Symbol:
Fah
Name:
fumarylacetoacetate hydrolase
RGD ID:
62225
MGI Page
MGI
Description:
Enables fumarylacetoacetase activity. Acts upstream of or within arginine catabolic process. Is expressed in several structures, including alimentary system; central nervous system; eye; genitourinary system; and skeleton. Used to study tyrosinemia type I. Human ortholog(s) of this gene implicated in tyrosinemia type I. Orthologous to human FAH (fumarylacetoacetate hydrolase).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
beta-diketonase; FAA; fumarylacetoacetase; sw; swst
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
FAH (fumarylacetoacetate hydrolase) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Fah (fumarylacetoacetate hydrolase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Fah (fumarylacetoacetate hydrolase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
FAH (fumarylacetoacetate hydrolase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
FAH (fumarylacetoacetate hydrolase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Fah (fumarylacetoacetate hydrolase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
FAH (fumarylacetoacetate hydrolase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
FAH (fumarylacetoacetate hydrolase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Fah (fumarylacetoacetate hydrolase) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Fah (fumarylacetoacetate hydrolase)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
FAH (fumarylacetoacetate hydrolase)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
fah (fumarylacetoacetate hydrolase (fumarylacetoacetase))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Faa
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
fah-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
fah
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 84,234,367 - 84,255,150 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 84,234,367 - 84,255,930 (-) Ensembl GRCm39 Ensembl GRCm38 7 84,585,159 - 84,605,942 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 84,585,159 - 84,606,722 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 91,733,669 - 91,754,452 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 84,461,355 - 84,481,937 (-) NCBI MGSCv36 mm8 Celera 7 81,987,620 - 82,008,470 (-) NCBI Celera Cytogenetic Map 7 D3 NCBI cM Map 7 48.36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Fah Mouse beta-mannosidosis ISO RGD:733367 8554872 ClinVar Annotator: match by term: Beta-D-mannosidosis ClinVar PMID:25741868 Fah Mouse Bloom syndrome ISO RGD:733367 8554872 ClinVar Annotator: match by term: Bloom syndrome ClinVar PMID:28492532 Fah Mouse colorectal cancer ISO RGD:733367 8554872 ClinVar Annotator: match by term: Familial colorectal cancer ClinVar PMID:28492532 Fah Mouse genetic disease ISO RGD:733367 8554872 ClinVar Annotator: match by term: Inborn genetic diseases ClinVar PMID:17576681|PMID:25741868|PMID:28492532|PMID:9536098 Fah Mouse hepatoblastoma ISO RGD:733367 8554872 ClinVar Annotator: match by term: Hepatoblastoma ClinVar Fah Mouse tyrosinemia ISO RGD:733367 8554872 ClinVar Annotator: match by term: FAH deficiency | ClinVar Annotator: match by term: Fumarylacetoacetase deficiency more ... ClinVar PMID:11278491|PMID:11476670|PMID:11754109|PMID:12203990|PMID:14691918|PMID:15187789|PMID:15638932|PMID:16521249|PMID:17576681|PMID:20301688|PMID:21752152|PMID:21764616|PMID:22554029|PMID:22802474|PMID:22975760|PMID:23193487|PMID:23348723|PMID:23430822|PMID:23430836|PMID:23895425|PMID:24016420|PMID:24033266|PMID:24555242|PMID:25081276|PMID:25087612|PMID:25256450|PMID:25525159|PMID:25681080|PMID:25741868|PMID:26565546|PMID:27814443|PMID:28468868|PMID:28492532|PMID:28755182|PMID:28755192|PMID:29326876|PMID:29497141|PMID:30414057|PMID:30581635|PMID:306090409|PMID:31300554|PMID:31568711|PMID:31574857|PMID:31998365|PMID:33083013|PMID:35800472|PMID:7757089|PMID:7929843|PMID:7942842|PMID:7977370|PMID:8028615|PMID:8076937|PMID:8318997|PMID:8557261|PMID:8723690|PMID:8821854|PMID:8829657|PMID:9101289|PMID:9536098|PMID:9633815|PMID:9705236 