Symbol:
Actn1
Name:
actinin, alpha 1
RGD ID:
70907
Description:
Enables cytoskeletal regulatory protein binding activity and protein domain specific binding activity. Predicted to be involved in several processes, including actin cytoskeleton organization; focal adhesion assembly; and platelet formation. Located in actin cytoskeleton; dendritic spine; and plasma membrane. Is active in postsynaptic actin cytoskeleton. Human ortholog(s) of this gene implicated in platelet-type bleeding disorder 15. Orthologous to human ACTN1 (actinin alpha 1); PARTICIPATES IN E-cadherin signaling pathway; syndecan signaling pathway; arrhythmogenic right ventricular cardiomyopathy pathway; INTERACTS WITH (R)-adrenaline; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
alpha-actinin cytoskeletal isoform; alpha-actinin-1; F-actin cross-linking protein; non-muscle alpha-actinin 1; non-muscle alpha-actinin-1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ACTN1 (actinin alpha 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):
Actn1 (actinin, alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Actn1 (actinin alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ACTN1 (actinin alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ACTN1 (actinin alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Actn1 (actinin alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ACTN1 (actinin alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ACTN1 (actinin alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Actn1 (actinin alpha 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ACTN4 (actinin alpha 4) HGNC
OrthoDB
Homo sapiens (human):
NTN5 (netrin 5) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
ACTN1 (actinin alpha 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Mus musculus (house mouse):
Actn1 (actinin, alpha 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
actn1 (actinin, alpha 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Actn
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
atn-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
actn1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Allele / Splice:
Actn1_v3
Actn1_v2
Actn1_v1
Candidate Gene For:
Uae22
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 104,731,485 - 104,826,312 (-) NCBI GRCr8 mRatBN7.2 6 98,998,553 - 99,093,334 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 98,998,556 - 99,093,251 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 99,420,854 - 99,515,776 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 99,719,945 - 99,814,871 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 99,099,910 - 99,194,634 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 103,376,557 - 103,470,497 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 103,375,799 - 103,470,555 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 116,056,248 - 116,149,471 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 103,188,593 - 103,282,873 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 103,192,048 - 103,286,329 NCBI Celera 6 97,355,796 - 97,450,012 (-) NCBI Celera Cytogenetic Map 6 q24 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Actn1 Rat (1->4)-beta-D-glucan multiple interactions ISO Actn1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ACTN1 mRNA CTD PMID:36331819 Actn1 Rat (R)-adrenaline increases expression EXP 6480464 Epinephrine results in increased expression of ACTN1 protein CTD PMID:19464573 Actn1 Rat 1,2-dimethylhydrazine multiple interactions ISO Actn1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of ACTN1 mRNA] CTD PMID:22206623 Actn1 Rat 1,2-dimethylhydrazine increases expression ISO Actn1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of ACTN1 mRNA CTD PMID:22206623 Actn1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of ACTN1 mRNA CTD PMID:25380136 Actn1 Rat 17alpha-ethynylestradiol multiple interactions ISO Actn1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of ACTN1 mRNA CTD PMID:17942748 Actn1 Rat 17alpha-ethynylestradiol increases expression ISO Actn1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of ACTN1 mRNA CTD PMID:17942748 Actn1 Rat 17beta-estradiol multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of ACTN1 mRNA CTD PMID:30165855 Actn1 Rat 17beta-estradiol increases expression ISO ACTN1 (Homo sapiens) 6480464 Estradiol results in increased expression of ACTN1 mRNA CTD PMID:31614463 Actn1 Rat 17beta-estradiol decreases expression ISO Actn1 (Mus musculus) 6480464 Estradiol results in decreased expression of ACTN1 mRNA CTD PMID:39298647 Actn1 Rat 2,3,3',4,4',5,5'-Heptachlorobiphenyl decreases expression ISO ACTN1 (Homo sapiens) 6480464 2 more ... CTD PMID:26238599 Actn1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Actn1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of ACTN1 mRNA more ... CTD PMID:16214954 more ... Actn1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ACTN1 mRNA CTD PMID:34747641 Actn1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Actn1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of ACTN1 mRNA CTD PMID:15034205 more ... Actn1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Actn1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ACTN1 mRNA CTD PMID:21570461 Actn1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Actn1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ACTN1 mRNA and Tetrachlorodibenzodioxin results in decreased expression of ACTN1 protein CTD PMID:21354282 Actn1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Actn1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Actn1 Rat 2,6-dimethoxyphenol multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [pyrogallol 1 and 3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization of ACTN1 protein CTD PMID:38598786 Actn1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ACTN1 mRNA CTD PMID:21346803 Actn1 Rat 2-nitrotoluene decreases expression EXP 6480464 2-nitrotoluene results in decreased expression of ACTN1 mRNA CTD PMID:16460773 Actn1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of ACTN1 mRNA and alpha-Chlorohydrin results in increased expression of ACTN1 protein CTD PMID:26072098 and PMID:28522335 Actn1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ACTN1 mRNA CTD PMID:28628672 Actn1 Rat 4,4'-diaminodiphenylmethane increases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of ACTN1 mRNA CTD PMID:25380136 Actn1 Rat 4,4'-sulfonyldiphenol increases methylation ISO Actn1 (Mus musculus) 6480464 bisphenol S results in increased methylation of ACTN1 promoter CTD