease in Egyptians.	Amir M, etal., Mol Biol Rep. 2018 Dec;45(6):2411-2419. doi: 10.1007/s11033-018-4407-1. Epub 2018 Oct 3.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Cloning and sequencing of cDNA encoding NG,NG-dimethylarginine dimethylaminohydrolase from rat kidney.	Kimoto M, etal., Biochim Biophys Acta 1997 Jan 4;1337(1):6-10.
5.	Dimethylarginine dimethylaminohydrolase I enhances tumour growth and angiogenesis.	Kostourou V, etal., Br J Cancer 2002 Sep 9;87(6):673-80.
6.	Gene Data Set	MGD Curation, June 12, 2002
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Roles of accumulated endogenous nitric oxide synthase inhibitors, enhanced arginase activity, and attenuated nitric oxide synthase activity in endothelial cells for pulmonary hypertension in rats.	Sasaki A, etal., Am J Physiol Lung Cell Mol Physiol. 2007 Jun;292(6):L1480-7. Epub 2007 Feb 23.
12.	DDAH gene and cardiovascular risk.	Valkonen VP, etal., Vasc Med. 2005 Jul;10 Suppl 1:S45-8.
13.	Dimethylarginine dimethylaminohydrolase 1 deficiency aggravates monocrotaline-induced pulmonary oxidative stress, pulmonary arterial hypertension and right heart failure in rats.	Wang D, etal., Int J Cardiol. 2019 Nov 15;295:14-20. doi: 10.1016/j.ijcard.2019.07.078. Epub 2019 Jul 27.

Additional References at PubMed

PMID:14766200	PMID:15256062	PMID:16533509	PMID:16959216	PMID:17409314	PMID:17673667	PMID:17909098	PMID:18614015	PMID:19056867	PMID:19156866	PMID:19481782	PMID:19528264
PMID:19663506	PMID:21408057	PMID:21493890	PMID:21590769	PMID:22785485	PMID:22995517	PMID:23376485	PMID:23533145	PMID:24455716	PMID:24895913	PMID:25013773	PMID:26375520
PMID:29263339	PMID:29513072	PMID:29721731	PMID:31870966	PMID:33574439	PMID:35509834	PMID:37116560

Genomics

Comparative Map Data

Ddah1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	237,327,812 - 237,460,624 (+)	NCBI		GRCr8
mRatBN7.2	2	234,667,499 - 234,800,322 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	234,667,491 - 234,799,339 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	242,465,212 - 242,597,798 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	240,356,099 - 240,488,167 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	235,222,839 - 235,355,419 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	251,634,368 - 251,766,009 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	251,634,431 - 251,766,014 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	270,160,842 - 270,289,319 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	243,932,221 - 244,069,832 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	243,918,960 - 244,056,573 (+)	NCBI
Celera	2	226,655,820 - 226,787,619 (+)	NCBI		Celera
Cytogenetic Map	2	q44	NCBI

DDAH1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	85,318,485 - 85,578,200 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	85,318,481 - 85,578,363 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	85,784,168 - 86,043,883 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	85,556,756 - 85,703,411 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	85,496,189 - 85,642,844	NCBI
Celera	1	84,028,261 - 84,288,153 (-)	NCBI		Celera
Cytogenetic Map	1	p22.3	NCBI
HuRef	1	83,894,842 - 84,154,833 (-)	NCBI		HuRef
CHM1_1	1	85,899,643 - 86,159,483 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	85,159,290 - 85,419,019 (-)	NCBI		T2T-CHM13v2.0

Ddah1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	145,464,447 - 145,600,032 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	145,464,430 - 145,600,032 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	145,758,692 - 145,894,277 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	145,758,675 - 145,894,277 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	145,421,656 - 145,557,241 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	145,696,113 - 145,829,059 (+)	NCBI		MGSCv36	mm8
Celera	3	152,212,383 - 152,347,807 (+)	NCBI		Celera
Cytogenetic Map	3	H2	NCBI
cM Map	3	70.63	NCBI