Fah Mouse tyrosinemia type I ISO RGD:733367 8554872 ClinVar Annotator: match by term: Tyrosinemia type I ClinVar PMID:10073910|PMID:10508789|PMID:11196105|PMID:11278491|PMID:11476670|PMID:11754109|PMID:12203990|PMID:12555948|PMID:1401056|PMID:14691918|PMID:15187789|PMID:15465000|PMID:15638932|PMID:16199547|PMID:16521249|PMID:17576681|PMID:19569981|PMID:19763152|PMID:20301688|PMID:20307669|PMID:21117323|PMID:21752152|PMID:21764616|PMID:22145516|PMID:22406018|PMID:22554029|PMID:22802474|PMID:22884142|PMID:22975760|PMID:23000314|PMID:23193487|PMID:23225041|PMID:23348723|PMID:23430822|PMID:23430836|PMID:23895425|PMID:23927806|PMID:24016420|PMID:24033266|PMID:24516753|PMID:24555242|PMID:24756054|PMID:25081276|PMID:25087612|PMID:25256450|PMID:25525159|PMID:25564536|PMID:25640679|PMID:25681080|PMID:25741868|PMID:26565546|PMID:27093575|PMID:27397503|PMID:27814443|PMID:28039895|PMID:28468868|PMID:28492532|PMID:28755182|PMID:28755192|PMID:29326876|PMID:29497141|PMID:30414057|PMID:30581635|PMID:306090409|PMID:30954369|PMID:31030436|PMID:31300554|PMID:31568711|PMID:31574857|PMID:31965297|PMID:31998365|PMID:32832707|PMID:33083013|PMID:34023347|PMID:35800472|PMID:36393896|PMID:7550234|PMID:7757089|PMID:7929843|PMID:7942842|PMID:7977370|PMID:8005583|PMID:8028615|PMID:8076937|PMID:8162054|PMID:8204664|PMID:8318997|PMID:8364576|PMID:8557261|PMID:8723690|PMID:8723698|PMID:8821854|PMID:8829657|PMID:9101289|PMID:9536098|PMID:9633815|PMID:9705236 Fah Mouse tyrosinemia type II ISO RGD:733367 8554872 ClinVar Annotator: match by term: Tyrosinemia type II ClinVar PMID:14691918|PMID:17576681|PMID:20301688|PMID:22975760|PMID:23193487|PMID:23430822|PMID:25681080|PMID:25741868|PMID:26565546|PMID:28492532|PMID:7942842|PMID:8829657|PMID:9101289|PMID:9536098
Only show annotations with direct experimental evidence (0 objects hidden)
Fah Mouse (+)-schisandrin B multiple interactions ISO RGD:61932 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of FAH mRNA] CTD PMID:31150632 Fah Mouse (S)-nicotine increases expression ISO RGD:733367 6480464 Nicotine results in increased expression of FAH mRNA CTD PMID:23825647 Fah Mouse 1,1-dichloroethene decreases expression EXP 6480464 vinylidene chloride results in decreased expression of FAH mRNA CTD PMID:26682919 Fah Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of FAH mRNA CTD PMID:22206623 Fah Mouse 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of FAH mRNA CTD PMID:16174780 Fah Mouse 17alpha-ethynylestradiol decreases expression ISO RGD:61932 6480464 Ethinyl Estradiol results in decreased expression of FAH mRNA CTD PMID:16174780 Fah Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FAH mRNA CTD PMID:17942748 Fah Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of FAH mRNA CTD PMID:17942748 Fah Mouse 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of FAH mRNA CTD PMID:39298647 Fah Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of FAH mRNA CTD PMID:17942748 Fah Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:61932 6480464 Tetrachlorodibenzodioxin results in increased expression of FAH mRNA CTD PMID:33387578 Fah Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:61932 6480464 Tetrachlorodibenzodioxin results in decreased expression of FAH mRNA CTD PMID:21215274|PMID:21724226 Fah Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of FAH mRNA CTD PMID:21570461 Fah Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:733367 6480464 Tetrachlorodibenzodioxin results in increased expression of FAH mRNA CTD PMID:20106945|PMID:21632981 Fah Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of