PMID:33297965 Actn1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Actn1 (Mus musculus) 6480464 bisphenol S affects the methylation of ACTN1 gene CTD PMID:31683443 Actn1 Rat 4,4'-sulfonyldiphenol increases expression ISO ACTN1 (Homo sapiens) 6480464 bisphenol S results in increased expression of ACTN1 protein CTD PMID:34186270 Actn1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Actn1 (Mus musculus) 6480464 bisphenol S results in decreased expression of ACTN1 mRNA CTD PMID:39298647 Actn1 Rat 4-hydroxynon-2-enal affects binding ISO ACTN1 (Homo sapiens) 6480464 ACTN1 protein binds to 4-hydroxy-2-nonenal CTD PMID:20043646 Actn1 Rat 4-hydroxyphenyl retinamide increases expression ISO Actn1 (Mus musculus) 6480464 Fenretinide results in increased expression of ACTN1 mRNA CTD PMID:28973697 Actn1 Rat 5-aza-2'-deoxycytidine affects methylation ISO ACTN1 (Homo sapiens) 6480464 Decitabine affects the methylation of ACTN1 gene CTD PMID:17630775 Actn1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ACTN1 mRNA CTD PMID:30047161 Actn1 Rat 7,12-dimethyltetraphene multiple interactions EXP 6480464 [9 more ... CTD PMID:22248470 Actn1 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:22248470 Actn1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of ACTN1 mRNA CTD PMID:31881176 Actn1 Rat acrolein multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of ACTN1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of ACTN1 mRNA CTD PMID:32699268 Actn1 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of ACTN1 mRNA CTD PMID:33354967 Actn1 Rat all-trans-retinoic acid multiple interactions ISO Actn1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of ACTN1 mRNA CTD PMID:30951980 Actn1 Rat allethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of ACTN1 protein CTD PMID:34896426 Actn1 Rat alpha-pinene multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of ACTN1 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in decreased expression of ACTN1 mRNA CTD PMID:32699268 Actn1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ACTN1 mRNA CTD PMID:16483693 Actn1 Rat androgen antagonist multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ACTN1 mRNA CTD PMID:25607892 Actn1 Rat aristolochic acid A increases expression ISO ACTN1 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of ACTN1 protein CTD PMID:33212167 Actn1 Rat arsane affects methylation ISO ACTN1 (Homo sapiens) 6480464 Arsenic affects the methylation of ACTN1 gene CTD PMID:25304211 Actn1 Rat arsenic atom affects methylation ISO ACTN1 (Homo sapiens) 6480464 Arsenic affects the methylation of ACTN1 gene CTD PMID:25304211 Actn1 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of ACTN1 gene CTD PMID:35440735 Actn1 Rat Azoxymethane multiple interactions ISO Actn1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ACTN1 mRNA CTD PMID:29950665 Actn1 Rat azoxystrobin decreases expression ISO ACTN1 (Homo sapiens) 6480464 azoxystrobin results in decreased expression of ACTN1 mRNA CTD PMID:33512557 Actn1 Rat benzo[a]pyrene decreases expression ISO ACTN1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ACTN1 mRNA and Benzo(a)pyrene results in decreased expression of ACTN1 protein CTD PMID:20064835 more ... Actn1 Rat benzo[a]pyrene increases expression ISO ACTN1 (Homo sapiens) 6480464 Benzo(a)pyrene metabolite results in increased expression of ACTN1 mRNA and Benzo(a)pyrene results in increased expression of ACTN1 mRNA CTD PMID:26314263 and PMID:32234424 Actn1 Rat benzo[a]pyrene decreases expression ISO Actn1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of ACTN1 mRNA CTD PMID:15034205 and PMID:19770486 Actn1 Rat benzo[a]pyrene increases expression ISO Actn1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of ACTN1 mRNA CTD PMID:22228805 Actn1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO ACTN1 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Actn1 Rat beta-lapachone decreases expression ISO ACTN1 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of ACTN1 mRNA CTD PMID:38218311 Actn1 Rat beta-lapachone increases expression ISO ACTN1 (Homo sapiens) 6480464 beta-lapachone results in increased expression of ACTN1 mRNA CTD PMID:38218311 Actn1 Rat bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of ACTN1 mRNA CTD PMID:20920545 Actn1 Rat bis(2-ethylhexyl) phthalate affects methylation ISO Actn1 (Mus musculus) 6480464 Diethylhexyl Phthalate affects the methylation of ACTN1 gene CTD PMID:38833407 Actn1 Rat bis(2-ethylhexyl) phthalate increases expression ISO ACTN1 (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of ACTN1 mRNA CTD PMID:31163220 Actn1 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ACTN1 mRNA CTD PMID:25607892 Actn1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ACTN1 mRNA CTD PMID:25607892 Actn1 Rat bisphenol A decreases expression ISO Actn1 (Mus musculus) 6480464 bisphenol A results in decreased expression of ACTN1 mRNA and bisphenol A results in decreased expression of ACTN1 protein CTD PMID:35999755 and PMID:37105096 Actn1 Rat bisphenol A decreases expression ISO ACTN1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of ACTN1 protein CTD PMID:33376534 and PMID:34186270 Actn1 Rat bisphenol A increases expression ISO ACTN1 (Homo sapiens) 6480464 bisphenol A results in increased expression of ACTN1 protein CTD PMID:37567409 Actn1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ACTN1 mRNA CTD PMID:33296240 Actn1 Rat bisphenol A multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [ginger extract results in increased abundance of Oils more ... CTD PMID:28628672 and PMID:33376534 Actn1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of ACTN1 mRNA CTD PMID:25181051 Actn1 Rat bisphenol AF increases expression ISO ACTN1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of ACTN1 protein CTD PMID:34186270 Actn1 Rat Bisphenol B increases expression ISO ACTN1 (Homo sapiens) 6480464 bisphenol B results in increased expression of ACTN1 protein CTD PMID:34186270 Actn1 Rat bisphenol F multiple interactions ISO Actn1 (Mus musculus) 6480464 [bisphenol F co-treated with Tretinoin] results in decreased expression of ACTN1 mRNA CTD PMID:30951980 Actn1 Rat bisphenol F increases expression ISO ACTN1 (Homo sapiens) 6480464 bisphenol F results in increased expression of ACTN1 protein CTD PMID:34186270 Actn1 Rat bleomycin A2 decreases expression EXP 6480464 Bleomycin results in decreased expression of ACTN1 protein CTD PMID:25933445 Actn1 Rat bromochloroacetic acid decreases expression EXP 6480464 bromochloroacetic acid results in decreased expression of ACTN1 mRNA