Symbol:
Qsox1
Name:
quiescin sulfhydryl oxidase 1
RGD ID:
68957
Description:
Enables FAD binding activity and flavin-dependent sulfhydryl oxidase activity. Predicted to be involved in extracellular matrix assembly; negative regulation of macroautophagy; and protein folding. Located in extracellular space. Orthologous to human QSOX1 (quiescin sulfhydryl oxidase 1); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
FAD-dependent sulfhydryl oxidase-2; Qscn6; Qsox; quiescin Q6; quiescin Q6 sulfhydryl oxidase 1; rQSOX; rSOx; Sox-2; sulfhydryl oxidase 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
QSOX1 (quiescin sulfhydryl oxidase 1) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Qsox1 (quiescin Q6 sulfhydryl oxidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Qsox1 (quiescin sulfhydryl oxidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
QSOX1 (quiescin sulfhydryl oxidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
QSOX1 (quiescin sulfhydryl oxidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Qsox1 (quiescin sulfhydryl oxidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
QSOX1 (quiescin sulfhydryl oxidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
QSOX1 (quiescin sulfhydryl oxidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Qsox1 (quiescin sulfhydryl oxidase 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
QSOX1 (quiescin sulfhydryl oxidase 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Qsox1 (quiescin Q6 sulfhydryl oxidase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
qsox1 (quiescin Q6 sulfhydryl oxidase 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F35G2.1
Alliance
DIOPT (OMA|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Qsox1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F47B7.2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
Qsox2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
Qsox3
Alliance
DIOPT (Ensembl Compara|Hieranoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
Qsox4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Caenorhabditis elegans (roundworm):
T10H10.2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
qsox1
Alliance
DIOPT (Ensembl Compara|Hieranoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 70,500,060 - 70,537,711 (-) NCBI GRCr8 mRatBN7.2 13 67,949,780 - 67,987,434 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 67,949,780 - 67,987,459 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 70,529,544 - 70,566,399 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 71,844,987 - 71,881,834 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 69,106,470 - 69,143,317 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 73,423,396 - 73,460,890 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 73,423,397 - 73,460,935 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 78,351,222 - 78,388,703 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 70,739,793 - 70,777,526 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 70,753,873 - 70,791,628 (-) NCBI Celera 13 67,815,702 - 67,852,956 (-) NCBI Celera Cytogenetic Map 13 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Qsox1 Rat (1->4)-beta-D-glucan multiple interactions ISO Qsox1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of QSOX1 mRNA CTD PMID:36331819 Qsox1 Rat 17beta-estradiol increases expression ISO Qsox1 (Mus musculus) 6480464 Estradiol results in increased expression of QSOX1 mRNA CTD PMID:15289156 and PMID:39298647 Qsox1 Rat 17beta-estradiol increases expression ISO QSOX1 (Homo sapiens) 6480464 Estradiol results in increased expression of QSOX1 mRNA CTD PMID:23019147 and PMID:31614463 Qsox1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl affects expression ISO QSOX1 (Homo sapiens) 6480464 2 more ... CTD PMID:20638727 Qsox1 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:31826744 Qsox1 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO QSOX1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Qsox1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Qsox1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in increased methylation of QSOX1 gene CTD PMID:21212295 Qsox1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of QSOX1 mRNA CTD PMID:32109520 and PMID:33387578 Qsox1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Qsox1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of QSOX1 mRNA CTD PMID:21570461 Qsox1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO QSOX1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of QSOX1 mRNA CTD PMID:20106945 and PMID:21632981 Qsox1 Rat 2,4,6-tribromophenol increases expression ISO QSOX1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Qsox1 Rat 2-hydroxypropanoic acid decreases expression ISO QSOX1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of QSOX1 mRNA CTD PMID:30851411 Qsox1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO QSOX1 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of QSOX1 protein CTD PMID:31675489 Qsox1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Qsox1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of QSOX1 mRNA CTD PMID:20188158 and PMID:26251327 