Ddah1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955423	8,636,756 - 8,676,790 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955423	8,637,116 - 8,673,881 (+)	NCBI	ChiLan1.0	ChiLan1.0

DDAH1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	141,354,493 - 141,614,910 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	140,509,872 - 140,770,243 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	117,875,875 - 118,136,304 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	86,732,327 - 86,991,596 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

DDAH1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	62,548,852 - 62,683,687 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	62,549,152 - 62,683,729 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	65,198,038 - 65,332,811 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	63,091,600 - 63,223,617 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	63,092,081 - 63,223,617 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	62,619,548 - 62,750,820 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	62,587,035 - 62,721,493 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	63,093,978 - 63,228,831 (+)	NCBI		UU_Cfam_GSD_1.0

Ddah1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	95,908,280 - 96,043,352 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936608	262,445 - 397,762 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936608	262,653 - 397,753 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DDAH1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	130,579,729 - 130,617,531 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	130,485,305 - 130,617,534 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	143,081,555 - 143,209,100 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DDAH1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	47,788,410 - 48,031,868 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	47,891,289 - 48,032,343 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	69,777,494 - 70,020,724 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ddah1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624742	12,026,248 - 12,170,147 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624742	12,027,450 - 12,170,003 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ddah1
1101 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	191
Count of miRNA genes:	130
Interacting mature miRNAs:	158
Transcripts:	ENSRNOT00000045016
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631563	Hcuc3	Hepatic copper content QTL 3	3.87		liver copper amount (VT:0003065)	liver copper weight to liver dry weight ratio (CMO:0001512)	2	229059610	249053267	Rat
1331767	Hrtrt12	Heart rate QTL 12	3.373		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	218414747	240841241	Rat
8693697	Alc36	Alcohol consumption QTL 36	2	0.592	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	217139753	236660713	Rat
1298075	Scl17	Serum cholesterol level QTL 17	3.4		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	211744537	249053267	Rat
2293833	Kiddil8	Kidney dilation QTL 8	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	219753301	247136170	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	200990457	245990457	Rat
2298479	Eau5	Experimental allergic uveoretinitis QTL 5		0.0021	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	2	202446871	237938339	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	214226044	247136170	Rat
7207490	Bss111	Bone structure and strength QTL 111	6.4		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	2	211744537	249053267	Rat
7207484	Bss108	Bone structure and strength QTL 108	5.3		femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	2	211744537	249053267	Rat
2313073	Bmd75	Bone mineral density QTL 75	4.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	2	215377404	237938339	Rat
8693622	Alc26	Alcohol consumption QTL 26	2.4	0.667	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	2	221136523	241305619	Rat
7411555	Bw132	Body weight QTL 132		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	223389739	249053267	Rat
9587428	Epfw6	Epididymal fat weight QTL 6	7.47	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	2	223389739	249053267	Rat
7207482	Bss107	Bone structure and strength QTL 107	7		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	2	211744537	249053267	Rat
2293844	Kiddil7	Kidney dilation QTL 7	3.5		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	219753301	247136170	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat
1549836	Bss2	Bone structure and strength QTL 2	7.5		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	2	211744537	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
2317885	Alcrsp28	Alcohol response QTL 28	2.1	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	212828222	249053267	Rat

Markers in Region

D2Got166

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	234,670,004 - 234,670,280 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	251,636,874 - 251,637,149	NCBI	Rnor6.0
Rnor_5.0	2	270,163,348 - 270,163,623	UniSTS	Rnor5.0
RGSC_v3.4	2	243,934,775 - 243,935,051	RGD	RGSC3.4
RGSC_v3.4	2	243,934,776 - 243,935,051	UniSTS	RGSC3.4
RGSC_v3.1	2	243,921,515 - 243,921,791	RGD
Celera	2	226,658,326 - 226,658,601	UniSTS
Cytogenetic Map	2	q44	UniSTS

RH140029

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	234,798,808 - 234,799,010 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	251,764,496 - 251,764,697	NCBI	Rnor6.0
Rnor_5.0	2	270,288,789 - 270,288,990	UniSTS	Rnor5.0
RGSC_v3.4	2	244,069,535 - 244,069,736	UniSTS	RGSC3.4
Celera	2	226,787,089 - 226,787,290	UniSTS
Cytogenetic Map	2	q44	UniSTS

