Tnfsf15 (TNF superfamily member 15)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Tnfsf15 (TNF superfamily member 15) Rattus norvegicus

Analyze

Symbol:

Tnfsf15

Name:

TNF superfamily member 15

RGD ID:

628735

Description:

Enables death receptor binding activity. Involved in activation of cysteine-type endopeptidase activity involved in apoptotic process and positive regulation of cytokine production. Predicted to be located in plasma membrane. Orthologous to human TNFSF15 (TNF superfamily member 15); PARTICIPATES IN cytokine mediated signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,4-methylenedioxymethamphetamine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

TNF ligand-related molecule 1; Tnlg1b; tumor necrosis factor (ligand) superfamily, member 15; tumor necrosis factor ligand 1b; tumor necrosis factor ligand superfamily member 15; tumor necrosis factor superfamily member 15; vascular endothelial cell growth inhibitor

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	77,140,099 - 77,156,142 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	77,139,878 - 77,156,228 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	79,536,800 - 79,552,843 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	81,353,990 - 81,370,033 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	81,329,474 - 81,345,517 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	79,553,935 - 79,569,974 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	79,553,742 - 79,570,073 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	83,660,720 - 83,677,388 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	80,700,180 - 80,716,158 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	80,705,292 - 80,721,271 (-)	NCBI
Celera	5	76,073,295 - 76,089,313 (-)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Enteritis (ISO)

Inflammation (ISO)

inflammatory bowel disease (ISO)

inflammatory bowel disease 16 (ISS)

osteoarthritis (ISO)

ulcerative colitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

22-Hydroxycholesterol (ISO)

25-hydroxycholesterol (ISO)

3,4-methylenedioxymethamphetamine (EXP)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aripiprazole (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

buta-1,3-diene (ISO)

cadmium atom (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

clozapine (ISO)

copper atom (EXP)

copper(0) (EXP)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dorsomorphin (ISO)

geldanamycin (ISO)

gentamycin (EXP)

glycidol (EXP)

GW 3965 (ISO)

GW 4064 (ISO)

Licochalcone B (ISO)

lucanthone (ISO)

manganese(II) chloride (EXP)

methotrexate (ISO)

methylisothiazolinone (ISO)

N-methyl-4-phenylpyridinium (EXP)

Nonylphenol (ISO)

o-anisidine (ISO)

ozone (ISO)

p-menthan-3-ol (ISO)

paracetamol (EXP)

PD 0325901 (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenylmercury acetate (ISO)

propanal (ISO)

raloxifene (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

testosterone (EXP,ISO)

titanium dioxide (ISO)

triadimefon (ISO)

trichloroethene (EXP)

valproic acid (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

activation of cysteine-type endopeptidase activity involved in apoptotic process (IBA,IDA,IEA,ISO)

activation of NF-kappaB-inducing kinase activity (IEA,ISO)

apoptotic process (IEA)

immune response (IEA)

positive regulation of cytokine production (IDA)

signal transduction (IEA)

Cellular Component

extracellular region (IEA)

extracellular space (IEA)

membrane (IEA)

plasma membrane (IEA,ISO)

Molecular Function

cytokine activity (IEA)

death receptor binding (IDA)

protein binding (ISO)

tumor necrosis factor receptor binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

cytokine mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	TL1A is a TNF-like ligand for DR3 and TR6/DcR3 and functions as a T cell costimulator.	Migone TS, etal., Immunity 2002 Mar;16(3):479-92.
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:20572782	PMID:26125742	PMID:26646413

Genomics

Comparative Map Data

Tnfsf15
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	77,140,099 - 77,156,142 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	77,139,878 - 77,156,228 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	79,536,800 - 79,552,843 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	81,353,990 - 81,370,033 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	81,329,474 - 81,345,517 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	79,553,935 - 79,569,974 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	79,553,742 - 79,570,073 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	83,660,720 - 83,677,388 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	80,700,180 - 80,716,158 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	80,705,292 - 80,721,271 (-)	NCBI
Celera	5	76,073,295 - 76,089,313 (-)	NCBI		Celera
Cytogenetic Map	5	q24	NCBI