Qsox1 Rat 4,4'-sulfonyldiphenol increases expression ISO Qsox1 (Mus musculus) 6480464 bisphenol S results in increased expression of QSOX1 mRNA CTD PMID:39298647 Qsox1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of QSOX1 mRNA CTD PMID:36041667 Qsox1 Rat 4,4'-sulfonyldiphenol affects methylation ISO Qsox1 (Mus musculus) 6480464 bisphenol S affects the methylation of QSOX1 gene CTD PMID:31683443 Qsox1 Rat 4,4'-sulfonyldiphenol increases methylation ISO Qsox1 (Mus musculus) 6480464 bisphenol S results in increased methylation of QSOX1 exon CTD PMID:33297965 Qsox1 Rat 5-fluorouracil multiple interactions ISO QSOX1 (Homo sapiens) 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of QSOX1 mRNA] CTD PMID:15016801 Qsox1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of QSOX1 mRNA CTD PMID:30047161 Qsox1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of QSOX1 mRNA CTD PMID:31881176 Qsox1 Rat acetochlor multiple interactions ISO QSOX1 (Homo sapiens) 6480464 [Herbicides results in increased abundance of acetochlor] which affects the methylation of QSOX1 gene CTD PMID:34516295 Qsox1 Rat acrylamide affects expression EXP 6480464 Acrylamide affects the expression of QSOX1 mRNA CTD PMID:28959563 Qsox1 Rat aflatoxin B1 increases expression ISO QSOX1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of QSOX1 mRNA CTD PMID:22100608 Qsox1 Rat aflatoxin B1 increases methylation ISO QSOX1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of QSOX1 gene CTD PMID:27153756 Qsox1 Rat all-trans-retinoic acid increases expression ISO QSOX1 (Homo sapiens) 6480464 Tretinoin results in increased expression of QSOX1 mRNA CTD PMID:33167477 Qsox1 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of QSOX1 mRNA CTD PMID:30047161 Qsox1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of QSOX1 mRNA CTD PMID:16483693 Qsox1 Rat arsane multiple interactions ISO QSOX1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of QSOX1 mRNA CTD PMID:39836092 Qsox1 Rat arsenic atom multiple interactions ISO QSOX1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of QSOX1 mRNA CTD PMID:39836092 Qsox1 Rat arsenite(3-) increases expression ISO Qsox1 (Mus musculus) 6480464 arsenite results in increased expression of QSOX1 mRNA CTD PMID:18191166 Qsox1 Rat arsenous acid decreases expression ISO QSOX1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of QSOX1 mRNA CTD PMID:19128835 Qsox1 Rat benzo[a]pyrene increases expression ISO Qsox1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of QSOX1 mRNA CTD PMID:21569818 Qsox1 Rat benzo[a]pyrene increases methylation ISO Qsox1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of QSOX1 exon and Benzo(a)pyrene results in increased methylation of QSOX1 intron CTD PMID:27901495 Qsox1 Rat benzo[a]pyrene affects methylation ISO QSOX1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of QSOX1 promoter CTD PMID:27901495 Qsox1 Rat benzo[a]pyrene increases expression ISO QSOX1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of QSOX1 mRNA CTD PMID:22316170 Qsox1 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of QSOX1 mRNA CTD PMID:31199487 Qsox1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Qsox1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of QSOX1 mRNA CTD PMID:33754040 Qsox1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of QSOX1 mRNA CTD PMID:25181051 Qsox1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of QSOX1 mRNA CTD PMID:36041667 Qsox1 Rat bisphenol A decreases expression ISO QSOX1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of QSOX1 protein CTD PMID:31675489 Qsox1 Rat bisphenol A increases expression ISO Qsox1 (Mus musculus) 6480464 bisphenol A results in increased expression of QSOX1 mRNA CTD PMID:33221593 Qsox1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of QSOX1 mRNA CTD PMID:32145629 and PMID:33296240 Qsox1 Rat bisphenol F increases expression ISO Qsox1 (Mus musculus) 6480464 bisphenol F results in increased expression of QSOX1 mRNA CTD PMID:38685157 Qsox1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of QSOX1 mRNA CTD PMID:36041667 Qsox1 Rat Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of QSOX1 mRNA CTD PMID:31199487 Qsox1 Rat C60 fullerene increases expression EXP 6480464 fullerene C60 results in increased expression of QSOX1 mRNA CTD PMID:19167457 Qsox1 Rat cadmium dichloride increases expression ISO QSOX1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of QSOX1 mRNA CTD PMID:38568856 Qsox1 Rat calcitriol increases expression ISO QSOX1 (Homo sapiens) 6480464 Calcitriol results in increased expression of QSOX1 mRNA CTD PMID:21592394 Qsox1 Rat calcitriol multiple interactions ISO QSOX1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of QSOX1 mRNA CTD PMID:21592394 Qsox1 Rat carbon nanotube increases expression ISO Qsox1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Qsox1 Rat carnosic acid decreases expression ISO Qsox1 (Mus musculus) 6480464 salvin results in decreased expression of QSOX1 protein CTD PMID:35926579 Qsox1 Rat CGP 52608 multiple interactions ISO QSOX1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to QSOX1 gene] CTD PMID:28238834 Qsox1 Rat chlordecone decreases