Advanced Search (OLGA)

Gene: Pde10a (phosphodiesterase 10A) Rattus norvegicus

Analyze

Symbol:

Pde10a

Name:

phosphodiesterase 10A

RGD ID:

68434

Description:

Enables cyclic-nucleotide phosphodiesterase activity. Involved in cAMP catabolic process and cGMP catabolic process. Located in cytosol and perikaryon. Is active in glutamatergic synapse. Is extrinsic component of postsynaptic density membrane. Biomarker of traumatic brain injury. Human ortholog(s) of this gene implicated in striatal degeneration 2. Orthologous to human PDE10A (phosphodiesterase 10A); PARTICIPATES IN adenine phoshoribosyltransferase deficiency pathway; adenosine monophosphate deaminase deficiency pathway; adenylosuccinate lyase deficiency pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A; Pde10a3; testis-specific phosphodiesterase PDE10A2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PDE10A (phosphodiesterase 10A)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Pde10a (phosphodiesterase 10A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pde10a (phosphodiesterase 10A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PDE10A (phosphodiesterase 10A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PDE10A (phosphodiesterase 10A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pde10a (phosphodiesterase 10A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PDE10A (phosphodiesterase 10A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PDE10A (phosphodiesterase 10A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pde10a (phosphodiesterase 10A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ALG1 (ALG1 chitobiosyldiphosphodolichol beta-mannosyltransferase)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	PDE10A (phosphodiesterase 10A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pde10a (phosphodiesterase 10A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pde10a (phosphodiesterase 10A)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pde-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pde10a	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	54,313,343 - 54,765,668 (-)	NCBI		GRCr8
mRatBN7.2	1	51,765,743 - 52,218,086 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	51,770,132 - 52,216,563 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	52,476,016 - 52,919,928 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	58,463,473 - 58,911,420 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	52,551,592 - 52,995,519 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	52,360,296 - 52,544,448 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	52,360,296 - 52,544,450 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	53,617,430 - 53,800,479 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	46,392,900 - 46,589,076 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	46,395,844 - 46,592,020 (-)	NCBI
Celera	1	47,539,418 - 47,723,290 (-)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pde10a	Rat	traumatic brain injury		IEP		13513923		RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pde10a	Rat	Developmental Disabilities		ISO	RGD:68649	8554872	ClinVar Annotator: match by term: Global developmental delay	ClinVar	PMID:27058446\|PMID:32581362
Pde10a	Rat	genetic disease		ISO	RGD:68649	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:25741868\|PMID:28492532
Pde10a	Rat	Infantile-Onset Limb and Orofacial Dyskinesia		ISO	RGD:68649	8554872	ClinVar Annotator: match by term: Dyskinesia, limb and orofacial, infantile-onset \| ClinVar Annotator: match by more ...	ClinVar	PMID:25741868\|PMID:27058446\|PMID:27058447\|PMID:28492532\|PMID:29159890\|PMID:32581362
Pde10a	Rat	Muscle Hypotonia		ISO	RGD:68649	8554872	ClinVar Annotator: match by term: Generalized hypotonia	ClinVar	PMID:27058446\|PMID:32581362
Pde10a	Rat	striatal degeneration 2		ISO	RGD:68649	8554872	ClinVar Annotator: match by term: Striatal degeneration, autosomal dominant 2	ClinVar	PMID:25741868\|PMID:27058447\|PMID:28492532\|PMID:29159890\|PMID:29165877