CTD PMID:16460773 Actn1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of ACTN1 mRNA CTD PMID:24136188 Actn1 Rat Butylparaben multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ACTN1 mRNA CTD PMID:25607892 Actn1 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of ACTN1 mRNA CTD PMID:33453195 Actn1 Rat caffeine increases phosphorylation ISO ACTN1 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of ACTN1 protein CTD PMID:35688186 Actn1 Rat cannabidiol affects methylation EXP 6480464 Cannabidiol affects the methylation of ACTN1 gene CTD PMID:30521419 Actn1 Rat carbamazepine affects expression ISO ACTN1 (Homo sapiens) 6480464 Carbamazepine affects the expression of ACTN1 mRNA CTD PMID:25979313 Actn1 Rat carbon nanotube increases expression ISO Actn1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Actn1 Rat carmustine decreases expression ISO ACTN1 (Homo sapiens) 6480464 Carmustine results in decreased expression of ACTN1 mRNA CTD PMID:15980968 Actn1 Rat carnosic acid increases expression ISO Actn1 (Mus musculus) 6480464 salvin results in increased expression of ACTN1 protein CTD PMID:35926579 Actn1 Rat chloropicrin affects expression ISO ACTN1 (Homo sapiens) 6480464 chloropicrin affects the expression of ACTN1 mRNA CTD PMID:26352163 Actn1 Rat chromium(6+) decreases expression ISO ACTN1 (Homo sapiens) 6480464 chromium hexavalent ion results in decreased expression of ACTN1 protein CTD PMID:28596144 Actn1 Rat cisplatin multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [Cisplatin results in decreased susceptibility to Cisplatin] which results in increased expression of ACTN1 mRNA CTD PMID:30871063 Actn1 Rat clofibrate increases expression ISO Actn1 (Mus musculus) 6480464 Clofibrate results in increased expression of ACTN1 mRNA CTD PMID:17585979 Actn1 Rat cobalt dichloride decreases expression ISO ACTN1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of ACTN1 mRNA CTD PMID:19320972 Actn1 Rat cobalt dichloride increases expression ISO ACTN1 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of ACTN1 mRNA CTD PMID:26314263 Actn1 Rat copper(II) chloride increases expression ISO ACTN1 (Homo sapiens) 6480464 cupric chloride results in increased expression of ACTN1 mRNA CTD PMID:38568856 Actn1 Rat copper(II) sulfate increases expression ISO ACTN1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ACTN1 mRNA CTD PMID:19549813 Actn1 Rat corosolic acid increases expression ISO ACTN1 (Homo sapiens) 6480464 corosolic acid results in increased expression of ACTN1 mRNA CTD PMID:37939859 Actn1 Rat crocidolite asbestos decreases expression ISO ACTN1 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of ACTN1 mRNA CTD PMID:29523930 Actn1 Rat cyclosporin A decreases expression ISO ACTN1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ACTN1 mRNA CTD PMID:22147139 Actn1 Rat cyclosporin A increases expression ISO ACTN1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of ACTN1 mRNA CTD PMID:25562108 Actn1 Rat cyhalothrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of ACTN1 protein CTD PMID:34896426 Actn1 Rat cypermethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of ACTN1 protein CTD PMID:34896426 Actn1 Rat cyproconazole decreases expression ISO ACTN1 (Homo sapiens) 6480464 cyproconazole results in decreased expression of ACTN1 mRNA CTD PMID:26238599 Actn1 Rat DDE multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ACTN1 mRNA CTD PMID:25607892 Actn1 Rat dexamethasone increases expression ISO Actn1 (Mus musculus) 6480464 Dexamethasone results in increased expression of ACTN1 mRNA CTD PMID:22733784 Actn1 Rat dexamethasone multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ACTN1 mRNA CTD PMID:28628672 Actn1 Rat dextran sulfate multiple interactions ISO Actn1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ACTN1 mRNA CTD PMID:29950665 Actn1 Rat diazinon increases methylation ISO ACTN1 (Homo sapiens) 6480464 Diazinon results in increased methylation of ACTN1 gene CTD PMID:22964155 Actn1 Rat Dibutyl phosphate affects expression ISO ACTN1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of ACTN1 mRNA CTD PMID:37042841 Actn1 Rat dibutyl phthalate increases expression ISO Actn1 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of ACTN1 mRNA CTD PMID:21266533 Actn1 Rat dibutyl phthalate multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ACTN1 mRNA CTD PMID:25607892 Actn1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of ACTN1 mRNA CTD PMID:21266533 Actn1 Rat diclofenac affects expression EXP 6480464 Diclofenac affects the expression of ACTN1 mRNA CTD PMID:19022234 Actn1 Rat dicrotophos increases expression ISO ACTN1 (Homo sapiens) 6480464 dicrotophos results in increased expression of ACTN1 mRNA CTD PMID:28302478 Actn1 Rat dieldrin affects expression EXP 6480464 Dieldrin affects the expression of ACTN1 mRNA CTD PMID:22546817 Actn1 Rat dimethylarsinic acid increases expression EXP 6480464 Cacodylic Acid results in increased expression of ACTN1 mRNA CTD PMID:17720352 Actn1 Rat dioxygen multiple interactions ISO Actn1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of ACTN1 mRNA CTD PMID:30529165 Actn1 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of ACTN1 mRNA CTD PMID:33729688 Actn1 Rat diuron increases expression EXP 6480464 Diuron results in increased expression of ACTN1 mRNA CTD PMID:21551480 Actn1 Rat dorsomorphin multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Actn1 Rat doxorubicin affects response to substance ISO ACTN1 (Homo sapiens) 6480464 ACTN1 protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Actn1 Rat doxorubicin increases expression ISO ACTN1 (Homo sapiens) 6480464 Doxorubicin results in increased expression of ACTN1 mRNA CTD PMID:29803840 Actn1 Rat elemental selenium increases expression ISO ACTN1 (Homo sapiens) 6480464 Selenium results in increased expression of ACTN1 mRNA CTD PMID:19244175 Actn1 Rat entinostat increases expression ISO ACTN1 (Homo sapiens) 6480464 entinostat results in increased expression of ACTN1 mRNA CTD PMID:27188386 Actn1 Rat enzacamene multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ACTN1 mRNA CTD PMID:25607892 Actn1 Rat enzyme inhibitor multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of ACTN1 protein CTD PMID:23301498 Actn1 Rat epoxiconazole multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ACTN1 mRNA CTD PMID:25607892 Actn1 Rat epoxiconazole decreases expression ISO Actn1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of ACTN1 mRNA CTD PMID:35436446 Actn1 Rat ethanol affects expression ISO Actn1 (Mus musculus) 6480464 Ethanol