expression ISO Qsox1 (Mus musculus) 6480464 Chlordecone results in decreased expression of QSOX1 mRNA CTD PMID:29980752 and PMID:33711761 Qsox1 Rat chloroprene increases expression ISO Qsox1 (Mus musculus) 6480464 Chloroprene results in increased expression of QSOX1 mRNA CTD PMID:23125180 Qsox1 Rat choline multiple interactions ISO Qsox1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of QSOX1 gene CTD PMID:20938992 Qsox1 Rat cisplatin decreases response to substance ISO QSOX1 (Homo sapiens) 6480464 QSOX1 protein results in decreased susceptibility to Cisplatin CTD PMID:16734730 Qsox1 Rat cisplatin decreases expression ISO QSOX1 (Homo sapiens) 6480464 Cisplatin results in decreased expression of QSOX1 mRNA CTD PMID:27392435 Qsox1 Rat clofibrate decreases expression ISO Qsox1 (Mus musculus) 6480464 Clofibrate results in decreased expression of QSOX1 mRNA CTD PMID:17585979 Qsox1 Rat copper atom multiple interactions ISO QSOX1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of QSOX1 mRNA CTD PMID:20971185 Qsox1 Rat copper(0) multiple interactions ISO QSOX1 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in increased expression of QSOX1 mRNA CTD PMID:20971185 Qsox1 Rat copper(II) chloride increases expression ISO QSOX1 (Homo sapiens) 6480464 cupric chloride results in increased expression of QSOX1 mRNA CTD PMID:38568856 Qsox1 Rat copper(II) sulfate increases expression ISO QSOX1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of QSOX1 mRNA CTD PMID:19549813 Qsox1 Rat corosolic acid increases expression ISO QSOX1 (Homo sapiens) 6480464 corosolic acid results in increased expression of QSOX1 mRNA CTD PMID:37939859 Qsox1 Rat corticosterone increases expression EXP 6480464 Corticosterone results in increased expression of QSOX1 mRNA CTD PMID:15755911 Qsox1 Rat cyclosporin A increases expression ISO QSOX1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of QSOX1 mRNA CTD PMID:20106945 and PMID:27989131 Qsox1 Rat decabromodiphenyl ether increases expression ISO QSOX1 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of QSOX1 protein CTD PMID:31675489 Qsox1 Rat diarsenic trioxide decreases expression ISO QSOX1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of QSOX1 mRNA CTD PMID:19128835 Qsox1 Rat dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of QSOX1 mRNA CTD PMID:31199487 Qsox1 Rat diclofenac increases expression ISO Qsox1 (Mus musculus) 6480464 Diclofenac results in increased expression of QSOX1 mRNA CTD PMID:26934552 Qsox1 Rat dicrotophos decreases expression ISO QSOX1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of QSOX1 mRNA CTD PMID:28302478 Qsox1 Rat diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of QSOX1 mRNA CTD PMID:31199487 Qsox1 Rat diethyl phthalate decreases expression EXP 6480464 diethyl phthalate results in decreased expression of QSOX1 mRNA CTD PMID:32341500 Qsox1 Rat diethylstilbestrol increases expression ISO Qsox1 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of QSOX1 mRNA CTD PMID:15289156 Qsox1 Rat diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of QSOX1 mRNA CTD PMID:31199487 Qsox1 Rat diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate co-treated with diisononyl phthalate co-treated with diisobutyl phthalate co-treated with butylbenzyl phthalate] results in decreased expression of QSOX1 mRNA CTD PMID:31199487 Qsox1 Rat dioxygen multiple interactions ISO Qsox1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of QSOX1 mRNA CTD PMID:30529165 Qsox1 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of QSOX1 mRNA CTD PMID:29391264 Qsox1 Rat epoxiconazole decreases expression ISO Qsox1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of QSOX1 mRNA CTD PMID:35436446 Qsox1 Rat ethanol affects splicing ISO Qsox1 (Mus musculus) 6480464 Ethanol affects the splicing of QSOX1 mRNA CTD PMID:30319688 Qsox1 Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of QSOX1 mRNA CTD PMID:30307764 Qsox1 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of QSOX1 mRNA CTD PMID:23962444 Qsox1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of QSOX1 mRNA CTD PMID:24793618 Qsox1 Rat folic acid multiple interactions ISO Qsox1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of QSOX1 gene CTD PMID:20938992 Qsox1 Rat formaldehyde increases expression ISO QSOX1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of QSOX1 mRNA CTD PMID:18045764 Qsox1 Rat gefitinib increases expression ISO QSOX1 (Homo sapiens) 6480464 gefitinib results in increased expression of QSOX1 mRNA CTD PMID:16685379 Qsox1 Rat genistein increases expression ISO Qsox1 (Mus musculus) 6480464 Genistein results in increased expression of QSOX1 mRNA CTD PMID:15289156 Qsox1 Rat genistein increases expression ISO QSOX1 (Homo sapiens) 6480464 Genistein results in increased expression of QSOX1 mRNA CTD PMID:20884965 and PMID:23019147 Qsox1 Rat genistein increases expression EXP 6480464 Genistein results in increased expression of QSOX1 mRNA CTD PMID:17341692 Qsox1 Rat graphene oxide increases expression ISO QSOX1 (Homo sapiens) 6480464 graphene oxide results in increased expression of QSOX1 protein CTD PMID:33219560 Qsox1 Rat herbicide multiple