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pde10a	Rat	Infantile-Onset Limb and Orofacial Dyskinesia		ISO	RGD:68649	7240710		OMIM
Pde10a	Rat	striatal degeneration 2		ISO	RGD:68649	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pde10a	Rat	(S)-nicotine	decreases expression	ISO	RGD:68650	6480464	Nicotine results in decreased expression of PDE10A mRNA	CTD	PMID:21955143
Pde10a	Rat	1,2-dichloroethane	decreases expression	ISO	RGD:68650	6480464	ethylene dichloride results in decreased expression of PDE10A mRNA	CTD	PMID:28960355
Pde10a	Rat	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of PDE10A mRNA	CTD	PMID:29097150
Pde10a	Rat	17beta-estradiol	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of PDE10A mRNA	CTD	PMID:26496021
Pde10a	Rat	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	EXP		6480464	2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of PDE10A mRNA	CTD	PMID:27291303
Pde10a	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of PDE10A mRNA	CTD	PMID:22808131\|PMID:32109520
Pde10a	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of PDE10A mRNA	CTD	PMID:33387578
Pde10a	Rat	2,3,7,8-Tetrachlorodibenzofuran	decreases expression	EXP		6480464	2,3,7,8-tetrachlorodibenzofuran results in decreased expression of PDE10A mRNA	CTD	PMID:32109520
Pde10a	Rat	2-palmitoylglycerol	increases expression	ISO	RGD:68649	6480464	2-palmitoylglycerol results in increased expression of PDE10A mRNA	CTD	PMID:37199045
Pde10a	Rat	3',5'-cyclic AMP	multiple interactions	ISO	RGD:68649	6480464	Cyclic AMP inhibits the reaction [PDE10A protein results in increased hydrolysis of Cyclic GMP]; Cyclic more ...	CTD	PMID:10373451
Pde10a	Rat	3',5'-cyclic AMP	increases hydrolysis	ISO	RGD:68649	6480464	PDE10A protein results in increased hydrolysis of Cyclic AMP	CTD	PMID:10373451
Pde10a	Rat	3',5'-cyclic GMP	multiple interactions	ISO	RGD:68649	6480464	Cyclic AMP inhibits the reaction [PDE10A protein results in increased hydrolysis of Cyclic GMP]; Cyclic more ...	CTD	PMID:10373451
Pde10a	Rat	3',5'-cyclic GMP	increases hydrolysis	ISO	RGD:68649	6480464	PDE10A protein results in increased hydrolysis of Cyclic GMP	CTD	PMID:10373451
Pde10a	Rat	3,4-methylenedioxymethamphetamine	increases expression	ISO	RGD:68650	6480464	N-Methyl-3,4-methylenedioxyamphetamine results in increased expression of PDE10A mRNA	CTD	PMID:20188158
Pde10a	Rat	4,4'-sulfonyldiphenol	decreases methylation	ISO	RGD:68649	6480464	bisphenol S results in decreased methylation of PDE10A gene	CTD	PMID:31601247
Pde10a	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:68650	6480464	Fenretinide results in increased expression of PDE10A mRNA	CTD	PMID:28973697
Pde10a	Rat	5-(hydroxymethyl)cytosine	multiple interactions	ISO	RGD:68650	6480464	[bisphenol A results in increased methylation of PDE10A intron] which results in increased abundance of more ...	CTD	PMID:30044229
Pde10a	Rat	acrylamide	decreases expression	ISO	RGD:68650	6480464	Acrylamide results in decreased expression of PDE10A mRNA	CTD	PMID:30807115
Pde10a	Rat	aflatoxin B1	decreases methylation	ISO	RGD:68649	6480464	Aflatoxin B1 results in decreased methylation of PDE10A gene	CTD	PMID:27153756
Pde10a	Rat	Aflatoxin B2 alpha	affects methylation	ISO	RGD:68649	6480464	aflatoxin B2 affects the methylation of PDE10A intron	CTD	PMID:30157460
Pde10a	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:68649	6480464	Tretinoin results in increased expression of PDE10A mRNA	CTD	PMID:21934132
Pde10a	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of PDE10A mRNA	CTD	PMID:16483693
Pde10a	Rat	aristolochic acid A	decreases expression	ISO	RGD:68649	6480464	aristolochic acid I results in decreased expression of PDE10A mRNA	CTD	PMID:33212167
Pde10a	Rat	arsenite(3-)	increases expression	ISO	RGD:68650	6480464	arsenite results in increased expression of PDE10A mRNA	CTD	PMID:33053406
Pde10a	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of PDE10A gene	CTD	PMID:28931070
Pde10a	Rat	Azoxymethane	multiple interactions	ISO	RGD:68650	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PDE10A more ...	CTD	PMID:29950665
Pde10a	Rat	belinostat	decreases expression	ISO	RGD:68649	6480464	belinostat results in decreased expression of PDE10A mRNA	CTD	PMID:26272509
Pde10a	Rat	belinostat	multiple interactions	ISO	RGD:68649	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Pde10a	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:68650	6480464	Benzo(a)pyrene results in decreased expression of PDE10A mRNA	CTD	PMID:19770486
Pde10a	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:68650	6480464	Benzo(a)pyrene results in increased methylation of PDE10A exon; Benzo(a)pyrene results in increased methylation of PDE10A more ...	CTD	PMID:27901495
Pde10a	Rat	benzo[a]pyrene	decreases expression	EXP		6480464	Benzo(a)pyrene results in decreased expression of PDE10A mRNA	CTD	PMID:21839799
Pde10a	Rat	benzo[a]pyrene diol epoxide I	decreases expression	ISO	RGD:68649	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of PDE10A mRNA	CTD	PMID:20382639
Pde10a	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:68650	6480464	Diethylhexyl Phthalate results in increased expression of PDE10A mRNA	CTD	PMID:34319233
Pde10a	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with Estradiol] results in increased expression of PDE10A mRNA; [bisphenol A co-treated more ...	CTD	PMID:26496021
Pde10a	Rat	bisphenol A	increases expression	ISO	RGD:68650	6480464	bisphenol A results in increased expression of PDE10A mRNA	CTD	PMID:35598803
Pde10a	Rat	bisphenol A	increases methylation	ISO	RGD:68649	6480464	bisphenol A results in increased methylation of PDE10A gene	CTD	PMID:31601247
Pde10a	Rat	bisphenol A	multiple interactions	ISO	RGD:68649	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of PDE10A gene	CTD	PMID:31601247
Pde10a	Rat	bisphenol A	decreases expression	ISO	RGD:68650	6480464	bisphenol A results in decreased expression of PDE10A mRNA	CTD	PMID:34585602
Pde10a	Rat	bisphenol A	increases methylation	ISO	RGD:68650	6480464	bisphenol A results in increased methylation of PDE10A exon	CTD	PMID:30044229
Pde10a	Rat	bisphenol A	affects methylation	ISO	RGD:68650	6480464	bisphenol A affects the methylation of PDE10A intron	CTD	PMID:30044229\|PMID:30073950
Pde10a	Rat	bisphenol A	multiple interactions	ISO	RGD:68650	6480464	[bisphenol A results in increased methylation of PDE10A intron] which results in increased abundance of more ...	CTD	PMID:30044229
Pde10a	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of PDE10A gene	CTD	PMID:28505145
Pde10a	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of PDE10A mRNA	CTD	PMID:29097150
Pde10a	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PDE10A mRNA	CTD	PMID:25181051
Pde10a	Rat	bisphenol F	increases expression	EXP		6480464	4,4'-bisphenol F results in increased expression of PDE10A mRNA	CTD	PMID:26186136
Pde10a	Rat	butanal	decreases expression	ISO	RGD:68649	6480464	butyraldehyde results in decreased expression of PDE10A mRNA	CTD	PMID:26079696
Pde10a	Rat	C60 fullerene	decreases expression	EXP		6480464	fullerene C60 results in decreased expression of PDE10A mRNA	CTD	PMID:19167457
Pde10a	Rat	cadmium atom	increases expression	ISO	RGD:68649	6480464	Cadmium results in increased expression of PDE10A mRNA	CTD	PMID:31082426
Pde10a	Rat	cadmium atom	multiple interactions	ISO	RGD:68649	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PDE10A more ...	CTD	PMID:35301059
Pde10a	Rat	cadmium dichloride	decreases expression	ISO	RGD:68649	6480464	Cadmium Chloride results in decreased expression of PDE10A mRNA	CTD	PMID:26472689
Pde10a	Rat	cadmium dichloride	multiple interactions	ISO	RGD:68649	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of PDE10A more ...	CTD	PMID:35301059
Pde10a	Rat	carbon nanotube	increases expression	ISO	RGD:68650	6480464	Nanotubes, Carbon analog results in increased expression of PDE10A mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681
Pde10a	Rat	CGP 52608	multiple interactions	ISO	RGD:68649	6480464	CGP 52608 promotes the reaction [RORA protein binds to PDE10A gene]	CTD	PMID:28238834
Pde10a	Rat	chlorpyrifos	increases expression	ISO	RGD:68650	6480464	Chlorpyrifos results in increased expression of PDE10A mRNA	CTD	PMID:32715474\|PMID:37019170
Pde10a	Rat	choline	multiple interactions	ISO	RGD:68650	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Pde10a	Rat	cisplatin	decreases expression	ISO	RGD:68649	6480464	Cisplatin results in decreased expression of PDE10A mRNA	CTD	PMID:27392435
Pde10a	Rat	cisplatin	multiple interactions	ISO	RGD:68649	6480464	[Cisplatin co-treated with jinfukang] results in decreased expression of PDE10A mRNA	CTD	PMID:27392435
Pde10a	Rat	clothianidin	decreases expression	ISO	RGD:68649	6480464	clothianidin results in decreased expression of PDE10A mRNA	CTD	PMID:31626844
Pde10a	Rat	clozapine	increases expression	ISO	RGD:68650	6480464	Clozapine results in increased expression of PDE10A mRNA	CTD	PMID:17266109
Pde10a	Rat	clozapine	increases expression	EXP		6480464	Clozapine results in increased expression of PDE10A mRNA; Clozapine results in increased expression of PDE10A more ...	CTD	PMID:18222493
Pde10a	Rat	cocaine	increases expression	ISO	RGD:68650	6480464	Cocaine deficiency results in increased expression of PDE10A mRNA	CTD	PMID:27126842
Pde10a	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of PDE10A mRNA	CTD	PMID:26577399
Pde10a	Rat	dextran sulfate	multiple interactions	ISO	RGD:68650	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PDE10A more ...	CTD	PMID:29950665
Pde10a	Rat	diazinon	decreases expression	EXP		6480464	Diazinon results in decreased expression of PDE10A mRNA	CTD	PMID:17452286
Pde10a	Rat	dibutyl phthalate	increases expression	ISO	RGD:68650	6480464	Dibutyl Phthalate results in increased expression of PDE10A mRNA	CTD	PMID:31841868
Pde10a	Rat	dipyridamole	multiple interactions	ISO	RGD:68649	6480464	Dipyridamole inhibits the reaction [PDE10A protein results in increased hydrolysis of Cyclic AMP]; Dipyridamole inhibits more ...	CTD	PMID:10373451
Pde10a	Rat	dorsomorphin	multiple interactions	ISO	RGD:68649	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Pde10a	Rat	doxorubicin	decreases expression	ISO	RGD:68649	6480464	Doxorubicin results in decreased expression of PDE10A mRNA	CTD	PMID:29803840
Pde10a	Rat	endosulfan	decreases expression	EXP		6480464	Endosulfan results in decreased expression of PDE10A mRNA	CTD	PMID:29391264
Pde10a	Rat	entinostat	decreases expression	ISO	RGD:68649	6480464	entinostat results in decreased expression of PDE10A mRNA	CTD	PMID:26272509
Pde10a	Rat	entinostat	multiple interactions	ISO	RGD:68649	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Pde10a	Rat	epoxiconazole	increases expression	ISO	RGD:68650	6480464	epoxiconazole results in increased expression of PDE10A mRNA	CTD	PMID:35436446
Pde10a	Rat	ethanol	decreases expression	ISO	RGD:68650	6480464	Ethanol results in decreased expression of PDE10A mRNA	CTD	PMID:21955143\|PMID:29018328
Pde10a	Rat	ethanol	affects splicing	ISO	RGD:68650	6480464	Ethanol affects the splicing of PDE10A mRNA	CTD	PMID:30319688
Pde10a	Rat	flavonoids	decreases expression	EXP		6480464	Flavonoids results in decreased expression of PDE10A mRNA	CTD	PMID:18035473
Pde10a	Rat	folic acid	multiple interactions	ISO	RGD:68650	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Pde10a	Rat	folic acid	decreases expression	ISO	RGD:68650	6480464	Folic Acid results in decreased expression of PDE10A mRNA	CTD	PMID:25629700
Pde10a	Rat	fulvestrant	multiple interactions	ISO	RGD:68649	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of PDE10A gene	CTD	PMID:31601247
Pde10a	Rat	graphite	affects expression	EXP		6480464	Graphite affects the expression of PDE10A mRNA	CTD	PMID:29933104
Pde10a	Rat	haloperidol	increases expression	EXP		6480464	Haloperidol results in increased expression of PDE10A mRNA; Haloperidol results in increased expression of PDE10A more ...	CTD	PMID:18222493
Pde10a	Rat	L-methionine	multiple interactions	ISO	RGD:68650	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in decreased methylation more ...	CTD	PMID:20938992
Pde10a	Rat	lipopolysaccharide	increases expression	ISO	RGD:68649	6480464	Lipopolysaccharides results in increased expression of PDE10A mRNA	CTD	PMID:35811015
Pde10a	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:68649	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PDE10A mRNA	CTD	PMID:35811015
Pde10a	Rat	maneb	multiple interactions	ISO	RGD:68650	6480464	[Maneb co-treated with Paraquat] results in decreased expression of PDE10A mRNA	CTD	PMID:36117858
Pde10a	Rat	mercury dibromide	decreases expression	ISO	RGD:68649	6480464	mercuric bromide results in decreased expression of PDE10A mRNA	CTD	PMID:26272509
Pde10a	Rat	mercury dibromide	multiple interactions	ISO	RGD:68649	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Pde10a	Rat	morphine	decreases expression	ISO	RGD:68650	6480464	Morphine deficiency results in decreased expression of PDE10A mRNA; Morphine results in decreased expression of more ...	CTD	PMID:21955143\|PMID:27126842
Pde10a	Rat	N-methyl-4-phenylpyridinium	increases expression	ISO	RGD:68649	6480464	1-Methyl-4-phenylpyridinium results in increased expression of PDE10A mRNA	CTD	PMID:24810058
Pde10a	Rat	nickel sulfate	increases expression	ISO	RGD:68649	6480464	nickel sulfate results in increased expression of PDE10A mRNA	CTD	PMID:22714537
Pde10a	Rat	nicotine	decreases expression	ISO	RGD:68650	6480464	Nicotine results in decreased expression of PDE10A mRNA	CTD	PMID:21955143
Pde10a	Rat	p-chloromercuribenzoic acid	decreases expression	ISO	RGD:68649	6480464	p-Chloromercuribenzoic Acid results in decreased expression of PDE10A mRNA	CTD	PMID:26272509
Pde10a	Rat	p-chloromercuribenzoic acid	multiple interactions	ISO	RGD:68649	6480464	[NOG protein co-treated with p-Chloromercuribenzoic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Pde10a	Rat	panobinostat	multiple interactions	ISO	RGD:68649	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Pde10a	Rat	panobinostat	decreases expression	ISO	RGD:68649	6480464	panobinostat results in decreased expression of PDE10A mRNA	CTD	PMID:26272509
Pde10a	Rat	paracetamol	increases expression	ISO	RGD:68649	6480464	Acetaminophen results in increased expression of PDE10A mRNA	CTD	PMID:29067470
Pde10a	Rat	paraquat	multiple interactions	ISO	RGD:68650	6480464	[Maneb co-treated with Paraquat] results in decreased expression of PDE10A mRNA	CTD	PMID:36117858
Pde10a	Rat	pentanal	decreases expression	ISO	RGD:68649	6480464	pentanal results in decreased expression of PDE10A mRNA	CTD	PMID:26079696
Pde10a	Rat	phencyclidine	increases expression	ISO	RGD:68650	6480464	Phencyclidine results in increased expression of PDE10A mRNA	CTD	PMID:17266109
Pde10a	Rat	phenylmercury acetate	decreases expression	ISO	RGD:68649	6480464	Phenylmercuric Acetate results in decreased expression of PDE10A mRNA	CTD	PMID:26272509
Pde10a	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:68649	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Pde10a	Rat	PhIP	increases expression	EXP		6480464	2-amino-1-methyl-6-phenylimidazo(4,5-b)pyridine results in increased expression of PDE10A mRNA	CTD	PMID:15215175
Pde10a	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of PDE10A mRNA	CTD	PMID:27900601
Pde10a	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:68649	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of PDE10A mRNA	CTD	PMID:35811015
Pde10a	Rat	SB 431542	multiple interactions	ISO	RGD:68649	6480464	[NOG protein co-treated with belinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Pde10a	Rat	sodium arsenite	decreases expression	ISO	RGD:68649	6480464	sodium arsenite results in decreased expression of PDE10A mRNA	CTD	PMID:38568856
Pde10a	Rat	T-2 toxin	decreases expression	EXP		6480464	T-2 Toxin results in decreased expression of PDE10A mRNA	CTD	PMID:26141394
Pde10a	Rat	testosterone	multiple interactions	EXP		6480464	[bisphenol A co-treated with Testosterone] results in increased expression of PDE10A mRNA	CTD	PMID:26496021
Pde10a	Rat	testosterone enanthate	increases expression	EXP		6480464	testosterone enanthate results in increased expression of PDE10A mRNA	CTD	PMID:20463352\|PMID:21427060
Pde10a	Rat	thiram	decreases expression	ISO	RGD:68649	6480464	Thiram results in decreased expression of PDE10A mRNA	CTD	PMID:38568856
Pde10a	Rat	titanium dioxide	multiple interactions	ISO	RGD:68650	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of PDE10A more ...	CTD	PMID:29950665
Pde10a	Rat	titanium dioxide	decreases methylation	ISO	RGD:68650	6480464	titanium dioxide results in decreased methylation of PDE10A gene	CTD	PMID:35295148
Pde10a	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of PDE10A mRNA	CTD	PMID:33387578
Pde10a	Rat	trichostatin A	increases expression	ISO	RGD:68649	6480464	trichostatin A results in increased expression of PDE10A mRNA	CTD	PMID:24935251
Pde10a	Rat	trichostatin A	multiple interactions	ISO	RGD:68649	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Pde10a	Rat	trichostatin A	decreases expression	ISO	RGD:68649	6480464	trichostatin A results in decreased expression of PDE10A mRNA	CTD	PMID:24935251\|PMID:26272509
Pde10a	Rat	valproic acid	increases expression	EXP		6480464	Valproic Acid results in increased expression of PDE10A mRNA	CTD	PMID:23665938
Pde10a	Rat	valproic acid	decreases expression	EXP		6480464	Valproic Acid results in decreased expression of PDE10A mRNA	CTD	PMID:29427782
Pde10a	Rat	valproic acid	decreases expression	ISO	RGD:68649	6480464	Valproic Acid results in decreased expression of PDE10A mRNA	CTD	PMID:24383497\|PMID:24935251\|PMID:26272509\|PMID:27188386\|PMID:28001369
Pde10a	Rat	valproic acid	multiple interactions	ISO	RGD:68649	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Pde10a	Rat	valproic acid	increases expression	ISO	RGD:68649	6480464	Valproic Acid results in increased expression of PDE10A mRNA	CTD	PMID:24935251
Pde10a	Rat	valproic acid	affects expression	ISO	RGD:68649	6480464	Valproic Acid affects the expression of PDE10A mRNA	CTD	PMID:25979313
Pde10a	Rat	vinclozolin	affects expression	EXP		6480464	vinclozolin affects the expression of PDE10A mRNA	CTD	PMID:19015723
Pde10a	Rat	vorinostat	multiple interactions	ISO	RGD:68649	6480464	[NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Pde10a	Rat	vorinostat	decreases expression	ISO	RGD:68649	6480464	vorinostat results in decreased expression of PDE10A mRNA	CTD	PMID:26272509