affects the expression of ACTN1 mRNA CTD PMID:30319688 Actn1 Rat fenamidone increases expression ISO Actn1 (Mus musculus) 6480464 fenamidone results in increased expression of ACTN1 mRNA CTD PMID:27029645 Actn1 Rat fenvalerate multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of ACTN1 protein CTD PMID:34896426 Actn1 Rat folic acid multiple interactions ISO Actn1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of ACTN1 mRNA] CTD PMID:22206623 Actn1 Rat folic acid decreases expression ISO Actn1 (Mus musculus) 6480464 Folic Acid results in decreased expression of ACTN1 mRNA CTD PMID:25629700 Actn1 Rat furfural multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [pyrogallol 1 and 3-dimethyl ether co-treated with Furaldehyde] results in decreased expression of and affects the localization of ACTN1 protein CTD PMID:38598786 Actn1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of ACTN1 mRNA CTD PMID:22061828 Actn1 Rat hydrogen peroxide multiple interactions ISO Actn1 (Mus musculus) 6480464 [Hydrogen Peroxide co-treated with N-(oxo-5 more ... CTD PMID:31494107 Actn1 Rat indometacin multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in decreased expression of ACTN1 mRNA CTD PMID:28628672 Actn1 Rat ionomycin multiple interactions EXP 6480464 Ionomycin promotes the reaction [CAMK2A protein binds to ACTN1 protein] CTD PMID:19217379 Actn1 Rat isoflavones multiple interactions EXP 6480464 [9 more ... CTD PMID:22248470 Actn1 Rat ivermectin decreases expression ISO ACTN1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of ACTN1 protein CTD PMID:32959892 Actn1 Rat lead(0) affects methylation ISO Actn1 (Mus musculus) 6480464 Lead affects the methylation of ACTN1 gene CTD PMID:38833407 Actn1 Rat lead(0) affects methylation ISO ACTN1 (Homo sapiens) 6480464 Lead affects the methylation of ACTN1 gene CTD PMID:31636367 Actn1 Rat leflunomide increases expression ISO ACTN1 (Homo sapiens) 6480464 leflunomide results in increased expression of ACTN1 mRNA CTD PMID:28988120 Actn1 Rat linuron multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ACTN1 mRNA CTD PMID:25607892 Actn1 Rat lipopolysaccharide multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of ACTN1 mRNA CTD PMID:35877022 Actn1 Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of ACTN1 protein CTD PMID:37182599 Actn1 Rat metformin increases expression EXP 6480464 Metformin results in increased expression of ACTN1 mRNA CTD PMID:19022234 Actn1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of ACTN1 mRNA CTD PMID:30047161 Actn1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of ACTN1 gene CTD PMID:35440735 Actn1 Rat methylmercury chloride increases expression ISO ACTN1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of ACTN1 mRNA CTD PMID:23179753 more ... Actn1 Rat methylmercury chloride multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACTN1 mRNA CTD PMID:27188386 Actn1 Rat methylmercury(1+) increases expression ISO ACTN1 (Homo sapiens) 6480464 methylmercury II results in increased expression of ACTN1 mRNA CTD PMID:26314263 Actn1 Rat microcystin-LR decreases expression EXP 6480464 cyanoginosin LR results in decreased expression of ACTN1 mRNA CTD PMID:36657700 Actn1 Rat Muraglitazar decreases expression EXP 6480464 muraglitazar results in decreased expression of ACTN1 mRNA CTD PMID:21515302 Actn1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of ACTN1 mRNA CTD PMID:25380136 Actn1 Rat ochratoxin A increases expression ISO ACTN1 (Homo sapiens) 6480464 ochratoxin A metabolite results in increased expression of ACTN1 mRNA and ochratoxin A results in increased expression of ACTN1 mRNA CTD PMID:26314263 Actn1 Rat oxycodone decreases expression EXP 6480464 Oxycodone results in decreased expression of ACTN1 mRNA CTD PMID:23439660 Actn1 Rat ozone multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in decreased expression of ACTN1 mRNA more ... CTD PMID:32699268 Actn1 Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of ACTN1 mRNA CTD PMID:35737395 Actn1 Rat ozone multiple interactions ISO Actn1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of ACTN1 mRNA CTD PMID:34911549 Actn1 Rat paracetamol affects expression ISO Actn1 (Mus musculus) 6480464 Acetaminophen affects the expression of ACTN1 mRNA CTD PMID:17562736 Actn1 Rat paracetamol increases expression ISO ACTN1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of ACTN1 mRNA CTD PMID:29067470 Actn1 Rat paracetamol increases expression ISO Actn1 (Mus musculus) 6480464 Acetaminophen results in increased expression of ACTN1 mRNA CTD PMID:29246445 Actn1 Rat paracetamol multiple interactions ISO Actn1 (Mus musculus) 6480464 PANX1 gene mutant form inhibits the reaction [Acetaminophen results in increased expression of ACTN1 mRNA] CTD PMID:29246445 Actn1 Rat paracetamol decreases expression ISO ACTN1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ACTN1 mRNA CTD PMID:21420995 Actn1 Rat paracetamol multiple interactions EXP 6480464 [bisphenol A co-treated with enzacamene co-treated with octylmethoxycinnamate co-treated with butylparaben co-treated with Androgen Antagonists co-treated with Acetaminophen] results in decreased expression of ACTN1 mRNA CTD PMID:25607892 Actn1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of ACTN1 mRNA CTD PMID:32680482 Actn1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Actn1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of ACTN1 mRNA CTD PMID:36331819 Actn1 Rat phenylmercury acetate increases expression ISO ACTN1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of ACTN1 mRNA CTD PMID:26272509 Actn1 Rat phenylmercury acetate multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ACTN1 mRNA CTD PMID:27188386 Actn1 Rat picoxystrobin decreases expression ISO ACTN1 (Homo sapiens) 6480464 picoxystrobin results in decreased expression of ACTN1 mRNA CTD PMID:33512557 Actn1 Rat potassium dichromate decreases expression ISO ACTN1 (Homo sapiens) 6480464 Potassium Dichromate results in decreased expression of ACTN1 protein CTD PMID:23718831 Actn1 Rat prochloraz multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ACTN1 mRNA CTD PMID:25607892 Actn1 Rat procymidone multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ACTN1 mRNA CTD PMID:25607892 Actn1 Rat progesterone decreases expression ISO ACTN1 (Homo sapiens) 6480464 Progesterone results in decreased expression of ACTN1 mRNA CTD PMID:18037150 Actn1 Rat prostaglandin A1 increases metabolic processing ISO Actn1 (Mus musculus) 6480464 prostaglandin A1 analog results in increased metabolism of ACTN1 protein CTD PMID:19800325 