Genetic Models

This gene Ddah1 is modified in the following models/strains:

SD-Ddah1^em1Ywxu

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022297	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017591068	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063282450	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000045016 ⟹ ENSRNOP00000044971

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	234,667,491 - 234,799,339 (+)	Ensembl
Rnor_6.0 Ensembl	2	251,634,431 - 251,766,014 (+)	Ensembl

RefSeq Acc Id:

NM_022297 ⟹ NP_071633

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	237,327,812 - 237,459,641 (+)	NCBI
mRatBN7.2	2	234,667,499 - 234,799,339 (+)	NCBI
Rnor_6.0	2	251,634,368 - 251,765,026 (+)	NCBI
Rnor_5.0	2	270,160,842 - 270,289,319 (+)	NCBI
RGSC_v3.4	2	243,932,221 - 244,069,832 (+)	RGD
Celera	2	226,655,820 - 226,787,619 (+)	RGD

Sequence:

show sequence

GGAGCCGCCGGGCGCTCGCAGGCTCGCAGGCTCGCAGGTTGGGCGCGCGCTGCTCTCGGGAAGA
CCCGGCCACCGAGCCAAACCCCGCCGCCGCCTCTCCGCGCGAGCCATGGCCGGCCTCAGCCACC
CCTCGGTCTTCGGCCGGGCCACCCACGCCGTGGTGCGGGCTCCGCCCGAGTCCCTGTGCCGCCA
CGCGCTGAGGCGCTCCCAGGGCGAAGAGGTGGATTTCGCTCGCGCTGAGCGCCAGCACCAGCTC
TACGTGGGCGTGCTGGGCAGCAAGCTGGGGCTGCAGGTGGTGCAGCTGCCGGCCGACGAGAGCC
TGCCTGACTGCGTGTTCGTGGAGGACGTGGCCGTGGTGTGCGAGGAGACCGCCCTCATCACCCG
CCCCGGGGCGCCTAGCCGCAGGAAGGAGGTTGACATGATGAAAGAGGCTTTGGAAAAACTTCAG
CTCAACATAGTAGAGATGAAAGATGAAAATGCAACCTTAGATGGTGGGGACGTCCTATTCACAG
GCAGAGAGTTTTTTGTGGGCCTTTCCAAAAGGACAAATCAACGAGGTGCTGAGATCTTGGCTGA
TACTTTCAAGGACTACGCAGTTTCCACAGTCCCCGTGGCCGATTCTTTGCATTTAAAGAGTTTC
TGCAGCATGGCTGGCCCCAACCTGATCGCAATAGGGTCCAGTGAATCTGCGCAGAAGGCCCTCA
AGATCATGCAACAGATGAGTGACCACCGTTATGACAAGCTCACTGTACCGGACGACATGGCCGC
CAACTGTATATATTTAAATATCCCCAGCAAAGGGCATGTCTTGCTGCACCGAACCCCAGAAGAG
TACCCAGAAAGCGCAAAGGTTTATGAGAAGCTCAAGGACCATCTACTGATCCCTGTGAGCAATT
CTGAGATGGAAAAGGTGGACGGCTTGCTCACCTGCTGCTCCGTTTTTATTAACAAGAAGACAGA
CTCTTGAGCGGAAGAGTCCCTCCCGAGCGGCCGGCGAGTGGCCTAGGCCAGGCTGATGATGGCT