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pde10a	Rat	cAMP catabolic process		IDA		68285		RGD
Pde10a	Rat	cAMP catabolic process	involved_in	IEA	UniPathway:UPA00762	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Pde10a	Rat	cAMP-mediated signaling	involved_in	IBA	CGD:CAL0000178266\|PANTHER:PTN001682918	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pde10a	Rat	cGMP catabolic process		IDA		68285		RGD
Pde10a	Rat	cGMP catabolic process	involved_in	IEA	UniPathway:UPA00763	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Pde10a	Rat	negative regulation of cGMP-mediated signaling	involved_in	IBA	PANTHER:PTN001682930\|WB:WBGene00016328	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pde10a	Rat	regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	acts_upstream_of_or_within	ISO	RGD:68650	1624291	PMID:18923023	RGD	PMID:18923023
Pde10a	Rat	regulation of cAMP/PKA signal transduction	acts_upstream_of_or_within	ISO	RGD:68650	1624291	PMID:18923023	RGD	PMID:18923023
Pde10a	Rat	signal transduction	involved_in	IEA	InterPro:IPR002073\|InterPro:IPR036971	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pde10a	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pde10a	Rat	cytosol		IDA		68285		RGD
Pde10a	Rat	cytosol	located_in	IEA	UniProtKB-SubCell:SL-0091	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Pde10a	Rat	extrinsic component of postsynaptic density membrane	is_active_in	IDA		2312515	PMID:16483723	SynGO
Pde10a	Rat	extrinsic component of postsynaptic density membrane	is_active_in	IEP		2312515	PMID:16483723	SynGO
Pde10a	Rat	glutamatergic synapse	is_active_in	IDA		2312515	PMID:16483723	SynGO
Pde10a	Rat	glutamatergic synapse	is_active_in	ISO	RGD:68650	1624291	PMID:31171447	RGD	PMID:31171447
Pde10a	Rat	glutamatergic synapse	is_active_in	IEP		2312515	PMID:16483723	SynGO
Pde10a	Rat	neuronal cell body		IDA		2312516		RGD
Pde10a	Rat	perikaryon		IDA		2312501		RGD
Pde10a	Rat	synapse	is_active_in	ISO	RGD:68650	1624291	PMID:31171447	RGD	PMID:31171447