Actn1 Rat pyrethrins decreases expression EXP 6480464 Pyrethrins results in decreased expression of ACTN1 protein CTD PMID:34896426 Actn1 Rat quercitrin affects expression ISO ACTN1 (Homo sapiens) 6480464 quercitrin affects the expression of ACTN1 mRNA CTD PMID:25193878 Actn1 Rat resveratrol decreases expression ISO Actn1 (Mus musculus) 6480464 resveratrol results in decreased expression of ACTN1 protein CTD PMID:25505154 Actn1 Rat rotenone increases oxidation EXP 6480464 Rotenone results in increased oxidation of ACTN1 protein CTD PMID:30951809 Actn1 Rat rotenone decreases expression ISO ACTN1 (Homo sapiens) 6480464 Rotenone results in decreased expression of ACTN1 mRNA CTD PMID:33512557 Actn1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of ACTN1 mRNA CTD PMID:28374803 Actn1 Rat SB 431542 multiple interactions ISO ACTN1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Actn1 Rat selenium atom increases expression ISO ACTN1 (Homo sapiens) 6480464 Selenium results in increased expression of ACTN1 mRNA CTD PMID:19244175 Actn1 Rat silicon dioxide affects secretion ISO ACTN1 (Homo sapiens) 6480464 Silicon Dioxide analog affects the secretion of ACTN1 protein CTD PMID:25895662 Actn1 Rat sodium arsenate increases expression ISO Actn1 (Mus musculus) 6480464 sodium arsenate results in increased expression of ACTN1 mRNA CTD PMID:21795629 Actn1 Rat sodium arsenite increases expression ISO ACTN1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of ACTN1 mRNA CTD PMID:38568856 Actn1 Rat sodium arsenite decreases expression EXP 6480464 sodium arsenite results in decreased expression of ACTN1 protein CTD PMID:29459688 Actn1 Rat sodium fluoride increases expression ISO Actn1 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of ACTN1 protein CTD PMID:27548804 Actn1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of ACTN1 mRNA CTD PMID:19281266 Actn1 Rat starch multiple interactions EXP 6480464 Starch analog inhibits the reaction [Rapeseed Oil metabolite results in decreased expression of ACTN1 mRNA] CTD PMID:27363782 Actn1 Rat sulindac sulfide decreases expression ISO ACTN1 (Homo sapiens) 6480464 sulindac sulfide results in decreased expression of ACTN1 mRNA CTD PMID:16184548 Actn1 Rat tauroursodeoxycholic acid decreases expression EXP 6480464 ursodoxicoltaurine results in decreased expression of ACTN1 mRNA CTD PMID:15885361 Actn1 Rat tert-butyl hydroperoxide increases expression ISO ACTN1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of ACTN1 mRNA CTD PMID:15336504 Actn1 Rat tetrachloromethane increases expression ISO Actn1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of ACTN1 mRNA CTD PMID:17484886 Actn1 Rat thapsigargin decreases expression ISO ACTN1 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of ACTN1 mRNA CTD PMID:22378314 Actn1 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of ACTN1 protein CTD PMID:35544339 Actn1 Rat titanium dioxide increases expression ISO Actn1 (Mus musculus) 6480464 titanium dioxide results in increased expression of ACTN1 mRNA CTD PMID:27760801 Actn1 Rat titanium dioxide decreases methylation ISO Actn1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of ACTN1 gene CTD PMID:35295148 Actn1 Rat titanium dioxide decreases expression ISO ACTN1 (Homo sapiens) 6480464 titanium dioxide results in decreased expression of ACTN1 protein CTD PMID:30910687 Actn1 Rat titanium dioxide multiple interactions ISO Actn1 (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of ACTN1 mRNA CTD PMID:29950665 Actn1 Rat triadimefon decreases expression ISO ACTN1 (Homo sapiens) 6480464 triadimefon analog results in decreased expression of ACTN1 mRNA and triadimefon results in decreased expression of ACTN1 mRNA CTD PMID:26238599 Actn1 Rat tributylstannane increases expression ISO ACTN1 (Homo sapiens) 6480464 tributyltin results in increased expression of ACTN1 mRNA CTD PMID:26314263 Actn1 Rat Tributyltin oxide increases expression ISO ACTN1 (Homo sapiens) 6480464 bis(tri-n-butyltin)oxide results in increased expression of ACTN1 mRNA CTD PMID:26314263 Actn1 Rat triphenyl phosphate affects expression ISO ACTN1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of ACTN1 mRNA CTD PMID:37042841 Actn1 Rat troglitazone increases expression EXP 6480464 troglitazone results in increased expression of ACTN1 mRNA CTD PMID:19022234 Actn1 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of ACTN1 mRNA CTD PMID:21515302 Actn1 Rat ursodeoxycholic acid decreases expression EXP 6480464 Ursodeoxycholic Acid results in decreased expression of ACTN1 mRNA CTD PMID:15885361 Actn1 Rat valproic acid increases expression ISO ACTN1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of ACTN1 mRNA CTD PMID:23179753 Actn1 Rat valproic acid affects splicing EXP 6480464 Valproic Acid affects the splicing of ACTN1 mRNA CTD PMID:29427782 Actn1 Rat valproic acid increases methylation ISO ACTN1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of ACTN1 gene CTD PMID:29154799 Actn1 Rat vancomycin decreases expression ISO Actn1 (Mus musculus) 6480464 Vancomycin results in decreased expression of ACTN1 mRNA CTD PMID:18930951 Actn1 Rat vinclozolin multiple interactions EXP 6480464 [Dibutyl Phthalate co-treated with Diethylhexyl Phthalate co-treated with vinclozolin co-treated with prochloraz co-treated with procymidone co-treated with Linuron co-treated with epoxiconazole co-treated with Dichlorodiphenyl Dichloroethylene] results in decreased expression of ACTN1 mRNA CTD PMID:25607892 Actn1 Rat zoledronic acid decreases expression ISO ACTN1 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of ACTN1 protein CTD PMID:28871336