TNFSF15
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	114,784,635 - 114,806,039 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	9	114,784,652 - 114,806,039 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	117,546,915 - 117,568,319 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	116,591,421 - 116,608,229 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	114,631,165 - 114,647,962	NCBI
Celera	9	88,199,259 - 88,215,833 (-)	NCBI		Celera
Cytogenetic Map	9	q32	NCBI
HuRef	9	87,151,524 - 87,173,014 (-)	NCBI		HuRef
CHM1_1	9	117,693,586 - 117,715,078 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	126,977,075 - 126,998,476 (-)	NCBI		T2T-CHM13v2.0

Tnfsf15
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	63,642,837 - 63,663,296 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	63,642,840 - 63,663,350 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	63,724,600 - 63,745,059 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	63,727,084 - 63,745,113 (-)	Ensembl	GRCm38		mm10	GRCm38
GRCm38.p6 Ensembl	4	63,724,603 - 63,745,113 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	63,385,637 - 63,406,147 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	63,213,445 - 63,231,448 (-)	NCBI		MGSCv36	mm8
Celera	4	62,385,254 - 62,405,702 (-)	NCBI		Celera
Cytogenetic Map	4	C1	NCBI

Tnfsf15
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	12,863,615 - 12,879,517 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	12,863,617 - 12,884,498 (+)	NCBI	ChiLan1.0	ChiLan1.0

TNFSF15
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	9	114,243,664 - 114,265,139 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	114,249,472 - 114,265,441 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	9	85,881,800 - 85,904,191 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

TNFSF15
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	68,887,858 - 68,909,406 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	68,893,084 - 68,909,602 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	67,291,777 - 67,310,991 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	70,013,909 - 70,033,147 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	11	68,528,248 - 68,547,440 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	68,569,008 - 68,588,222 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	69,300,208 - 69,319,429 (-)	NCBI		UU_Cfam_GSD_1.0

Tnfsf15
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	184,185,757 - 184,207,492 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936487	3,959,224 - 3,975,959 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TNFSF15
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	255,328,719 - 255,349,539 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	255,328,731 - 255,349,508 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	286,440,650 - 286,461,441 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TNFSF15
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	24,784,185 - 24,801,809 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	24,785,046 - 24,800,692 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666035	18,025,960 - 18,047,188 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tnfsf15
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624760	20,386,113 - 20,403,716 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624760	20,386,025 - 20,408,919 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tnfsf15
48 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	32
Count of miRNA genes:	32
Interacting mature miRNAs:	32
Transcripts:	ENSRNOT00000011845
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
2316954	Rf57	Renal function QTL 57	0		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	59793528	90450144	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
2290005	Mcs24	Mammary carcinoma susceptibility QTL 24			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	64719390	109719390	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
2312671	Scl64	Serum cholesterol level QTL 64		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	68984307	104251008	Rat
61380	Edpm5	Estrogen-dependent pituitary mass QTL 5	4.5	0.92	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	5	68984307	104251008	Rat
1357396	Bw44	Body weight QTL 44	4.19		body mass (VT:0001259)	body weight (CMO:0000012)	5	68984307	104251008	Rat
1357402	Bw46	Body weight QTL 46	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
2302381	Bw84	Body weight QTL 84	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1598845	Mcs14	Mammary carcinoma susceptibility QTL 14		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	76369776	80813390	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low	2		12	1	19	1	6	6	30	31	22	11	6
Below cutoff	1	41	27	22		22	2	4	22	4	18		2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_145765	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF520787	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000161	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LN874406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000011845 ⟹ ENSRNOP00000011845

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	77,139,878 - 77,156,228 (-)	Ensembl
Rnor_6.0 Ensembl	5	79,553,742 - 79,570,073 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000100755 ⟹ ENSRNOP00000090865

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	77,139,878 - 77,156,196 (-)	Ensembl

RefSeq Acc Id:

NM_145765 ⟹ NP_665708

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	77,140,099 - 77,156,142 (-)	NCBI
Rnor_6.0	5	79,553,935 - 79,569,974 (-)	NCBI
Rnor_5.0	5	83,660,720 - 83,677,388 (-)	NCBI
RGSC_v3.4	5	80,700,180 - 80,716,158 (-)	RGD
Celera	5	76,073,295 - 76,089,313 (-)	RGD