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pde10a	Rat	3',5'-cGMP-stimulated cyclic-nucleotide phosphodiesterase activity	enables	ISS	UniProtKB:Q9Y233	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Pde10a	Rat	3',5'-cGMP-stimulated cyclic-nucleotide phosphodiesterase activity	enables	IBA	PANTHER:PTN001682930\|UniProtKB:Q9Y233	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pde10a	Rat	3',5'-cGMP-stimulated cyclic-nucleotide phosphodiesterase activity	enables	ISO	RGD:68649	1624291	PMID:19689430	RGD	PMID:19689430
Pde10a	Rat	3',5'-cGMP-stimulated cyclic-nucleotide phosphodiesterase activity	enables	ISS	UniProtKB:Q9Y233	12790642	PMID:19689430	UniProt
Pde10a	Rat	3',5'-cyclic-AMP phosphodiesterase activity	enables	IEA	RHEA:25277	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Pde10a	Rat	3',5'-cyclic-AMP phosphodiesterase activity	enables	IBA	FB:FBgn0085370\|FB:FBgn0264815\|MGI:108413\|MGI:1201792\|MGI:1202402\|MGI:1277116\|MGI:1333863\|MGI:1352752\|MGI:1860764\|MGI:2443999\|MGI:2446107\|MGI:99555\|MGI:99558\|PANTHER:PTN001682918\|RGD:3278\|RGD:3279\|RGD:3280\|RGD:61943\|RGD:621016\|RGD:68332\|SGD:S000005887\|UniProtKB:O00408\|UniProtKB:O60658\|UniProtKB:O95263\|UniProtKB:P14099\|UniProtKB:P14100\|UniProtKB:P27815\|UniProtKB:P54750\|UniProtKB:Q01061\|UniProtKB:Q01064\|UniProtKB:Q07343\|UniProtKB:Q08493\|UniProtKB:Q08499\|UniProtKB:Q13370\|UniProtKB:Q13946\|UniProtKB:Q14123\|UniProtKB:Q14432\|UniProtKB:Q8I6Z7\|UniProtKB:Q9NP56\|WB:WBGene00011433\|dictyBase:DDB_G0284331\|dictyBase:DDB_G0289121	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pde10a	Rat	3',5'-cyclic-GMP phosphodiesterase activity	enables	IBA	FB:FBgn0038237\|FB:FBgn0085370\|FB:FBgn0264815\|MGI:108413\|MGI:1201792\|MGI:1277179\|MGI:2446107\|PANTHER:PTN001682918\|RGD:61943\|RGD:620995\|RGD:68329\|RGD:68332\|UniProtKB:O00408\|UniProtKB:O60658\|UniProtKB:O76074\|UniProtKB:O76083\|UniProtKB:P14099\|UniProtKB:P14100\|UniProtKB:P54750\|UniProtKB:Q01061\|UniProtKB:Q01064\|UniProtKB:Q14123\|UniProtKB:Q14432\|UniProtKB:Q8I5V4\|UniProtKB:Q8I6Z7\|UniProtKB:Q8IKD3\|WB:WBGene00011433\|dictyBase:DDB_G0268634	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pde10a	Rat	3',5'-cyclic-GMP phosphodiesterase activity	enables	IEA	RHEA:16957	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Pde10a	Rat	3',5'-cyclic-nucleotide phosphodiesterase activity	enables	IEA	InterPro:IPR002073\|InterPro:IPR036971	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pde10a	Rat	3',5'-cyclic-nucleotide phosphodiesterase activity	enables	IEA	EC:3.1.4.17	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Pde10a	Rat	3',5'-cyclic-nucleotide phosphodiesterase activity	enables	ISO	RGD:68650	1624291	PMID:10359840, PMID:27058446	RGD	PMID:10359840\|PMID:27058446
Pde10a	Rat	3',5'-cyclic-nucleotide phosphodiesterase activity	enables	IEA	RHEA:14653	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Pde10a	Rat	cAMP binding	enables	ISO	RGD:68649	1624291	PMID:19689430	RGD	PMID:19689430
Pde10a	Rat	cAMP binding	enables	IEA	UniProtKB-KW:KW-0116	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pde10a	Rat	catalytic activity	enables	IEA	UniProtKB-KW:KW-0021	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pde10a	Rat	cGMP binding	enables	IEA	UniProtKB-KW:KW-0142	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pde10a	Rat	cyclic-nucleotide phosphodiesterase activity		IDA		68285		RGD
Pde10a	Rat	cyclic-nucleotide phosphodiesterase activity		IDA		2312517		RGD
Pde10a	Rat	hydrolase activity	enables	IEA	UniProtKB-KW:KW-0378	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pde10a	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pde10a	Rat	nucleotide binding	enables	IEA	UniProtKB-KW:KW-0547	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pde10a	Rat	phosphoric diester hydrolase activity	enables	IEA	InterPro:IPR023088\|InterPro:IPR023174	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Pathway Annotations Click to see Annotation Detail View

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pde10a	Rat	protein kinase A (PKA) signaling pathway		ISO	RGD:68649	2312479		RGD

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pde10a	Rat	adenine phoshoribosyltransferase deficiency pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00535
Pde10a	Rat	adenosine monophosphate deaminase deficiency pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00537
Pde10a	Rat	adenylosuccinate lyase deficiency pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00167
Pde10a	Rat	AICA-ribosuria pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00168
Pde10a	Rat	azathioprine pharmacodynamics pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00427
Pde10a	Rat	Kelley-Seegmiller syndrome pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00365
Pde10a	Rat	Lesch-Nyhan syndrome pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00364
Pde10a	Rat	mercaptopurine pharmacodynamics pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00428
Pde10a	Rat	molybdenum cofactor deficiency pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00203
Pde10a	Rat	purine metabolic pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00050
Pde10a	Rat	purine nucleoside phosphorylase deficiency pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00210
Pde10a	Rat	tioguanine pharmacodynamics pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00430
Pde10a	Rat	xanthinuria type I pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00512
Pde10a	Rat	xanthinuria pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00220
Pde10a	Rat	xanthinuria type II pathway		ISO	RGD:68649	10402751		SMPDB	SMP:00513

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pde10a	Rat	purine metabolic pathway		IEA		6907045		KEGG	rno:00230

Disease Annotations Click to see Annotation Detail View

Developmental Disabilities (ISO)

genetic disease (ISO)

Infantile-Onset Limb and Orofacial Dyskinesia (ISO)

Muscle Hypotonia (ISO)

striatal degeneration 2 (ISO)

traumatic brain injury (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2-dichloroethane (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-palmitoylglycerol (ISO)

3',5'-cyclic AMP (ISO)

3',5'-cyclic GMP (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-(hydroxymethyl)cytosine (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

atrazine (EXP)

Azoxymethane (ISO)

belinostat (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

butanal (ISO)

C60 fullerene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

choline (ISO)

cisplatin (ISO)

clothianidin (ISO)

clozapine (EXP,ISO)

cocaine (ISO)