CTGTACCCATTCCTCCTGTTTCCTTTGACAATCTACTGTGCCACTAACTCTTGTTTACAAAGAA
TTCCAATCTTAATCGCCTCATTTCCCCACACCCCCCTCTTCCTCACGGGGCCCCCTAACCTGTG
CACACATTTGCTCAATGAACTAAGCAACCTAGGAAATACAGAACTAACGAATCATTGGAATGTG
ATTGATAGCGTGGAGGCACTCACTCCAGCCTCTGTGTCCTTAGTGTGGGAATAGTTTAGATGCA
GGGCATCCTGAAGGACTGACCTCCTGGGCAGACAGATAAACAAGCAAGGGACTTTCTTTGCTTC
ATGAGTTGCGTTTGGTTCCTGTGAGAGTCCTGAGAACGTGGATTTTTTCCCATTCCCCTCTCTT
CTCACCTCTAAAACACTTTCTTCCAGGTCTTCCTTTGGCCTTCCTCACTTCTTTCGTAATCACC
TTGAACCTGGATTTATCCAAGGTCTCGAACTCTGGATACCCTCCTAACGTCCACCCTGTCTACG
TGCAGTCCTCTCCTCCTCACAGCCACAACTTCTGCCACCACCAGCAAATCAGAGTGGCTGGTTG
GAGACGAGGAACCTCACAGAGGCACATCCTGACAGGGTTTCCCATTAGCACACCTAGGAAGGTA
AATTCAGGTGGTTGATACAGGATGTTAGATACAGAAGCCTAGAAACACCCCCATGGGTACATCT
CAGAGAGACTGAGTCACTGCCATGATTTTGCCTCATGACTGGTCCTATAGGAGCGTGGAGGAAA
GTCTTTCTCCACCCCACCACCTCCCCCTTTTTCAGCTTCCTTCTGACTCAACCTTGTATCTACC
CCCTTAGAATCACCATGATTTTGAAAAGTCATTTCCTTCAAAAGAGGCAGAACATCTAATGATT
GTTGACGGTCTGGTAAGAGCTAGAGGGAACTGCCTCCACCCAAGGCCTAGGAGCACAATCAGGA
AATGGTTCCTAAAGTCAACTTCAAACAATGTGTGAGTCTCCTTTGAAATATCCATGACTGTTTA
CTGTGGAATTCAACCGAAACTTCAAATTACACAACTTTCANNAGACGCAGGTCTCTCACAGGGA
ACAATACCACAGCAAAGGAATTCCTTTCTTGAAAGCTGAAACAGGCCAAGGACATGGTACCTTA
CAAGGCACGGTGACCCAGCCAGGCATCTCATCAAACTTCTGGTCACTTCTACCTTGGCTGTATA
GCCTGCAGTCTGTCATTCGATATTTAAAGTTGGGGAGACAAAGGCTATGTCAGCTCTAGCTCTC
CTTACCTCTCTTTGTGATCAGTGTTTCTTCTAGTGAAGGCAAGAGAGACTGGGCCTCATCTCGT
CCCCCTCAGTGGCCGGAAGTGAGAAAATCAAGACTTCCTTTACCGCCCTTCTCTTAGTTGGCAA
CCTCTCTGAAGAGGTCTCCATCTCTCCCTTGCTGTCTAACTCTAGACTCATATCGCATGCCAAT
ATCTAACTGTACACCCTGTGAATGAACCATATCCTGGTCACTGTCACATTTCACAGCGTATCAC
AGGTGAACAGTTATGCCTTCTCCAGGGCAAGGGAATATGAGACAGTTGCCTAAATTCATAAAGA
AAAATTGTTCTCAGCCATTATGGTTGCCTTGAGGGGTTAAAGTTGACCCCACCTACACTAGC

hide sequence

RefSeq Acc Id:

XM_017591068 ⟹ XP_017446557

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	237,345,379 - 237,460,624 (+)	NCBI
mRatBN7.2	2	234,684,993 - 234,800,322 (+)	NCBI
Rnor_6.0	2	251,651,493 - 251,766,009 (+)	NCBI