Sequence:

show sequence

ATGGCAGAGGAGCTGGGGCTGGGCTTTGGGGAAGCAGTCCCAGTGGAAATGCTGCCGGAAGGCT
GCCGGCACAGGCGAGAGGCCAGGACCGGGCTAGCAGCCAGGAGCAAAGCCTGTTTGGCTCTCAC
CTGCTGCCTGTTATCATTTCCCATCCTCGCAGGACTTAGCACCCTCCTGATGACTGGCCAGCTC
CGGATCCCCGGAAAAGACTGTATGTTTCCGACTGTGACAGAAGAGAGGTCTGCCCCTTCAGCAC
AACCAGTTTACACACCTTCCAGAGACAAGCCAAAAGCCCACCTGACAATTATGAGACAAACTCC
TGTACCACATCTGAAAAATGAACTGGCTGCTCTACACTGGGAGAATAACCTAGGGATGGCCTTC
ACCAAGAACCGAATGAACTACACCAACAAATTCCTGGTGATCCCAGAGTCAGGAGACTATTTCA
TCTACTCCCAGATCACATTCCGAGGAACCACATCTGAGTGTGGTGACATCAGCAGGGTGAGACG
GCCAAAAAAGCCAGACTCCATCACTGTGGTTATCACCAAGGTAGCAGACAGCTACCCTGAGCCT
GCCCACCTCCTTACAGGGACCAAGTCTGTGTGTGAAATAAGCAGCAACTGGTTTCAGCCCATCT
ACCTTGGGGCCATGTTCTCCTTGGAAGAAGGGGACAGGCTGATGGTAAATGTCAGTGACATCTC
CTTGGTGGATTACACAAAAGAAGATAAAACTTTCTTTGGAGCCTTCTTGATATGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_665708	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAM77368	(Get FASTA)	NCBI Sequence Viewer
	CTQ86171	(Get FASTA)	NCBI Sequence Viewer
	EDM10514	(Get FASTA)	NCBI Sequence Viewer
	Q8K3Y7	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_665708 ⟸ NM_145765

- UniProtKB:

Q8K3Y7 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MAEELGLGFGEAVPVEMLPEGCRHRREARTGLAARSKACLALTCCLLSFPILAGLSTLLMTGQL
RIPGKDCMFPTVTEERSAPSAQPVYTPSRDKPKAHLTIMRQTPVPHLKNELAALHWENNLGMAF
TKNRMNYTNKFLVIPESGDYFIYSQITFRGTTSECGDISRVRRPKKPDSITVVITKVADSYPEP
AHLLTGTKSVCEISSNWFQPIYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLI

hide sequence

RefSeq Acc Id:

ENSRNOP00000011845 ⟸ ENSRNOT00000011845

RefSeq Acc Id:

ENSRNOP00000090865 ⟸ ENSRNOT00000100755

Protein Domains

TNF_2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8K3Y7-F1-model_v2	AlphaFold	Q8K3Y7	1-252	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693804

Promoter ID:

EPDNEW_R4328

Type:

single initiation site

Name:

Tnfsf15_1

Description:

TNF superfamily member 15

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	79,570,003 - 79,570,063	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:628735	AgrOrtholog
BioCyc Gene	G2FUF-41054	BioCyc
Ensembl Genes	ENSRNOG00000008930	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000011845	ENTREZGENE
	ENSRNOP00000011845.3	UniProtKB/TrEMBL
	ENSRNOP00000090865.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000011845	ENTREZGENE
	ENSRNOT00000011845.4	UniProtKB/TrEMBL
	ENSRNOT00000100755.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	TNF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TNF_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TNFSF15	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Tumour_necrosis_fac-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:252878	UniProtKB/Swiss-Prot
NCBI Gene	252878	ENTREZGENE
PANTHER	PTHR11471:SF24	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	TNF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Tnfsf15	PhenoGen
PRINTS	TNECROSISFCT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	TNF_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	TNF	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF49842	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0H2UHG9_RAT	UniProtKB/TrEMBL
	A0A8I6AB10_RAT	UniProtKB/TrEMBL
	Q8K3Y7	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-21	Tnfsf15	TNF superfamily member 15	Tnfsf15	tumor necrosis factor superfamily member 15	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-11-25	Tnfsf15	tumor necrosis factor superfamily member 15	Tnfsf15	tumor necrosis factor (ligand) superfamily, member 15	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Tnfsf15	tumor necrosis factor (ligand) superfamily, member 15			Symbol and Name status set to approved	625702	APPROVED
2003-02-27	Tnfsf15	tumor necrosis factor (ligand) superfamily, member 15			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_process	induces NF-kB activation and apoptosis in DR3-expressing cell lines	634236
gene_protein	251 amino acids	634236

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Annotations - KEGG (archival)