Cuprizon (EXP)

dextran sulfate (ISO)

diazinon (EXP)

dibutyl phthalate (ISO)

dipyridamole (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

flavonoids (EXP)

folic acid (ISO)

fulvestrant (ISO)

graphite (EXP)

haloperidol (EXP)

L-methionine (ISO)

lipopolysaccharide (ISO)

maneb (ISO)

mercury dibromide (ISO)

morphine (ISO)

N-methyl-4-phenylpyridinium (ISO)

nickel sulfate (ISO)

nicotine (ISO)

p-chloromercuribenzoic acid (ISO)

panobinostat (ISO)

paracetamol (ISO)

paraquat (ISO)

pentanal (ISO)

phencyclidine (ISO)

phenylmercury acetate (ISO)

PhIP (EXP)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

T-2 toxin (EXP)

testosterone (EXP)

testosterone enanthate (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

valproic acid (EXP,ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cAMP catabolic process (IDA,IEA)

cAMP-mediated signaling (IBA)

cGMP catabolic process (IDA,IEA)

negative regulation of cGMP-mediated signaling (IBA)

regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway (ISO)

regulation of cAMP/PKA signal transduction (ISO)

signal transduction (IEA)

Cellular Component

cytoplasm (IEA)

cytosol (IDA,IEA)

extrinsic component of postsynaptic density membrane (IDA,IEP)

glutamatergic synapse (IDA,IEP,ISO)

neuronal cell body (IDA)

perikaryon (IDA)

synapse (ISO)

Molecular Function

3',5'-cGMP-stimulated cyclic-nucleotide phosphodiesterase activity (IBA,ISO,ISS)

3',5'-cyclic-AMP phosphodiesterase activity (IBA,IEA)

3',5'-cyclic-GMP phosphodiesterase activity (IBA,IEA)

3',5'-cyclic-nucleotide phosphodiesterase activity (IEA,ISO)

cAMP binding (IEA,ISO)

catalytic activity (IEA)

cGMP binding (IEA)

cyclic-nucleotide phosphodiesterase activity (IDA)

hydrolase activity (IEA)

metal ion binding (IEA)

nucleotide binding (IEA)

phosphoric diester hydrolase activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

adenine phoshoribosyltransferase deficiency pathway (ISO)

adenosine monophosphate deaminase deficiency pathway (ISO)

adenylosuccinate lyase deficiency pathway (ISO)

AICA-ribosuria pathway (ISO)

azathioprine pharmacodynamics pathway (ISO)

Kelley-Seegmiller syndrome pathway (ISO)

Lesch-Nyhan syndrome pathway (ISO)

mercaptopurine pharmacodynamics pathway (ISO)

molybdenum cofactor deficiency pathway (ISO)

protein kinase A (PKA) signaling pathway (ISO)

purine metabolic pathway (IEA,ISO)

purine nucleoside phosphorylase deficiency pathway (ISO)

tioguanine pharmacodynamics pathway (ISO)

xanthinuria type I pathway (ISO)

xanthinuria pathway (ISO)

xanthinuria type II pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Biochemistry and physiology of cyclic nucleotide phosphodiesterases: essential components in cyclic nucleotide signaling.	Conti M and Beavo J, Annu Rev Biochem. 2007;76:481-511.
2.	Striatum- and testis-specific phosphodiesterase PDE10A isolation and characterization of a rat PDE10A.	Fujishige K, etal., Eur J Biochem 1999 Dec;266(3):1118-27.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	Subcellular localization of cyclic nucleotide phosphodiesterase type 10A variants, and alteration of the localization by cAMP-dependent protein kinase-dependent phosphorylation.	Kotera J, etal., J Biol Chem. 2004 Feb 6;279(6):4366-75. Epub 2003 Nov 6.
7.	PDE9A, PDE10A, and PDE11A expression in rat trigeminovascular pain signalling system.	Kruse LS, etal., Brain Res. 2009 Jul 24;1281:25-34. Epub 2009 May 13.
8.	Binding of cyclic nucleotides to phosphodiesterase 10A and 11A GAF domains does not stimulate catalytic activity.	Matthiesen K and Nielsen J, Biochem J. 2009 Oct 12;423(3):401-9. doi: 10.1042/BJ20090982.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
12.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
13.	GOA pipeline	RGD automated data pipeline
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	Immunohistochemical localization of PDE10A in the rat brain.	Seeger TF, etal., Brain Res. 2003 Sep 26;985(2):113-26.
17.	Quantitative Proteomic Study Reveals Up-Regulation of cAMP Signaling Pathway-Related Proteins in Mild Traumatic Brain Injury.	Song H, etal., J Proteome Res. 2018 Feb 2;17(2):858-869. doi: 10.1021/acs.jproteome.7b00618. Epub 2017 Dec 27.
18.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
19.	Cellular and subcellular localization of PDE10A, a striatum-enriched phosphodiesterase.	Xie Z, etal., Neuroscience. 2006 May 12;139(2):597-607. Epub 2006 Feb 17.

Additional References at PubMed

PMID:10359840	PMID:14752115	PMID:18923023	PMID:19056933	PMID:19103603	PMID:21194525	PMID:21494592	PMID:21515371	PMID:21777010	PMID:22142545	PMID:26256420	PMID:27058446
PMID:30053369	PMID:36671394

Genomics

Comparative Map Data

Pde10a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	54,313,343 - 54,765,668 (-)	NCBI		GRCr8
mRatBN7.2	1	51,765,743 - 52,218,086 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	51,770,132 - 52,216,563 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	52,476,016 - 52,919,928 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	58,463,473 - 58,911,420 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	52,551,592 - 52,995,519 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	52,360,296 - 52,544,448 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	52,360,296 - 52,544,450 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	53,617,430 - 53,800,479 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	46,392,900 - 46,589,076 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	46,395,844 - 46,592,020 (-)	NCBI
Celera	1	47,539,418 - 47,723,290 (-)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

PDE10A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	165,327,289 - 165,988,052 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	165,327,287 - 165,988,117 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	165,740,778 - 166,076,729 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	165,664,519 - 165,995,574 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	165,714,945 - 166,045,996	NCBI
Celera	6	166,478,886 - 166,814,271 (-)	NCBI		Celera
Cytogenetic Map	6	q27	NCBI
HuRef	6	163,202,267 - 163,537,621 (-)	NCBI		HuRef
CHM1_1	6	166,003,719 - 166,338,432 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	166,693,362 - 167,356,384 (-)	NCBI		T2T-CHM13v2.0

Pde10a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	8,742,719 - 9,205,480 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	8,744,204 - 9,205,480 (+)	Ensembl		GRCm39 Ensembl
GRCm38	17	8,525,187 - 8,986,648 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	8,525,372 - 8,986,648 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	8,994,610 - 9,179,513 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	8,639,919 - 8,824,822 (+)	NCBI		MGSCv36	mm8
Celera	17	8,848,994 - 9,030,858 (+)	NCBI		Celera
Cytogenetic Map	17	A1	NCBI
cM Map	17	4.96	NCBI

Pde10a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955439	16,114,530 - 16,365,146 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955439	16,114,530 - 16,370,648 (+)	NCBI	ChiLan1.0	ChiLan1.0

PDE10A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	185,514,841 - 186,181,000 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	183,411,044 - 184,076,963 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	163,274,252 - 163,612,749 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	168,259,978 - 168,596,401 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	168,265,707 - 168,645,231 (-)	Ensembl	panpan1.1		panPan2

PDE10A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	53,457,781 - 54,049,735 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	53,462,979 - 53,801,966 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	54,243,884 - 54,542,326 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	53,634,410 - 54,231,358 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	53,639,079 - 53,984,940 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	53,531,754 - 53,830,179 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	53,379,457 - 53,678,753 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	54,012,303 - 54,310,827 (-)	NCBI		UU_Cfam_GSD_1.0