Sequence:

show sequence

CCCGCTGTCGGGACAGAAATGCCCTAGTTGCACTCTAGTTGAAACCGCAAAATCCTCAGGACTA
TGGAGTCTGACCTCCCTCCCCTCCTCTCTCTGGGGATCTCTATGGTCTCCCTGCCCATTTATCT
ATAAGTTAAGCTGATAACAACTTGTGGTCAACCTGAGTCTCATGGGCCTAGATTAATTTGTTGA
GCCAAGCAAACACCTCGAGCCATCAGTAGCTGGGCAGACGTAGCACACCGGGTTTAGCACGGTT
CCCCAGTCTGGATTCTGTCGGGTTAGTTTCAGGGTTCAAAGGCCAAGTTGGTTTTCTTAGAGTG
GCGAGTCAGCACAGAGGCATGGTTTTGAACGTAGTCAGACAGTGCCTCACGCATTTCTGGCCCC
TTCCTGCTGTGCAAATCCAAACACCCAAGAGTTGTGTAAGACAAAGAGACCACAGTATCGCCGT
CTTCTTTCTTGAAACTCAACAATGATGTCCTTTCTCTCCCTCCTGTTAAAAGCTGGGCCGCCCC
CTGGTGAAATATTGTTATCTAAAACCACTGCTGTAGGGAGAGTGGACATAAACGAAGGAAAGGG
ACAAAGGGAAGGCAGAAGAAGAGAGGAGAGGGACCCGCTAAAAGAAACCCTGACAGTGTCTACT
CAGAAACGTGGTTGACATGATGAAAGAGGCTTTGGAAAAACTTCAGCTCAACATAGTAGAGATG
AAAGATGAAAATGCAACCTTAGATGGTGGGGACGTCCTATTCACAGGCAGAGAGTTTTTTGTGG
GCCTTTCCAAAAGGACAAATCAACGAGGTGCTGAGATCTTGGCTGATACTTTCAAGGACTACGC
AGTTTCCACAGTCCCCGTGGCCGATTCTTTGCATTTAAAGAGTTTCTGCAGCATGGCTGGCCCC
AACCTGATCGCAATAGGGTCCAGTGAATCTGCGCAGAAGGCCCTCAAGATCATGCAACAGATGA
GTGACCACCGTTATGACAAGCTCACTGTACCGGACGACATGGCCGCCAACTGTATATATTTAAA
TATCCCCAGCAAAGGGCATGTCTTGCTGCACCGAACCCCAGAAGAGTACCCAGAAAGCGCAAAG
GTTTATGAGAAGCTCAAGGACCATCTACTGATCCCTGTGAGCAATTCTGAGATGGAAAAGGTGG
ACGGCTTGCTCACCTGCTGCTCCGTTTTTATTAACAAGAAGACAGACTCTTGAGCGGAAGAGTC
CCTCCCGAGCGGCCGGCGAGTGGCCTAGGCCAGGCTGATGATGGCTCTGTACCCATTCCTCCTG
TTTCCTTTGACAATCTACTGTGCCACTAACTCTTGTTTACAAAGAATTCCAATCTTAATCGCCT
CATTTCCCCACACCCCCCTCTTCCTCACGGGGCCCCCTAACCTGTGCACACATTTGCTCAATGA
ACTAAGCAACCTAGGAAATACAGAACTAACGAATCATTGGAATGTGATTGATAGCGTGGAGGCA
CTCACTCCAGCCTCTGTGTCCTTAGTGTGGGAATAGTTTAGATGCAGGGCATCCTGAAGGACTG
ACCTCCTGGGCAGACAGATAAACAAGCAAGGGACTTTCTTTGCTTCATGAGTTGCGTTTGGTTC
CTGTGAGAGTCCTGAGAACGTGGATTTTTTCCCATTCCCCTCTCTTCTCACCTCTAAAACACTT
TCTTCCAGGTCTTCCTTTGGCCTTCCTCACTTCTTTCGTAATCACCTTGAACCTGGATTTATCC
AAGGTCTCGAACTCTGGATACCCTCCTAACGTCCACCCTGTCTACGTGCAGTCCTCTCCTCCTC
ACAGCCACAACTTCTGCCACCACCAGCAAATCAGAGTGGCTGGTTGGAGACGAGGGACCTCACA
GAGGCACATCCTGACAGGGTTTCCCATTAGCACACCTAGGAAGGTAAATTCAGGTGGTTGATAC