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(1->4)-beta-D-glucan (ISO) (R)-adrenaline (EXP) 1,2-dimethylhydrazine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,3',4,4',5,5'-Heptachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-dimethoxyphenol (ISO) 2,6-dinitrotoluene (EXP) 2-nitrotoluene (EXP) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) acetamide (EXP) acrolein (ISO) aflatoxin B1 (EXP) all-trans-retinoic acid (ISO) allethrin (EXP) alpha-pinene (ISO) ammonium chloride (EXP) androgen antagonist (EXP) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) atrazine (EXP) Azoxymethane (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bleomycin A2 (EXP) bromochloroacetic acid (EXP) buspirone (EXP) Butylparaben (EXP) cadmium dichloride (EXP) caffeine (ISO) cannabidiol (EXP) carbamazepine (ISO) carbon nanotube (ISO) carmustine (ISO) carnosic acid (ISO) chloropicrin (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibrate (ISO) cobalt dichloride (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) corosolic acid (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) cyhalothrin (EXP) cypermethrin (EXP) cyproconazole (ISO) DDE (EXP) dexamethasone (ISO) dextran sulfate (ISO) diazinon (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) diclofenac (EXP) dicrotophos (ISO) dieldrin (EXP) dimethylarsinic acid (EXP) dioxygen (EXP,ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) entinostat (ISO) enzacamene (EXP) enzyme inhibitor (ISO) epoxiconazole (EXP,ISO) ethanol (ISO) fenamidone (ISO) fenvalerate (EXP) folic acid (ISO) furfural (ISO) gentamycin (EXP) hydrogen peroxide (ISO) indometacin (ISO) ionomycin (EXP) isoflavones (EXP) ivermectin (ISO) lead(0) (ISO) leflunomide (ISO) linuron (EXP) lipopolysaccharide (ISO) Mesaconitine (EXP) metformin (EXP) methimazole (EXP) methoxychlor (EXP) methylmercury chloride (ISO) methylmercury(1+) (ISO) microcystin-LR (EXP) Muraglitazar (EXP) N-nitrosodimethylamine (EXP) ochratoxin A (ISO) oxycodone (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) paraquat (EXP) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) picoxystrobin (ISO) potassium dichromate (ISO) prochloraz (EXP) procymidone (EXP) progesterone (ISO) prostaglandin A1 (ISO) pyrethrins (EXP) quercitrin (ISO) resveratrol (ISO) rotenone (EXP,ISO) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium fluoride (ISO) Soman (EXP) starch (EXP) sulindac sulfide (ISO) tauroursodeoxycholic acid (EXP) tert-butyl hydroperoxide (ISO) tetrachloromethane (ISO) thapsigargin (EXP,ISO) titanium dioxide (ISO) triadimefon (ISO) tributylstannane (ISO) Tributyltin oxide (ISO) triphenyl phosphate (ISO) troglitazone (EXP) ursodeoxycholic acid (EXP) valproic acid (EXP,ISO) vancomycin (ISO) vinclozolin (EXP) zoledronic acid (ISO)
Cellular Component
actin cytoskeleton (IEA) actin filament (IEA,ISO) anchoring junction (IEA) bicellular tight junction (ISS) brush border (IEA,ISO) cell junction (IBA,IDA) cell leading edge (ISS) cell projection (IBA,IEA,ISO) cell-cell junction (IEA,ISO) cortical actin cytoskeleton (IBA,IDA) cytoplasm (IDA,IEA,ISO) cytoskeleton (IDA,IEA) cytosol (TAS) dendritic spine (IDA) dense body (ISS) fascia adherens (IEA,ISO) focal adhesion (IEA,ISO,ISS) glutamatergic synapse (IEA,ISO) inner dense plaque of desmosome (ISS) lamellipodium (ISS) lateral plasma membrane (ISS) membrane (IEA) outer dense plaque of desmosome (ISS) plasma membrane (IBA,IDA,IEA) postsynaptic actin cytoskeleton (IDA,IMP) ruffle (IEA,ISO,ISS) sarcolemma (ISS) sarcomere (IEA,ISO) smooth muscle dense body (ISS) stress fiber (IBA,IDA,IEA,ISO,ISS) synapse (IDA) terminal web (ISS) Z disc (IBA,IEA,ISO,ISS) zonula adherens (ISS)
Molecular Function
actin binding (IEA) actin filament binding (IBA,IEA,ISO) alpha-actinin binding (ISS) calcium ion binding (IEA) cytoskeletal regulatory protein binding (IPI) double-stranded RNA binding (IEA,ISO) integrin binding (IEA,ISO) metal ion binding (IEA) protein binding (IPI,ISO) protein domain specific binding (IPI) protein homodimerization activity (IEA,ISO,ISS) structural constituent of postsynapse (IEA,ISO) transcription coactivator activity (IEA,ISO) transmembrane transporter binding (IEA,ISO) vinculin binding (IEA,ISO,ISS)
1.
Protein interactions with the glucose transporter binding protein GLUT1CBP that provide a link between GLUT1 and the cytoskeleton.
Bunn RC, etal., Mol Biol Cell 1999 Apr;10(4):819-32.
2.
The cyclin-dependent kinase 5 activators p35 and p39 interact with the alpha-subunit of Ca2+/calmodulin-dependent protein kinase II and alpha-actinin-1 in a calcium-dependent manner.
Dhavan R, etal., J Neurosci. 2002 Sep 15;22(18):7879-91.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Brain-specific splicing of alpha-actinin 1 (ACTN1) mRNA.
Kremerskothen J, etal., Biochem Biophys Res Commun 2002 Jul 19;295(3):678-81.
6.
Postsynaptic recruitment of Dendrin depends on both dendritic mRNA transport and synaptic anchoring.
Kremerskothen J, etal., J Neurochem. 2006 Mar;96(6):1659-66. doi: 10.1111/j.1471-4159.2006.03679.x. Epub 2006 Feb 8.
7.
Growth cone morphology and spreading are regulated by a dynamin-cortactin complex at point contacts in hippocampal neurons.
Kurklinsky S, etal., J Neurochem. 2011 Apr;117(1):48-60. doi: 10.1111/j.1471-4159.2011.07169.x. Epub 2011 Feb 9.
8.
Alpha-actinin associates with polycystin-2 and regulates its channel activity.
Li Q, etal., Hum Mol Genet. 2005 Jun 15;14(12):1587-603. Epub 2005 Apr 20.
9.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
10.
CLP36 and RIL recruit a-actinin-1 to stress fibers and differentially regulate stress fiber dynamics in F2408 fibroblasts.
Miyazaki K, etal., Exp Cell Res. 2012 Aug 15;318(14):1716-25. doi: 10.1016/j.yexcr.2012.05.006. Epub 2012 May 30.
11.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.
Phosphorylation-dependent interactions of alpha-Actinin-1/IQGAP1 with the AMPA receptor subunit GluR4.
Nuriya M, etal., J Neurochem. 2005 Oct;95(2):544-52. doi: 10.1111/j.1471-4159.2005.03410.x.
13.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
14.
Involvement of LMO7 in the association of two cell-cell adhesion molecules, nectin and E-cadherin, through afadin and alpha-actinin in epithelial cells.
Ooshio T, etal., J Biol Chem 2004 Jul 23;279(30):31365-73. Epub 2004 May 12.
15.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
16.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
17.
GOA pipeline
RGD automated data pipeline
18.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
Expression and tissue localization of beta-catenin, alpha-actinin and chondroitin sulfate proteoglycan 6 is modulated during rat and human left ventricular hypertrophy.
Ridinger H, etal., Exp Mol Pathol. 2009 Feb;86(1):23-31. Epub 2008 Nov 27.
21.
[Organization of the activities of the medical-sanitary battalion]
Sherniakov MA Voen Med Zh 1978 Nov;(11):20-2.
22.
Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
23.
Pdlim2, a novel PDZ-LIM domain protein, interacts with alpha-actinins and filamin A.
Torrado M, etal., Invest Ophthalmol Vis Sci 2004 Nov;45(11):3955-63.
24.
The PDZ-LIM protein RIL modulates actin stress fiber turnover and enhances the association of alpha-actinin with F-actin.
Vallenius T, etal., Exp Cell Res 2004 Feb 1;293(1):117-28.
25.
Integrated Analysis of Multiple Microarray Studies to Identify Core Gene-Expression Signatures Involved in Tubulointerstitial Injury in Diabetic Nephropathy.
Zhou H, etal., Biomed Res Int. 2022 May 10;2022:9554658. doi: 10.1155/2022/9554658. eCollection 2022.