interactions ISO QSOX1 (Homo sapiens) 6480464 [Herbicides results in increased abundance of acetochlor] which affects the methylation of QSOX1 gene CTD PMID:34516295 Qsox1 Rat hydrogen cyanide decreases expression ISO Qsox1 (Mus musculus) 6480464 Hydrogen Cyanide results in decreased expression of QSOX1 mRNA CTD PMID:33914522 Qsox1 Rat hydrogen peroxide decreases expression ISO QSOX1 (Homo sapiens) 6480464 Hydrogen Peroxide results in decreased expression of QSOX1 mRNA CTD PMID:12419474 Qsox1 Rat inulin multiple interactions ISO Qsox1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of QSOX1 mRNA CTD PMID:36331819 Qsox1 Rat ketoconazole decreases expression ISO QSOX1 (Homo sapiens) 6480464 Ketoconazole results in decreased expression of QSOX1 mRNA CTD PMID:36621641 Qsox1 Rat L-methionine multiple interactions ISO Qsox1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation of QSOX1 gene CTD PMID:20938992 Qsox1 Rat lipopolysaccharide increases expression ISO Qsox1 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of QSOX1 mRNA CTD PMID:27339419 Qsox1 Rat lipopolysaccharide multiple interactions ISO Qsox1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Lipopolysaccharides] results in increased methylation of QSOX1 gene CTD PMID:21212295 Qsox1 Rat lipopolysaccharide increases methylation ISO Qsox1 (Mus musculus) 6480464 Lipopolysaccharides results in increased methylation of QSOX1 gene CTD PMID:21212295 Qsox1 Rat manganese atom multiple interactions ISO QSOX1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of QSOX1 mRNA CTD PMID:39836092 Qsox1 Rat manganese(0) multiple interactions ISO QSOX1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of QSOX1 mRNA CTD PMID:39836092 Qsox1 Rat manganese(II) chloride multiple interactions ISO QSOX1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of QSOX1 mRNA CTD PMID:39836092 Qsox1 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of QSOX1 mRNA CTD PMID:30047161 Qsox1 Rat methoxyacetic acid multiple interactions ISO QSOX1 (Homo sapiens) 6480464 methoxyacetic acid promotes the reaction [Promegestone results in increased expression of QSOX1 mRNA] CTD PMID:15103026 Qsox1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of QSOX1 gene CTD PMID:33148267 Qsox1 Rat naphthalene increases expression ISO Qsox1 (Mus musculus) 6480464 naphthalene results in increased expression of QSOX1 mRNA CTD PMID:18978301 Qsox1 Rat nickel atom decreases expression ISO QSOX1 (Homo sapiens) 6480464 Nickel results in decreased expression of QSOX1 mRNA CTD PMID:25583101 Qsox1 Rat nitrates multiple interactions ISO Qsox1 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of QSOX1 mRNA CTD PMID:35964746 Qsox1 Rat ozone multiple interactions ISO Qsox1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of QSOX1 mRNA CTD PMID:34911549 Qsox1 Rat paclitaxel decreases expression ISO QSOX1 (Homo sapiens) 6480464 Paclitaxel results in decreased expression of QSOX1 mRNA CTD PMID:15000894 Qsox1 Rat paracetamol affects expression ISO Qsox1 (Mus musculus) 6480464 Acetaminophen affects the expression of QSOX1 mRNA CTD PMID:17562736 Qsox1 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of QSOX1 mRNA CTD PMID:33387578 Qsox1 Rat paraquat decreases expression ISO QSOX1 (Homo sapiens) 6480464 Paraquat results in decreased expression of QSOX1 protein CTD PMID:34064677 Qsox1 Rat parathion decreases expression ISO Qsox1 (Mus musculus) 6480464 Parathion results in decreased expression of QSOX1 mRNA CTD PMID:34813904 Qsox1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Qsox1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of QSOX1 mRNA more ... CTD PMID:36331819 Qsox1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in increased methylation of QSOX1 gene CTD PMID:33148267 Qsox1 Rat phenethyl isothiocyanate increases expression EXP 6480464 phenethyl isothiocyanate results in increased expression of QSOX1 mRNA CTD PMID:17616710 Qsox1 Rat pirinixic acid decreases expression ISO Qsox1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of QSOX1 mRNA CTD PMID:23811191 Qsox1 Rat potassium cyanide increases expression ISO Qsox1 (Mus musculus) 6480464 Potassium Cyanide results in increased expression of QSOX1 mRNA CTD PMID:33914522 Qsox1 Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of QSOX1 mRNA CTD PMID:20726854 Qsox1 Rat promegestone multiple interactions ISO QSOX1 (Homo sapiens) 6480464 methoxyacetic acid promotes the reaction [Promegestone results in increased expression of QSOX1 mRNA] CTD PMID:15103026 Qsox1 Rat promegestone increases expression ISO QSOX1 (Homo sapiens) 6480464 Promegestone results in increased expression of QSOX1 mRNA CTD PMID:15103026 Qsox1 Rat propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of QSOX1 mRNA CTD PMID:30047161 Qsox1 Rat quercetin increases expression ISO QSOX1 (Homo sapiens) 6480464 Quercetin results in increased expression of QSOX1 mRNA CTD PMID:21632981 Qsox1 Rat rac-lactic acid decreases expression ISO QSOX1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of QSOX1 mRNA CTD PMID:30851411 Qsox1 Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of QSOX1 mRNA CTD PMID:22431001 Qsox1 Rat sodium arsenite