AGGATGTTAGATACAGAAGCCTAGAAACACCCCCATGGGTACATCTCAGAGAGACTGAGTCACT
GCCATGATTTTGCCTCATGACTGGTCCTATAGGAGCGTGGAGGAAAGTCTTTCTCCACCCCACC
ACCTCCCCCTTTTTCAGCTTCCTTCTGACTCAACCTTGTATCTACCCCCTTAGAATCACCATGA
TTTTGAAAAGTCATTTCCTTCAAAAAAAGGCAGAACATCTAATGATTGTTGACGGTCTGGTAAG
AGCTAGAGGGAACTGCCTCCACCCAAGGCCTAGGAGCACAATCAGGAAATGGTTCCTAAAGTCA
ACTTCAAACAATGTGTGAGTCTCCTTTGAAATATCCATGACTGTTTACTGTGGAATTCAACCGA
AACTTCAAATTACACAACTTTCAGCAGACGCAGGTCTCTCACAGGGAACAATACCACAGCAAAG
GAATTCCTTTCTTGAAAGCTGAAACAGGCCAAGGACATGGTACCTTACAAGGCACGGTGACCCA
GCCAGGCATCTCATCAAACTTCTGGTCACTTCTACCTTGGCTGTATAGCCTGCAGTCTGTCATT
CGATATTTAAAGTTGGGGAGACAAAGGCTATGTCAGCTCTAGCTCTCCTTACCTCTCTTTGTGA
TCAGTGTTTCTTCTAGTGAAGGCAAGAGAGACTGGGCCTCATCTCGTCCCCCTCAGTGGCCGGA
AGTGAGAAAATCAAGACTTCCTTTACCGCCCTTCTCTTAGTTGGCAACCTCTCTGAAGAGGTCT
CCATCTCTCCCTTGCTGTCTAACTCTAGACTCATATCGCATGCCAATATCTAACTGTACACCCT
GTGAATGAACCATATCCTGGTCACTGTCACATTTCACAGCGTATCACAGGTGAACAGTTATGCC
TTCTCCAGGGCAAGGGAATATGAGACAGTTGCCTAAATTCATAAAGAAAAATTGTTCTCAGCCA
TTATGGTTGCCTTGAGGGGTTAAAGTTGACCCCACCTACACTAGCAAAAAAAAAAAATTCTTAA
TTGTGGGAAGTGACCATCTCAAAATCAACCACAGGAAAAACAGCCCACTCTACACATACCAGCA
TATAATTGTCACTGACGCCTCTTCTATCATCCCGGTTCCAGAACTGTCCTCAATGATATTTAGT
CAATTACAAGGGATTAGGTTTCTTTCATGGTGACAGTTTCTTCTACCAAAGGTGGCTTTCCATT
CCCCTTTCCTTTTGCATCCCTCTTTCCTTGTTTGTCCTGAGAAATTGACGAGAGTCCCTGCCTC
CTCCCCATCTTATTCTGCTCTTGGACTCCCTGTGTGATACAGTGATGTGAAAACTCAAAATACA
TGCAGCACGGCTCCTGTGAGGTCCTCATCAGCGTGATGAAAGGGAAAGATGTCTTTACCCAAGT
TCCCTTTGTGTCTCACGGAGACGGGAAGACTAACAAGAAGGCTTCTTAACATCGTAAAGACATG
AGTTCCGTTGAACTAAGTATATAGGTTGGGTTAGAATGAACGGGTCCATGTGGGTTGGTCTAGT
GAAGAGATGAGCTAGATGCAATGTGTCATTTAGCGTTATGTCTTTAACCGGTGGGCTGCTGTAA
GAATCGGTGGCAGTTCTCTCTCTGCCGTGTGTTAATTGCTCTGGAACGCTACTAGGACCCGAAT
ACTAAGGCCACATCTCTACGTCTCTAAGAAGGGGAAATAAGATAGGCTTTAGTCTCACAGTGTG
GCCTAGGTGGGGTTGCATGTTACTCCCTAACACGCTACAGAATTCAGACATAGTTTCTGTGTGG
TGGTAGGTCTGTGCTTTTTTTATCGTCTTGCCTGCCATCTTCCAGCCAGTGTATGGTTTATCCA
GTCTGTGTGCCAAAGCCAGCCATGTCTCCCACGACCCGTTAGTCCAGAGGAGTTCTGCCCCAAC
ACTAGTTTCCAGCTGCCCACTCCTAATGTACACCAATCAAGACAGAATAAAATTTGAGTTGTTC
GGTG