Pde10a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	148,143,922 - 148,659,124 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936489	15,400,629 - 15,671,600 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936489	15,401,248 - 15,671,594 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PDE10A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	2,829,411 - 3,392,651 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	3,120,418 - 3,394,236 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	4,618,673 - 4,742,489 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PDE10A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	93,012,027 - 93,684,349 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	93,020,696 - 93,344,369 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	64,833,189 - 65,491,475 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pde10a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624785	13,497,495 - 13,880,345 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624785	13,208,518 - 13,885,261 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pde10a
3075 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	182
Count of miRNA genes:	91
Interacting mature miRNAs:	110
Transcripts:	ENSRNOT00000043474, ENSRNOT00000067142
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
1357400	Bw62	Body weight QTL62	4.05		inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	1	22340647	67340647	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1578756	Iddm22	Insulin dependent diabetes mellitus QTL 22	2.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	11835181	56835181	Rat
631508	Sald1	Serum aldosterone level QTL 1	3.7		blood aldosterone amount (VT:0005346)	serum aldosterone level (CMO:0000487)	1	9856001	54856001	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
724520	Bp145	Blood pressure QTL 145	2.1	0.0024	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	20784828	65784828	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	50343510	99980958	Rat
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
2302038	Pia31	Pristane induced arthritis QTL 31	5.5	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin M-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002111)	1	10992065	55992065	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
634353	Rends2	Renal damage susceptibility QTL 2		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	1	19333571	56983283	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat

Markers in Region

D17Mit247

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	51,776,532 - 51,776,645 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	52,366,636 - 52,366,748	NCBI	Rnor6.0
Rnor_5.0	1	53,623,770 - 53,623,882	UniSTS	Rnor5.0
RGSC_v3.4	1	46,399,301 - 46,399,413	UniSTS	RGSC3.4
Celera	1	47,545,819 - 47,545,931	UniSTS
Cytogenetic Map	1	q11	UniSTS

BE121313

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	51,943,640 - 51,943,799 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	52,534,475 - 52,534,633	NCBI	Rnor6.0
Rnor_5.0	1	53,790,506 - 53,790,664	UniSTS	Rnor5.0
RGSC_v3.4	1	46,579,103 - 46,579,261	UniSTS	RGSC3.4
Celera	1	47,713,317 - 47,713,475	UniSTS
RH 3.4 Map	1	607.2	UniSTS
Cytogenetic Map	1	q11	UniSTS

BE097292

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	51,964,411 - 51,964,566 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	52,554,878 - 52,555,032	NCBI	Rnor6.0
Rnor_5.0	1	53,810,943 - 53,811,097	UniSTS	Rnor5.0
RGSC_v3.4	1	46,600,046 - 46,600,200	UniSTS	RGSC3.4
Celera	1	47,733,835 - 47,733,989	UniSTS
RH 3.4 Map	1	606.7	UniSTS
Cytogenetic Map	1	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	87	86	55	25	55	6	214	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001388509	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001388510	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001388511	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_022236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089147	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089160	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089171	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089177	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089184	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089188	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039089191	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272580	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272582	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272590	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005491608	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB027155	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB027156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY462091	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY462092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY462093	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY462094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY462095	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474059	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212600	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000043474 ⟹ ENSRNOP00000042134

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	51,770,132 - 51,953,616 (-)	Ensembl
Rnor_6.0 Ensembl	1	52,360,296 - 52,544,450 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000067142 ⟹ ENSRNOP00000060834

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	51,770,850 - 52,216,563 (-)	Ensembl
Rnor_6.0 Ensembl	1	52,361,038 - 52,495,582 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000098030 ⟹ ENSRNOP00000081805

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	51,770,132 - 51,953,616 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102087 ⟹ ENSRNOP00000086612

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	51,770,132 - 51,904,854 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106865 ⟹ ENSRNOP00000086886

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	51,770,132 - 51,830,095 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111002 ⟹ ENSRNOP00000092661

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	51,770,132 - 52,216,563 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111873 ⟹ ENSRNOP00000091632

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	51,770,138 - 52,216,563 (-)	Ensembl

RefSeq Acc Id:

NM_001388509 ⟹ NP_001375438

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,317,738 - 54,765,668 (-)	NCBI
mRatBN7.2	1	51,770,138 - 52,218,086 (-)	NCBI

RefSeq Acc Id:

NM_001388510 ⟹ NP_001375439

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,317,738 - 54,765,668 (-)	NCBI
mRatBN7.2	1	51,770,138 - 52,218,086 (-)	NCBI

RefSeq Acc Id:

NM_001388511 ⟹ NP_001375440

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,317,738 - 54,765,668 (-)	NCBI
mRatBN7.2	1	51,770,138 - 52,218,086 (-)	NCBI

RefSeq Acc Id:

NM_022236 ⟹ NP_071572

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,317,738 - 54,501,206 (-)	NCBI
mRatBN7.2	1	51,770,138 - 51,953,614 (-)	NCBI
Rnor_6.0	1	52,360,296 - 52,544,448 (-)	NCBI
Rnor_5.0	1	53,617,430 - 53,800,479 (-)	NCBI
RGSC_v3.4	1	46,392,900 - 46,589,076 (-)	RGD
Celera	1	47,539,418 - 47,723,290 (-)	RGD

Sequence:

show sequence

GAATTCGGCACGAGGCAGCGGCGGGCGGCGGCGGCTCTTCCTTTCGCCTGCGATCCAAGGCTTG
CTGCTCCCAGCCCGCTCCGGGCCCCGGCCACCTCCACCGCCGCGGCTCCCCTTACACCCGGGCG
CACACCGCGCGGACTCCTTGGGTTTTCCGGGTGCCGGCGGGGGCTGCCCTGGCCTCGGCCCCGG
CTCTGCGGCCGGTGGCCGAACTCCGTGGCGGCCCCGAGGCACCGCCCTCCCCCTTGCCACTGCC
TGGCCGCTGCTCTTCGGCTCCGACATGGAAGATGGACCCTCTAACAATGCGAGTTGCTTCCGAA
GGCTGACCGAGTGTTTCCTCAGCCCCAGTTTGACGGATGAAAAGGTGAAGGCCTATCTTTCCCT
CCATCCCCAGGTATTAGACGAGTTTGTTTCTGAAAGTGTTAGTGCGGAGACTGTGGAGAAGTGG
CTGAAGAGGAAAAACAACAAAGCAGAAGATGAACCATCTCCTAAGGAAGTCAGCAGGTACCAGG
ACACGAACATGCAGGGAGTCGTGTACGAGCTGAACAGCTACATAGAGCAGCGCCTGGACACCGG
CGGGGACAACCACCTGCTCCTGTACGAGCTAAGCAGTATCATCAGGATAGCCACAAAAGCCGAC
GGATTTGCACTGTACTTCCTTGGAGAGTGCAATAATAGTCTGTGTGTCTTCACACCACCCGGAA
TGAAGGAAGGTCAACCCCGTCTCATCCCCGCAGGGCCCATCACCCAGGGCACCACCATCTCTGC
CTATGTGGCCAAGTCTAGGAAGACCCTGCTGGTAGAGGACATCCTTGGGGATGAGCGATTTCCC
AGAGGCACTGGTCTGGAGTCAGGAACCCGAATCCAGTCTGTCCTTTGCTTGCCTATTGTCACTG
CCATTGGAGACTTGATTGGCATCCTTGAACTGTACAGGCACTGGGGCAAAGAGGCCTTCTGCCT
CAGCCATCAGGAGGTTGCAACCGCCAATCTCGCTTGGGCTTCCGTAGCAATACACCAGGTGCAG
GTGTGCAGAGGTCTCGCCAAGCAGACCGAACTGAATGACTTCCTGCTCGATGTATCAAAGACAT
ACTTTGATAACATAGTCGCCATAGACTCTCTACTTGAACACATCATGATATATGCAAAAAATCT
AGTGAACGCCGACCGCTGCGCGCTCTTCCAGGTGGACCACAAGAACAAGGAGCTGTACTCGGAC
CTGTTTGACATTGGGGAGGAGAAGGAGGGGAAGCCCGTCTTCAAGAAGACCAAGGAGATCAGAT
TTTCCATTGAGAAAGGGATTGCTGGTCAAGTGGCAAGAACGGGAGAAGTCCTGAACATTCCTGA
TGCCTACGCAGACCCGCGCTTTAACAGGGAGGTGGACCTGTACACAGGCTATACCACGCGGAAC
ATTCTGTGTATGCCCATAGTGAGCCGCGGCAGCGTGATCGGTGTGGTGCAAATGGTTAACAAGA
TCAGCGGCAGCGCCTTCTCCAAGACGGATGAGAACAACTTCAAGATGTTTGCTGTCTTCTGCGC
TCTGGCCCTGCACTGCGCTAACATGTACCACAGGATCCGCCACTCAGAGTGCATCTACAGGGTT
ACCATGGAGAAGCTGTCTTACCACAGCATCTGCACCTCTGAGGAATGGCAAGGCCTCATGCACT
TCAACTTGCCAGCACGCATCTGCCGGGACATCGAGCTATTCCACTTTGACATTGGTCCTTTCGA
GAACATGTGGCCTGGGATCTTTGTCTACATGATCCATCGGTCTTGTGGGACATCCTGTTTTGAA
CTTGAAAAATTGTGCCGTTTTATCATGTCTGTGAAGAAGAACTATAGGCGGGTTCCTTACCACA
ACTGGAAGCATGCAGTCACGGTGGCGCACTGCATGTACGCCATACTTCAAAACAACAATGGCCT
CTTCACAGACCTTGAGCGCAAAGGCCTGCTAATTGCCTGTCTGTGCCATGACCTGGACCACAGG
GGCTTCAGTAACAGCTACCTGCAGAAATTCGACCACCCCCTGGCTGCGTTGTACTCCACCTCCA
CCATGGAGCAACACCACTTCTCCCAGACGGTGTCCATCCTCCAGCTGGAAGGACACAACATCTT
CTCCACCCTGAGCTCCAGCGAGTACGAGCAGGTGCTGGAGATCATCCGCAAAGCCATCATCGCC
ACTGACCTCGCACTGTACTTTGGGAACAGGAAGCAGTTGGAGGAGATGTACCAGACAGGGTCGC
TGAACCTCCACAACCAGTCCCATCGAGACCGCGTCATCGGCTTGATGATGACTGCCTGCGATCT
TTGCTCTGTGACGAAACTATGGCCAGTTACAAAATTGACAGCAAATGATATATATGCAGAGTTC
TGGGCTGAGGGGGATGAGATGAAGAAGTTGGGGATACAGCCCATCCCTATGATGGACAGAGACA
AGCGAGATGAAGTCCCTCAAGGACAGCTTGGATTCTACAATGCTGTGGCCATCCCCTGCTATAC
CACCCTGACGCAGATCCTCCCACCCACAGAGCCTCTGCTGAAGGCCTGCAGGGATAACCTCAAT
CAGTGGGAGAAGGTAATTCGAGGGGAAGAGACAGCAATGTGGATTTCAGGCCCAGCAACTAGCA
AAAGCACATCTGAGAAGCCGACCAGGAAGGTCGATGACTGATCCTGAGGTGATGTCTGCCTAGC
AACTGACTCAACCTGCTTCTGTGACTTCGTTCTTTTTATTTTTATTTTTTTAACGGGGTGAAAA
CCTCTCTCAGAAGGTACCGTCGCATATCCATGTGAAGCAGATGACTCCCTGCGCACACCTCGGA
CCGTGAGCAACCCGGGCTCCACCGTGTTCAGACGTCGGCTATTCCATGGCTCCGCCTGACCCCC
GAATGCCATTTGCTACCAGGCCAGAACTGCGCTGGCTGGAGGGGGCAGAGACGACAGGAGGGGT
TCTTACCTGCATCCTTCCATGAGGGTGTGGTTCTGTGTTTCATCTCTAACAGAGATGCTACTGC
TTGGTGGCGTTTGTTAGAAATGGGACACATGCCCCTGTCGTGAAGTTTACATGTGACCTTCTTG
TAGGTAACTTGAGTTCGTAGCCTGGGACCCCTGTAATGAAGGTTACAGTCCACAGGTGATAGAG
AAATTCAAGCTGTAAGTTACAGGTGCACTACAAGTGTGTTCATTCAGTTTACCTGGGGGCATGG
AGGTGAGTCAGCTCCACGAGGAAGGAAGCATACCTCTGCCCTCATCAAGGGGACACAGGGTACA
TCCCAGGCATCAGAGAACTGCAGCTCACCTCAAACCATGTCAAAGAATTAAAACACACCCCCAT
CCCCTCACTGTAGCCTTTGGCAACTTCGCCAAACCCTTCACACAAAGAAAATAAAAGTAAGGCG
TATAAATTTCCTCCAGCAAGCCTCGTGCCGAATTC

hide sequence

RefSeq Acc Id:

XM_039089147 ⟹ XP_038945075

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,313,343 - 54,547,279 (-)	NCBI
mRatBN7.2	1	51,770,107 - 51,999,679 (-)	NCBI

RefSeq Acc Id:

XM_039089154 ⟹ XP_038945082

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,313,343 - 54,547,257 (-)	NCBI
mRatBN7.2	1	51,770,107 - 51,999,690 (-)	NCBI

RefSeq Acc Id:

XM_039089160 ⟹ XP_038945088

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,313,343 - 54,764,151 (-)	NCBI
mRatBN7.2	1	51,770,107 - 52,216,507 (-)	NCBI

RefSeq Acc Id:

XM_039089171 ⟹ XP_038945099

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,313,343 - 54,764,189 (-)	NCBI
mRatBN7.2	1	51,770,107 - 52,216,507 (-)	NCBI

RefSeq Acc Id:

XM_039089177 ⟹ XP_038945105

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,313,343 - 54,452,436 (-)	NCBI
mRatBN7.2	1	51,770,107 - 51,904,826 (-)	NCBI

RefSeq Acc Id:

XM_039089181 ⟹ XP_038945109

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,313,343 - 54,452,420 (-)	NCBI
mRatBN7.2	1	51,770,107 - 51,904,826 (-)	NCBI

RefSeq Acc Id:

XM_039089184 ⟹ XP_038945112

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,313,343 - 54,454,121 (-)	NCBI
mRatBN7.2	1	51,770,107 - 51,906,531 (-)	NCBI

RefSeq Acc Id:

XM_039089188 ⟹ XP_038945116

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,313,343 - 54,415,600 (-)	NCBI
mRatBN7.2	1	51,770,107 - 51,868,011 (-)	NCBI

RefSeq Acc Id:

XM_039089191 ⟹ XP_038945119

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,313,343 - 54,373,060 (-)	NCBI
mRatBN7.2	1	51,770,107 - 51,825,465 (-)	NCBI

RefSeq Acc Id:

XM_063272580 ⟹ XP_063128650

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,313,343 - 54,547,274 (-)	NCBI

RefSeq Acc Id:

XM_063272582 ⟹ XP_063128652

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,313,343 - 54,764,150 (-)	NCBI

RefSeq Acc Id:

XM_063272590 ⟹ XP_063128660

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,313,343 - 54,764,150 (-)	NCBI

RefSeq Acc Id:

XR_005491608

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	54,348,522 - 54,547,282 (-)	NCBI
mRatBN7.2	1	51,800,923 - 51,999,679 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001375438	(Get FASTA)	NCBI Sequence Viewer
	NP_001375439	(Get FASTA)	NCBI Sequence Viewer
	NP_001375440	(Get FASTA)	NCBI Sequence Viewer
	NP_071572	(Get FASTA)	NCBI Sequence Viewer
	XP_038945075	(Get FASTA)	NCBI Sequence Viewer
	XP_038945082	(Get FASTA)	NCBI Sequence Viewer
	XP_038945088	(Get FASTA)	NCBI Sequence Viewer
	XP_038945099	(Get FASTA)	NCBI Sequence Viewer
	XP_038945105	(Get FASTA)	NCBI Sequence Viewer
	XP_038945109	(Get FASTA)	NCBI Sequence Viewer
	XP_038945112	(Get FASTA)	NCBI Sequence Viewer
	XP_038945116	(Get FASTA)	NCBI Sequence Viewer
	XP_038945119	(Get FASTA)	NCBI Sequence Viewer
	XP_063128650	(Get FASTA)	NCBI Sequence Viewer
	XP_063128652	(Get FASTA)	NCBI Sequence Viewer
	XP_063128660	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAS21243	(Get FASTA)	NCBI Sequence Viewer
	AAS21244	(Get FASTA)	NCBI Sequence Viewer
	AAS21245	(Get FASTA)	NCBI Sequence Viewer
	AAS21246	(Get FASTA)	NCBI Sequence Viewer
	AAS21247	(Get FASTA)	NCBI Sequence Viewer
	BAA88996	(Get FASTA)	NCBI Sequence Viewer
	BAA88997	(Get FASTA)	NCBI Sequence Viewer
	EDL83102	(Get FASTA)	NCBI Sequence Viewer
	EDL83103	(Get FASTA)	NCBI Sequence Viewer
	EDL83104	(Get FASTA)	NCBI Sequence Viewer
	EDL83105	(Get FASTA)	NCBI Sequence Viewer
	EDL83106	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000042134.2
	ENSRNOP00000060834.4
	ENSRNOP00000086612
	ENSRNOP00000086886
	ENSRNOP00000091632
	ENSRNOP00000091632.1
	ENSRNOP00000104055
	ENSRNOP00000107322
	ENSRNOP00000108193
GenBank Protein	Q9QYJ6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_071572 ⟸ NM_022236
- Peptide Label:	isoform 1
- UniProtKB:	Q6S9E9 (UniProtKB/Swiss-Prot), Q6S9E8 (UniProtKB/Swiss-Prot), Q6S9E7 (UniProtKB/Swiss-Prot), Q6S9E6 (UniProtKB/Swiss-Prot), Q9QYJ5 (UniProtKB/Swiss-Prot), Q9QYJ6 (UniProtKB/Swiss-Prot), A0A8I6G6I2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEDGPSNNASCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRKNNKA EDEPSPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNHLLLYELSSIIRIATKADGFALYFLG ECNNSLCVFTPPGMKEGQPRLIPAGPITQGTTISAYVAKSRKTLLVEDILGDERFPRGTGLESG TRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWASVAIHQVQVCRGLAKQ TELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEK EGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCMPIVS RGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCANMYHRIRHSECIYRVTMEKLSYH SICTSEEWQGLMHFNLPARICRDIELFHFDIGPFENMWPGIFVYMIHRSCGTSCFELEKLCRFI MSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNNGLFTDLERKGLLIACLCHDLDHRGFSNSYLQ KFDHPLAALYSTSTMEQHHFSQTVSILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFG NRKQLEEMYQTGSLNLHNQSHRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMK KLGIQPIPMMDRDKRDEVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLNQWEKVIRG EETAMWISGPATSKSTSEKPTRKVDD hide sequence

Ensembl Acc Id:

ENSRNOP00000042134 ⟸ ENSRNOT00000043474

Ensembl Acc Id:

ENSRNOP00000060834 ⟸ ENSRNOT00000067142

RefSeq Acc Id:	XP_038945099 ⟸ XM_039089171
- Peptide Label:	isoform X5
- UniProtKB:	A6KK14 (UniProtKB/TrEMBL), A0A8I6AI39 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945088 ⟸ XM_039089160
- Peptide Label:	isoform X4
- UniProtKB:	A0A8I6AI39 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945082 ⟸ XM_039089154
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038945075 ⟸ XM_039089147
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038945112 ⟸ XM_039089184
- Peptide Label:	isoform X7
- UniProtKB:	A0A8I6A4Q3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945105 ⟸ XM_039089177
- Peptide Label:	isoform X6
- UniProtKB:	F1LX13 (UniProtKB/TrEMBL), A6KK17 (UniProtKB/TrEMBL), A6KK18 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945109 ⟸ XM_039089181
- Peptide Label:	isoform X7
- UniProtKB:	A0A8I6A4Q3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945116 ⟸ XM_039089188
- Peptide Label:	isoform X7
- UniProtKB:	A0A8I6A4Q3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038945119 ⟸ XM_039089191
- Peptide Label:	isoform X8
- UniProtKB:	A0A8I6A4Q3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001375440 ⟸ NM_001388511
- Peptide Label:	isoform 3
- UniProtKB:	A0A8I6A4Q3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001375438 ⟸ NM_001388509
- Peptide Label:	isoform 2
- UniProtKB:	A6KK15 (UniProtKB/TrEMBL), A6KK18 (UniProtKB/TrEMBL)

RefSeq Acc Id:	NP_001375439 ⟸ NM_001388510
- Peptide Label:	isoform 2
- UniProtKB:	A6KK15 (UniProtKB/TrEMBL), A6KK18 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000086886 ⟸ ENSRNOT00000106865

Ensembl Acc Id:

ENSRNOP00000092661 ⟸ ENSRNOT00000111002

Ensembl Acc Id:

ENSRNOP00000086612 ⟸ ENSRNOT00000102087

Ensembl Acc Id:

ENSRNOP00000081805 ⟸ ENSRNOT00000098030

Ensembl Acc Id:

ENSRNOP00000091632 ⟸ ENSRNOT00000111873

RefSeq Acc Id:	XP_063128660 ⟸ XM_063272590
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6AI39 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063128652 ⟸ XM_063272582
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6AI39 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063128650 ⟸ XM_063272580
- Peptide Label:	isoform X1

Protein Domains

PDEase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QYJ6-F1-model_v2	AlphaFold	Q9QYJ6	1-794	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:68434	AgrOrtholog
BioCyc Gene	G2FUF-61520	BioCyc
Ensembl Genes	ENSRNOG00000011310	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000043474.4	UniProtKB/Swiss-Prot
	ENSRNOT00000067142.5	UniProtKB/Swiss-Prot
	ENSRNOT00000102087	ENTREZGENE
	ENSRNOT00000106865	ENTREZGENE
	ENSRNOT00000111873	ENTREZGENE
	ENSRNOT00000111873.1	UniProtKB/Swiss-Prot
	ENSRNOT00000141864	ENTREZGENE
	ENSRNOT00000160109	ENTREZGENE
	ENSRNOT00000172789	ENTREZGENE
Gene3D-CATH	1.10.1300.10	UniProtKB/Swiss-Prot
	3.30.450.40	UniProtKB/Swiss-Prot
InterPro	GAF	UniProtKB/Swiss-Prot
	GAF-like_dom_sf	UniProtKB/Swiss-Prot
	HD/PDEase_dom	UniProtKB/Swiss-Prot
	PDEase	UniProtKB/Swiss-Prot
	PDEase_catalytic_dom	UniProtKB/Swiss-Prot
	PDEase_catalytic_dom_sf	UniProtKB/Swiss-Prot
	PDEase_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:63885	UniProtKB/Swiss-Prot
NCBI Gene	63885	ENTREZGENE
PANTHER	CYCLIC NUCLEOTIDE PHOSPHODIESTERASE	UniProtKB/Swiss-Prot
Pfam	GAF	UniProtKB/Swiss-Prot
	PDEase_I	UniProtKB/Swiss-Prot
PhenoGen	Pde10a	PhenoGen
PRINTS	PDIESTERASE1	UniProtKB/Swiss-Prot
PROSITE	PDEASE_I_1	UniProtKB/Swiss-Prot
	PDEASE_I_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000011310	RatGTEx
SMART	GAF	UniProtKB/Swiss-Prot
	HDc	UniProtKB/Swiss-Prot
Superfamily-SCOP	GAF domain-like	UniProtKB/Swiss-Prot
	HD-domain/PDEase-like	UniProtKB/Swiss-Prot
TIGR	TC206846
UniProt	A0A8I6A4Q3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AI39	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6G6I2	ENTREZGENE, UniProtKB/TrEMBL
	A6KK14	ENTREZGENE, UniProtKB/TrEMBL
	A6KK15	ENTREZGENE, UniProtKB/TrEMBL
	A6KK17	ENTREZGENE, UniProtKB/TrEMBL
	A6KK18	ENTREZGENE, UniProtKB/TrEMBL
	F1LX13	ENTREZGENE, UniProtKB/TrEMBL
	PDE10_RAT	UniProtKB/Swiss-Prot
	Q6S9E6	ENTREZGENE
	Q6S9E7	ENTREZGENE
	Q6S9E8	ENTREZGENE
	Q6S9E9	ENTREZGENE
	Q9QYJ5	ENTREZGENE
	Q9QYJ6	ENTREZGENE
UniProt Secondary	Q6S9E6	UniProtKB/Swiss-Prot
	Q6S9E7	UniProtKB/Swiss-Prot
	Q6S9E8	UniProtKB/Swiss-Prot
	Q6S9E9	UniProtKB/Swiss-Prot
	Q9QYJ5	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Pde10a	phosphodiesterase 10A			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)