increases expression ISO QSOX1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of QSOX1 mRNA CTD PMID:38568856 Qsox1 Rat sodium arsenite multiple interactions ISO QSOX1 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of QSOX1 mRNA CTD PMID:39836092 Qsox1 Rat sodium fluoride increases expression ISO Qsox1 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of QSOX1 protein CTD PMID:28918527 Qsox1 Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of QSOX1 mRNA CTD PMID:30047161 Qsox1 Rat sulforaphane increases expression ISO Qsox1 (Mus musculus) 6480464 sulforaphane results in increased expression of QSOX1 mRNA CTD PMID:30529165 Qsox1 Rat sunitinib decreases expression ISO QSOX1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of QSOX1 mRNA CTD PMID:31533062 Qsox1 Rat T-2 toxin decreases expression EXP 6480464 T-2 Toxin results in decreased expression of QSOX1 mRNA CTD PMID:26141394 Qsox1 Rat temozolomide increases expression ISO QSOX1 (Homo sapiens) 6480464 Temozolomide results in increased expression of QSOX1 mRNA CTD PMID:31758290 Qsox1 Rat tert-butyl hydroperoxide decreases expression ISO QSOX1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of QSOX1 mRNA CTD PMID:12419474 Qsox1 Rat testosterone multiple interactions ISO QSOX1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of QSOX1 mRNA CTD PMID:21592394 Qsox1 Rat testosterone increases expression ISO QSOX1 (Homo sapiens) 6480464 Testosterone results in increased expression of QSOX1 mRNA CTD PMID:21592394 Qsox1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of QSOX1 mRNA CTD PMID:31150632 Qsox1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of QSOX1 mRNA CTD PMID:23411599 Qsox1 Rat titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of QSOX1 mRNA CTD PMID:30012374 Qsox1 Rat titanium dioxide decreases methylation ISO Qsox1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of QSOX1 gene CTD PMID:35295148 Qsox1 Rat trichostatin A affects expression ISO QSOX1 (Homo sapiens) 6480464 trichostatin A affects the expression of QSOX1 mRNA CTD PMID:28542535 Qsox1 Rat triphenyl phosphate affects expression ISO QSOX1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of QSOX1 mRNA CTD PMID:37042841 Qsox1 Rat troglitazone increases expression ISO QSOX1 (Homo sapiens) 6480464 troglitazone results in increased expression of QSOX1 mRNA CTD PMID:19140230 Qsox1 Rat urethane increases expression ISO QSOX1 (Homo sapiens) 6480464 Urethane results in increased expression of QSOX1 mRNA CTD PMID:28818685 Qsox1 Rat valproic acid increases expression ISO QSOX1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of QSOX1 mRNA CTD PMID:19101580 and PMID:29154799 Qsox1 Rat vitamin E increases expression ISO QSOX1 (Homo sapiens) 6480464 Vitamin E results in increased expression of QSOX1 mRNA CTD PMID:19244175 Qsox1 Rat zinc atom increases expression EXP 6480464 Zinc deficiency results in increased expression of QSOX1 mRNA CTD PMID:19111725 Qsox1 Rat zinc(0) increases expression EXP 6480464 Zinc deficiency results in increased expression of QSOX1 mRNA CTD PMID:19111725
(1->4)-beta-D-glucan (ISO) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4,6-tribromophenol (ISO) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acetochlor (ISO) acrylamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) amitrole (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol F (EXP,ISO) Butylbenzyl phthalate (EXP) C60 fullerene (EXP) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) carnosic acid (ISO) CGP 52608 (ISO) chlordecone (ISO) chloroprene (ISO) choline (ISO) cisplatin (ISO) clofibrate (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) corosolic acid (ISO) corticosterone (EXP) cyclosporin A (ISO) decabromodiphenyl ether (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP) diclofenac (ISO) dicrotophos (ISO) diethyl phthalate (EXP) diethylstilbestrol (ISO) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) dioxygen (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (ISO) fenvalerate (EXP) fipronil (EXP) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) gefitinib (ISO) genistein (EXP,ISO) graphene oxide (ISO) herbicide (ISO) hydrogen cyanide (ISO) hydrogen peroxide (ISO) inulin (ISO) ketoconazole (ISO) L-methionine (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methimazole (EXP) methoxyacetic acid (ISO) N,N-diethyl-m-toluamide (EXP) naphthalene (ISO) nickel atom (ISO) nitrates (ISO) ozone (ISO) paclitaxel (ISO) paracetamol (EXP,ISO) paraquat (ISO) parathion (ISO) perfluorooctane-1-sulfonic acid (ISO) permethrin (EXP) phenethyl isothiocyanate (EXP) pirinixic acid (ISO) potassium cyanide (ISO) progesterone (EXP) promegestone (ISO) propiconazole (EXP) quercetin (ISO) rac-lactic acid (ISO) silicon dioxide (EXP) sodium arsenite (ISO) sodium fluoride (ISO) sulfadimethoxine (EXP) sulforaphane (ISO) sunitinib (ISO) T-2 toxin (EXP) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (EXP) thioacetamide (EXP) titanium dioxide (EXP,ISO) trichostatin A (ISO) triphenyl phosphate (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) vitamin E (ISO) zinc atom (EXP) zinc(0) (EXP)
Cellular Component