hide sequence

RefSeq Acc Id:

XM_063282450 ⟹ XP_063138520

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	237,418,023 - 237,460,624 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_071633	(Get FASTA)	NCBI Sequence Viewer
	XP_017446557	(Get FASTA)	NCBI Sequence Viewer
	XP_063138520	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL82408	(Get FASTA)	NCBI Sequence Viewer
	EDL82409	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000044971
	ENSRNOP00000044971.3
GenBank Protein	O08557	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071633 ⟸ NM_022297

- UniProtKB:

O08557 (UniProtKB/Swiss-Prot), A6HWC2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAGLSHPSVFGRATHAVVRAPPESLCRHALRRSQGEEVDFARAERQHQLYVGVLGSKLGLQVVQ
LPADESLPDCVFVEDVAVVCEETALITRPGAPSRRKEVDMMKEALEKLQLNIVEMKDENATLDG
GDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVPVADSLHLKSFCSMAGPNLIAIGSSE
SAQKALKIMQQMSDHRYDKLTVPDDMAANCIYLNIPSKGHVLLHRTPEEYPESAKVYEKLKDHL
LIPVSNSEMEKVDGLLTCCSVFINKKTDS

hide sequence

RefSeq Acc Id:	XP_017446557 ⟸ XM_017591068
- Peptide Label:	isoform X1
- UniProtKB:	A6HWC3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MMKEALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADTFKDYAVSTVP VADSLHLKSFCSMAGPNLIAIGSSESAQKALKIMQQMSDHRYDKLTVPDDMAANCIYLNIPSKG HVLLHRTPEEYPESAKVYEKLKDHLLIPVSNSEMEKVDGLLTCCSVFINKKTDS hide sequence

Ensembl Acc Id:

ENSRNOP00000044971 ⟸ ENSRNOT00000045016

RefSeq Acc Id:	XP_063138520 ⟸ XM_063282450
- Peptide Label:	isoform X2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O08557-F1-model_v2	AlphaFold	O08557	1-285	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691809

Promoter ID:

EPDNEW_R2334

Type:

initiation region

Name:

Ddah1_1

Description:

dimethylarginine dimethylaminohydrolase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	251,634,348 - 251,634,408	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:70968	AgrOrtholog
BioCyc Gene	G2FUF-50919	BioCyc
Ensembl Genes	ENSRNOG00000014613	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000045016	ENTREZGENE
	ENSRNOT00000045016.5	UniProtKB/Swiss-Prot
Gene3D-CATH	L-arginine/glycine Amidinotransferase, Chain A	UniProtKB/Swiss-Prot
InterPro	DDAH	UniProtKB/Swiss-Prot
KEGG Report	rno:64157	UniProtKB/Swiss-Prot
NCBI Gene	64157	ENTREZGENE
PANTHER	PTHR12737	UniProtKB/Swiss-Prot
	PTHR12737:SF17	UniProtKB/Swiss-Prot
Pfam	DDAH_eukar	UniProtKB/Swiss-Prot
PhenoGen	Ddah1	PhenoGen
RatGTEx	ENSRNOG00000014613	RatGTEx
Superfamily-SCOP	Pentein	UniProtKB/Swiss-Prot
UniProt	A6HWC2	ENTREZGENE, UniProtKB/TrEMBL
	A6HWC3	ENTREZGENE, UniProtKB/TrEMBL
	DDAH1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-07-09	Ddah1	dimethylarginine dimethylaminohydrolase 1			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_function	catalyzes the conversion of N(G), N(G)-dimethyl-L-arginine and H(2)O to dimethylamine and L-citrulline	70711
gene_mutations_overexpression	overexpression induces increased nitric oxide synthesis and angiogenesis	727432
gene_protein	protein is 285 amino acids with a M(r) of 3,1414	727432

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD

Mammalian Phenotype