Actn1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 6 104,731,485 - 104,826,312 (-) NCBI GRCr8 mRatBN7.2 6 98,998,553 - 99,093,334 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 6 98,998,556 - 99,093,251 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 6 99,420,854 - 99,515,776 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 6 99,719,945 - 99,814,871 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 6 99,099,910 - 99,194,634 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 6 103,376,557 - 103,470,497 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 6 103,375,799 - 103,470,555 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 6 116,056,248 - 116,149,471 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 6 103,188,593 - 103,282,873 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 6 103,192,048 - 103,286,329 NCBI Celera 6 97,355,796 - 97,450,012 (-) NCBI Celera Cytogenetic Map 6 q24 NCBI
ACTN1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 14 68,874,128 - 68,979,302 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 14 68,874,123 - 68,979,440 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 14 69,340,845 - 69,446,019 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 14 68,410,793 - 68,515,709 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 14 68,410,792 - 68,515,709 NCBI Celera 14 49,401,716 - 49,506,993 (-) NCBI Celera Cytogenetic Map 14 q24.1 NCBI HuRef 14 49,510,917 - 49,616,121 (-) NCBI HuRef CHM1_1 14 69,279,215 - 69,384,488 (-) NCBI CHM1_1 T2T-CHM13v2.0 14 63,083,135 - 63,188,360 (-) NCBI T2T-CHM13v2.0
Actn1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 12 80,214,316 - 80,307,165 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 12 80,214,321 - 80,307,145 (-) Ensembl GRCm39 Ensembl GRCm38 12 80,167,542 - 80,260,420 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 12 80,167,547 - 80,260,371 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 12 81,268,529 - 81,361,358 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 12 81,086,387 - 81,179,156 (-) NCBI MGSCv36 mm8 Celera 12 81,632,311 - 81,725,181 (-) NCBI Celera Cytogenetic Map 12 C3 NCBI cM Map 12 36.49 NCBI
Actn1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955466 1,388,507 - 1,480,282 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955466 1,388,507 - 1,480,990 (+) NCBI ChiLan1.0 ChiLan1.0
ACTN1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 15 69,990,975 - 70,096,691 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 14 69,207,296 - 69,313,200 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 14 49,460,390 - 49,565,986 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 14 68,335,694 - 68,440,836 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 14 68,335,694 - 68,440,836 (-) Ensembl panpan1.1 panPan2
ACTN1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 8 42,714,806 - 42,808,318 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 8 42,712,142 - 42,808,323 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 8 42,404,474 - 42,497,710 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 8 42,945,028 - 43,038,491 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 8 42,945,037 - 43,038,504 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 8 42,559,338 - 42,652,710 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 8 42,634,268 - 42,727,356 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 8 42,993,500 - 43,086,762 (-) NCBI UU_Cfam_GSD_1.0
Actn1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 61,974,520 - 62,067,210 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936495 12,124,443 - 12,217,242 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936495 12,124,489 - 12,217,223 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ACTN1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 92,550,007 - 92,644,842 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 92,550,132 - 92,644,842 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 98,863,871 - 98,874,025 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ACTN1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 24 46,089,989 - 46,196,897 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 24 46,085,751 - 46,196,886 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666053 34,323,625 - 34,430,616 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Actn1
.
Assembly: RGSC_v3.4 Assembly: Rnor_6.0
Chromosome Start Pos End Pos Reference Nucleotide Variant Nucleotide Variant Type Strain Variant Page
6
103389945
103389946
C
G
snv
BN/SsN (MCW) View more Information
Predicted Target Of
Count of predictions: 64 Count of miRNA genes: 58 Interacting mature miRNAs: 63 Transcripts: ENSRNOT00000068522 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
12801411 Schws8 Schwannoma susceptibility QTL 8 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 94968928 139968928 Rat 1331799 Bp211 Blood pressure QTL 211 3.66407 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 72202632 130919985 Rat 634330 Pia16 Pristane induced arthritis QTL 16 3.9 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 6 45790088 104200226 Rat 1331789 Rf37 Renal function QTL 37 3.224 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 6 72202632 115200186 Rat 1331725 Bp212 Blood pressure QTL 212 3.52475 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 6 93701310 128713626 Rat 1331722 Thshl1 Thyroid stimulating hormone level QTL 1 11.7 0.0001 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 6 89762877 106752806 Rat 8552796 Vie3 Viral induced encephalitis QTL 3 2.6 brain integrity trait (VT:0010579) encephalitis incidence/prevalence measurement (CMO:0002361) 6 96833997 140994061 Rat 4145119 Mcs25 Mammary carcinoma susceptibility QTL 25 0.0001 mammary gland integrity trait (VT:0010552) ratio of deaths to total study population during a period of time (CMO:0001023) 6 10894415 110548006 Rat 70176 Mcsm1 Mammary carcinoma susceptibility modifier QTL 1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 58632962 103632962 Rat 1581563 Uae33 Urinary albumin excretion QTL 33 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 72227641 130729205 Rat 10054138 Gmadr3 Adrenal mass QTL 3 3.68 0.00045 adrenal gland mass (VT:0010420) both adrenal glands wet weight (CMO:0000164) 6 85140138 130140138 Rat 1558641 Cm47 Cardiac mass QTL 47 2.9 0.001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 6 57730540 104085867 Rat 61414 Pia3 Pristane induced arthritis QTL 3 4.5 joint integrity trait (VT:0010548) post-insult time to onset of experimental arthritis (CMO:0001450) 6 94968928 137848904 Rat 724524 Uae2 Urinary albumin excretion QTL 2 2.7 0.0005 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 73463459 109394713 Rat 737827 Hcar11 Hepatocarcinoma resistance QTL 11 4.4 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 6 82523650 110548006 Rat 1641904 Alcrsp4 Alcohol response QTL 4 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 6 67262953 112262953 Rat 724513 Uae14 Urinary albumin excretion QTL 14 6.5 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 85311061 133478515 Rat 2303624 Vencon5 Ventilatory control QTL 5 4.45 respiration trait (VT:0001943) minute ventilation (CMO:0000132) 6 88047916 133047916 Rat 1576309 Emca7 Estrogen-induced mammary cancer QTL 7 4 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 