extracellular exosome (IEA,ISO) extracellular region (IEA) extracellular space (IBA,IDA,IEA,ISO,ISS) Golgi apparatus (IEA,ISO) Golgi membrane (IBA,IEA,ISO,ISS) intracellular membrane-bounded organelle (IEA,ISO) membrane (IEA)
1.
Rat seminal vesicle fad-dependent sulfhydryl oxidase. biochemical characterization and molecular cloning of a member of the new sulfhydryl oxidase/quiescin q6 gene family.
Benayoun B, etal., J Biol Chem 2001 Apr 27;276(17):13830-7.
2.
Enzyme structure captures four cysteines aligned for disulfide relay.
Gat Y, etal., Protein Sci. 2014 Aug;23(8):1102-12. doi: 10.1002/pro.2496. Epub 2014 Jun 18.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Expression of SOx-2, a member of the FAD-dependent sulfhydryl oxidase/quiescin Q6 gene family, in rat brain.
Mairet-Coello G, etal., Neuroreport 2002 Nov 15;13(16):2049-51.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Qsox1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 70,500,060 - 70,537,711 (-) NCBI GRCr8 mRatBN7.2 13 67,949,780 - 67,987,434 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 67,949,780 - 67,987,459 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 70,529,544 - 70,566,399 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 71,844,987 - 71,881,834 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 69,106,470 - 69,143,317 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 73,423,396 - 73,460,890 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 73,423,397 - 73,460,935 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 78,351,222 - 78,388,703 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 70,739,793 - 70,777,526 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 70,753,873 - 70,791,628 (-) NCBI Celera 13 67,815,702 - 67,852,956 (-) NCBI Celera Cytogenetic Map 13 q21 NCBI
QSOX1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 180,154,869 - 180,204,030 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 180,154,869 - 180,204,030 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 180,124,004 - 180,173,165 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 178,390,591 - 178,433,792 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 176,855,624 - 176,898,826 NCBI Celera 1 153,231,536 - 153,274,744 (+) NCBI Celera Cytogenetic Map 1 q25.2 NCBI HuRef 1 151,355,443 - 151,398,518 (+) NCBI HuRef CHM1_1 1 181,547,697 - 181,590,889 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 179,510,604 - 179,559,769 (+) NCBI T2T-CHM13v2.0
Qsox1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 155,653,901 - 155,688,645 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 155,651,775 - 155,688,635 (-) Ensembl GRCm39 Ensembl GRCm38 1 155,778,155 - 155,812,899 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 155,776,029 - 155,812,889 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 157,625,285 - 157,660,029 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 157,540,373 - 157,575,117 (-) NCBI MGSCv36 mm8 Celera 1 158,211,715 - 158,246,555 (-) NCBI Celera Cytogenetic Map 1 G3 NCBI cM Map 1 67.64 NCBI
Qsox1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955406 19,363,938 - 19,402,134 (+) NCBI ChiLan1.0 ChiLan1.0
QSOX1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 69,563,559 - 69,606,794 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 69,221,823 - 69,265,043 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 155,641,793 - 155,687,231 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 159,289,932 - 159,358,675 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 159,313,245 - 159,358,672 (+) Ensembl panpan1.1 panPan2
QSOX1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 13,718,799 - 13,754,115 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 13,718,799 - 13,754,114 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 13,297,965 - 13,333,390 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 13,446,573 - 13,482,007 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 13,446,567 - 13,482,619 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 13,357,448 - 13,392,875 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 13,463,885 - 13,499,332 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 13,588,279 - 13,623,755 (+) NCBI UU_Cfam_GSD_1.0
Qsox1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 91,129,070 - 91,166,948 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936481 8,975,790 - 9,013,723 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936481 8,975,818 - 9,013,684 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
QSOX1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 121,779,792 - 121,822,825 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 121,779,072 - 121,822,829 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 133,595,396 - 133,638,610 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
QSOX1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 49,180,365 - 49,223,814 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 49,181,365 - 49,223,741 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 50,571,837 - 50,617,458 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Qsox1
.
Predicted Target Of
Count of predictions: 299 Count of miRNA genes: 140 Interacting mature miRNAs: 163 Transcripts: ENSRNOT00000005052, ENSRNOT00000068044 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298066 Bp159 Blood pressure QTL 159 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 46088046 91088046 Rat 10755495 Bp387 Blood pressure QTL 387 3.78 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34663461 87525369 Rat 1354655 Bp241 Blood pressure QTL 241 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 56056920 101056920 Rat 70220 Bp55 Blood pressure QTL 55 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 71119 Thym2 Thymus enlargement QTL 2 3.8 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 13 46197976 84753113 Rat 4889861 Pur29 Proteinuria QTL 29 13.8 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 13 37415584 80753406 Rat 12879441 Bp396 Blood pressure QTL 396 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 45699983 90699983 Rat 2293687 Bss26 Bone structure and strength QTL 26 4.6 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 13 65103704 106807694 Rat 619615 Bp80 Blood pressure QTL 80 0.0354 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 39754544 84754544 Rat 2303028 Bp329 Blood pressure QTL 329 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 58497872 73485113 Rat 1581570 Eae17 Experimental allergic encephalomyelitis QTL 17 4.1 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 8897350 101631289 Rat 70170 Eae14 Experimental allergic encephalomyelitis QTL 14 0.0024 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 13 23203448 68203448 Rat 61340 Bp25 Blood pressure QTL 25 4.2 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 34535218 79535218 Rat 1581573 Uae36 Urinary albumin excretion QTL 36 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 1549897 Stresp12 Stress response QTL 12 3.35 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 13 38433408 83433408 Rat 724564 Uae11 Urinary albumin excretion QTL 11 5.7 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 13 59492522 77046890 Rat 7207885 Glom27 Glomerulus QTL 27 3.9 kidney glomerulus integrity trait (VT:0010546) kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139) 13 20605871 101339738 Rat 7387280 Uae43 Urinary albumin excretion QTL 43 5.69 0.4174 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 66451204 106807694 Rat 738026 Lnnr5 Liver neoplastic nodule remodeling QTL 5 3.29 liver integrity trait (VT:0010547) liver remodeling tumorous lesion number (CMO:0001461) 13 59874408 85581182 Rat 1558644 Cm45 Cardiac mass QTL 45 3.6 0.002 heart mass (VT:0007028) heart wet weight (CMO:0000069) 13 23692969 68692969 Rat 70181 BpQTLcluster11 Blood pressure QTL cluster 11 6.922 arterial blood pressure trait (VT:2000000) absolute change in mean arterial blood pressure (CMO:0000533) 13 31241331 93395974 Rat 2293702 Bss34 Bone structure and strength QTL 34 4.61 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 13 65103704 106807694 Rat 61349 Bp31 Blood pressure QTL 31 5.75 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 13 37374509 82374509 Rat 2303563 Bw89 Body weight QTL 89 6 body mass (VT:0001259) body weight (CMO:0000012) 13 32284471 77284471 Rat 1354621 Rf47 Renal function QTL 47 3.7 kidney renin amount (VT:0010559) kidney renin level (CMO:0002166) 13 30395351 101056920 Rat 1581554 Pur11 Proteinuria QTL 11 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 13 5994833 77046787 Rat 12879477 Bp401 Blood pressure QTL 401 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 37262092 82262092 Rat 1331750 Bp220 Blood pressure QTL 220 2.98 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 13 37415584 82415584 Rat 6893338 Cm76 Cardiac mass QTL 76 0 0.99 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 13 23692969 68692969 Rat 1641901 Alcrsp6 Alcohol response QTL 6 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 13 52362171 97362171 Rat 12879475 Bp400 Blood pressure QTL 400 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 13 61825626 106807694 Rat 1354666 Bp244 Blood pressure QTL 244 4.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 13 1 101056920 Rat