6 15107216 107351382 Rat 731173 Uae22 Urinary albumin excretion QTL 22 10.1 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 2293837 Kiddil1 Kidney dilation QTL 1 3.7 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 2293842 Kiddil3 Kidney dilation QTL 3 4.3 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 6 81132889 104393926 Rat 10054123 Srcrt6 Stress Responsive Cort QTL 6 2.5 0.0043 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 6 85140138 130140138 Rat 724536 Uae7 Urinary albumin excretion QTL 7 3.5 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 6 72202632 130729475 Rat 70196 BpQTLcluster7 Blood pressure QTL cluster 7 6.82 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 6 72202632 117202632 Rat 1581550 Pur8 Proteinuria QTL 8 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 6 72227641 130729205 Rat 1576302 Schws4 Schwannoma susceptibility QTL 4 0.0078 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 83190345 106747639 Rat 1300075 Glom7 Glomerulus QTL 7 5.6 0.0000002 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 6 71201409 116201409 Rat 738034 Anxrr5 Anxiety related response QTL 5 5.9 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 6 84130881 129130881 Rat 2290393 Uae37 Urinary albumin excretion QTL 37 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 6 65531555 140994061 Rat 12801471 Schws9 Schwannoma susceptibility QTL 9 nervous system integrity trait (VT:0010566) percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017) 6 61747639 106747639 Rat 6893332 Cm74 Cardiac mass QTL 74 0.4 0.64 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 6 57730540 104085867 Rat 1300076 Glom8 Glomerulus QTL 8 7 9e-09 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 6 86894788 131894788 Rat
C77473
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 98,998,858 - 98,998,992 (+) MAPPER mRatBN7.2 Rnor_6.0 6 103,376,175 - 103,376,308 NCBI Rnor6.0 Rnor_5.0 6 116,055,867 - 116,055,999 UniSTS Rnor5.0 RGSC_v3.4 6 103,188,211 - 103,188,344 UniSTS RGSC3.4 Celera 6 97,355,417 - 97,355,550 UniSTS Cytogenetic Map 6 q24 UniSTS
RH142024
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 99,000,729 - 99,000,918 (+) MAPPER mRatBN7.2 Rnor_6.0 6 103,378,046 - 103,378,234 NCBI Rnor6.0 Rnor_5.0 6 116,057,737 - 116,057,925 UniSTS Rnor5.0 RGSC_v3.4 6 103,190,082 - 103,190,270 UniSTS RGSC3.4 Celera 6 97,357,285 - 97,357,473 UniSTS RH 3.4 Map 6 692.1 UniSTS Cytogenetic Map 6 q24 UniSTS
BE119221
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 99,091,243 - 99,091,419 (+) MAPPER mRatBN7.2 Rnor_6.0 6 103,468,554 - 103,468,729 NCBI Rnor6.0 Rnor_5.0 6 116,147,528 - 116,147,703 UniSTS Rnor5.0 RGSC_v3.4 6 103,280,930 - 103,281,105 UniSTS RGSC3.4 Celera 6 97,448,069 - 97,448,244 UniSTS RH 3.4 Map 6 690.0 UniSTS Cytogenetic Map 6 q24 UniSTS
BE098731
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 6 99,094,236 - 99,094,390 (+) MAPPER mRatBN7.2 Rnor_6.0 6 103,471,547 - 103,471,700 NCBI Rnor6.0 Rnor_5.0 6 116,150,521 - 116,150,674 UniSTS Rnor5.0 RGSC_v3.4 6 103,283,923 - 103,284,076 UniSTS RGSC3.4 Celera 6 97,451,062 - 97,451,215 UniSTS RH 3.4 Map 6 711.3 UniSTS Cytogenetic Map 6 q24 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000079824 ⟹ ENSRNOP00000074946
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 98,998,559 - 99,093,245 (-) Ensembl Rnor_6.0 Ensembl 6 103,375,873 - 103,470,555 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000088795 ⟹ ENSRNOP00000069598
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 98,998,751 - 99,093,251 (-) Ensembl Rnor_6.0 Ensembl 6 103,376,557 - 103,470,501 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000091560 ⟹ ENSRNOP00000068851
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 98,998,556 - 99,093,031 (-) Ensembl Rnor_6.0 Ensembl 6 103,375,799 - 103,470,427 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000110416 ⟹ ENSRNOP00000097894
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 98,998,556 - 99,092,992 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111498 ⟹ ENSRNOP00000087449
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 99,000,287 - 99,092,992 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112260 ⟹ ENSRNOP00000085943
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 6 98,998,556 - 99,036,899 (-) Ensembl
RefSeq Acc Id:
NM_031005 ⟹ NP_112267
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 104,731,485 - 104,826,172 (-) NCBI mRatBN7.2 6 98,998,553 - 99,093,245 (-) NCBI Rnor_6.0 6 103,376,557 - 103,470,497 (-) NCBI Rnor_5.0 6 116,056,248 - 116,149,471 (-) NCBI RGSC_v3.4 6 103,188,593 - 103,282,873 (-) RGD Celera 6 97,355,796 - 97,450,012 (-) RGD
Sequence:
GAATTCGGCACGAGGTCAGCAGCAACCTCCTCGAGCAGAGCCGCGGCGGAAGCGGGCTCAGGGGAGCGAGCCCGGCCCCGCCAGCCCAGCCCAGCCCAGCCCAGCCCAGCCCAACCCTGCCGACTCCC
hide sequence
RefSeq Acc Id:
XM_039112992 ⟹ XP_038968920
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 104,731,488 - 104,826,222 (-) NCBI mRatBN7.2 6 98,998,556 - 99,093,334 (-) NCBI
RefSeq Acc Id:
XM_039112993 ⟹ XP_038968921
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 104,731,488 - 104,826,312 (-) NCBI mRatBN7.2 6 98,998,556 - 99,093,332 (-) NCBI
RefSeq Acc Id:
XM_063262548 ⟹ XP_063118618
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 104,731,488 - 104,825,744 (-) NCBI
RefSeq Acc Id:
XM_063262549 ⟹ XP_063118619
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 6 104,731,488 - 104,825,754 (-) NCBI
RefSeq Acc Id:
NP_112267 ⟸ NM_031005
- UniProtKB:
Q9Z1P2 (UniProtKB/Swiss-Prot), A0A8I6AV34 (UniProtKB/TrEMBL)
- Sequence:
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIW
hide sequence
Ensembl Acc Id:
ENSRNOP00000074946 ⟸ ENSRNOT00000079824
Ensembl Acc Id:
ENSRNOP00000068851 ⟸ ENSRNOT00000091560
Ensembl Acc Id:
ENSRNOP00000069598 ⟸ ENSRNOT00000088795
RefSeq Acc Id:
XP_038968920 ⟸ XM_039112992
- Peptide Label:
isoform X1
- UniProtKB:
Q6T487 (UniProtKB/TrEMBL), A0A8I6AV34 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038968921 ⟸ XM_039112993
- Peptide Label:
isoform X2
- UniProtKB:
Q6GMN8 (UniProtKB/TrEMBL), A0A8I6AV34 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000085943 ⟸ ENSRNOT00000112260
Ensembl Acc Id:
ENSRNOP00000087449 ⟸ ENSRNOT00000111498
Ensembl Acc Id:
ENSRNOP00000097894 ⟸ ENSRNOT00000110416
RefSeq Acc Id:
XP_063118619 ⟸ XM_063262549
- Peptide Label:
isoform X4
- UniProtKB:
A0A8I6GDI3 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063118618 ⟸ XM_063262548
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6GDI3 (UniProtKB/TrEMBL)
RGD ID: 13694699 Promoter ID: EPDNEW_R5221 Type: initiation region Name: Actn1_1 Description: actinin, alpha 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 6 103,470,564 - 103,470,624 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-07-09
Actn1
actinin, alpha 1
Symbol and Name updated to reflect Human and Mouse nomenclature
70877 APPROVED
Note Type
Note
Reference
gene_domains
has an N-terminal region containing two actin-binding motifs, a central four spectrin-like domain with the dimer forming sequence and a C-terminal domain with two EF hand motifs
625419
gene_expression
expressed in the adult brain, with highest in neurons of the hippocampus, cortex, and caudate putamen while the cerebellum and other subcortical structures showed low expression
625419
gene_expression
expressed in the adult rat brain
625419