RH139452
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 13 67,949,798 - 67,949,941 (+) MAPPER mRatBN7.2 Rnor_6.0 13 73,423,415 - 73,423,557 NCBI Rnor6.0 Rnor_5.0 13 78,351,241 - 78,351,383 UniSTS Rnor5.0 RGSC_v3.4 13 70,739,812 - 70,739,954 UniSTS RGSC3.4 Celera 13 67,815,721 - 67,815,863 UniSTS RH 3.4 Map 13 344.6 UniSTS Cytogenetic Map 13 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000005052 ⟹ ENSRNOP00000005052
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 67,949,782 - 67,987,459 (-) Ensembl Rnor_6.0 Ensembl 13 73,423,397 - 73,460,912 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000068044 ⟹ ENSRNOP00000061072
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 13 67,949,780 - 67,987,434 (-) Ensembl Rnor_6.0 Ensembl 13 73,424,027 - 73,460,935 (-) Ensembl
RefSeq Acc Id:
NM_001109898 ⟹ NP_001103368
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 70,500,060 - 70,537,711 (-) NCBI mRatBN7.2 13 67,949,780 - 67,987,434 (-) NCBI Rnor_6.0 13 73,423,396 - 73,460,890 (-) NCBI Rnor_5.0 13 78,351,222 - 78,388,703 (-) NCBI RGSC_v3.4 13 70,739,793 - 70,777,526 (-) RGD Celera 13 67,815,702 - 67,852,956 (-) RGD
Sequence:
GCGAGGTGGACAGTCAAGCCGCCTAGGATGAGGAGGTGCGGCCGCCACTCGGGGCCGCCGTCGCTGCTGCTGCTACTTCTGCTGCTCCCGCCGCTGCTGCTCTCGGTGCCCGGCGCTTACGCGGCCCG
hide sequence
RefSeq Acc Id:
NM_053431 ⟹ NP_445883
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 13 70,500,060 - 70,537,711 (-) NCBI mRatBN7.2 13 67,949,780 - 67,987,434 (-) NCBI Rnor_6.0 13 73,423,396 - 73,460,890 (-) NCBI Rnor_5.0 13 78,351,222 - 78,388,703 (-) NCBI RGSC_v3.4 13 70,739,793 - 70,777,526 (-) RGD Celera 13 67,815,702 - 67,852,956 (-) RGD
Sequence:
GCGAGGTGGACAGTCAAGCCGCCTAGGATGAGGAGGTGCGGCCGCCACTCGGGGCCGCCGTCGCTGCTGCTGCTACTTCTGCTGCTCCCGCCGCTGCTGCTCTCGGTGCCCGGCGCTTACGCGGCCCG
hide sequence
RefSeq Acc Id:
NP_445883 ⟸ NM_053431
- Peptide Label:
isoform B precursor
- UniProtKB:
A6ICZ3 (UniProtKB/TrEMBL), A6ICZ2 (UniProtKB/TrEMBL)
- Sequence:
MRRCGRHSGPPSLLLLLLLLPPLLLSVPGAYAARLSVLYSSSDPLTLLDADTVRPAVLGSSSAWAVEFFASWCGHCIAFAPTWKELANDVKDWRPALNLAVLDCADETNSAVCREFNIAGFPTVRFFK
hide sequence
RefSeq Acc Id:
NP_001103368 ⟸ NM_001109898
- Peptide Label:
isoform A precursor
- UniProtKB:
Q8K4M2 (UniProtKB/Swiss-Prot), Q99J80 (UniProtKB/Swiss-Prot), Q6IUU3 (UniProtKB/Swiss-Prot)
- Sequence:
MRRCGRHSGPPSLLLLLLLLPPLLLSVPGAYAARLSVLYSSSDPLTLLDADTVRPAVLGSSSAW
hide sequence
Ensembl Acc Id:
ENSRNOP00000005052 ⟸ ENSRNOT00000005052
Ensembl Acc Id:
ENSRNOP00000061072 ⟸ ENSRNOT00000068044
RGD ID: 13698909 Promoter ID: EPDNEW_R9434 Type: initiation region Name: Qsox1_1 Description: quiescin sulfhydryl oxidase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 13 73,460,961 - 73,461,021 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-12-02
Qsox1
quiescin sulfhydryl oxidase 1
Qsox1
quiescin Q6 sulfhydryl oxidase 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-18
Qsox1
quiescin Q6 sulfhydryl oxidase 1
Qscn6
quiescin Q6
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Qscn6
quiescin Q6
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
highly expressed in diencephalon and telencephalon
1299176
gene_function
converts alkyl thiols and oxygen to their dialkyl disulfides and hydrogen peroxide
67932
gene_protein
570 amino acids
67932
gene_transcript
2472 nucleotide cDNA with an open reading frame of 1710 base pairs
67932