FAH mRNA CTD PMID:19770486 Fah Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2,2',4,4',5-brominated diphenyl ether affects the expression of FAH mRNA CTD PMID:38648751 Fah Mouse 2,4-dinitrotoluene affects expression ISO RGD:61932 6480464 2,4-dinitrotoluene affects the expression of FAH mRNA CTD PMID:21346803 Fah Mouse 2-methoxyethanol increases expression ISO RGD:61932 6480464 methyl cellosolve results in increased expression of FAH mRNA CTD PMID:19643169 Fah Mouse 3,3',4,4',5-pentachlorobiphenyl decreases expression ISO RGD:61932 6480464 3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of FAH mRNA CTD PMID:23196670 Fah Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:733367 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Fah Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of FAH mRNA CTD PMID:39298647 Fah Mouse 4,4'-sulfonyldiphenol increases expression ISO RGD:733367 6480464 bisphenol S results in increased expression of FAH protein CTD PMID:34186270 Fah Mouse 4,4'-sulfonyldiphenol decreases methylation EXP 6480464 bisphenol S results in decreased methylation of FAH exon CTD PMID:33297965 Fah Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of FAH mRNA CTD PMID:28973697 Fah Mouse 5-fluorouracil multiple interactions ISO RGD:733367 6480464 TP53 protein affects the reaction [Fluorouracil results in decreased expression of FAH mRNA] CTD PMID:15016801 Fah Mouse 6-propyl-2-thiouracil decreases expression ISO RGD:61932 6480464 Propylthiouracil results in decreased expression of FAH mRNA CTD PMID:24780913|PMID:30047161 Fah Mouse acetamide decreases expression ISO RGD:61932 6480464 acetamide results in decreased expression of FAH mRNA CTD PMID:31881176 Fah Mouse acrolein multiple interactions ISO RGD:733367 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Fah Mouse aflatoxin B1 affects expression ISO RGD:733367 6480464 Aflatoxin B1 affects the expression of FAH protein CTD PMID:20106945 Fah Mouse aflatoxin B1 increases methylation ISO RGD:733367 6480464 Aflatoxin B1 results in increased methylation of FAH intron CTD PMID:30157460 Fah Mouse aflatoxin B1 decreases methylation ISO RGD:733367 6480464 Aflatoxin B1 results in decreased methylation of FAH gene CTD PMID:27153756 Fah Mouse aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of FAH mRNA CTD PMID:19770486 Fah Mouse all-trans-retinoic acid increases expression ISO RGD:733367 6480464 Tretinoin results in increased expression of FAH mRNA CTD PMID:33167477 Fah Mouse alpha-pinene multiple interactions ISO RGD:733367 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Fah Mouse alpha-Zearalanol multiple interactions ISO RGD:61932 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of FAH mRNA CTD PMID:35163327 Fah Mouse amitrole decreases expression ISO RGD:61932 6480464 Amitrole results in decreased expression of FAH mRNA CTD PMID:30047161 Fah Mouse ammonium chloride affects expression ISO RGD:61932 6480464 Ammonium Chloride affects the expression of FAH mRNA CTD PMID:16483693 Fah Mouse amphetamine multiple interactions EXP 6480464 Amphetamine inhibits the reaction [MDK gene mutant form results in decreased expression of FAH protein] CTD PMID:23459167 Fah Mouse arotinoid acid multiple interactions ISO RGD:733367 6480464 [4-(2-(5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-naphthalenyl)-1-propenyl)benzoic acid co-treated with Chir 99021 co-treated with 3-(4-pyridyl)-1H-indole co-treated with Hydrocortisone co-treated with EGF more ... CTD PMID:34480604 Fah Mouse arsane multiple interactions ISO RGD:733367 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Fah Mouse arsenic atom multiple interactions ISO RGD:733367 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Fah Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of FAH mRNA CTD PMID:19770486 Fah Mouse benzo[a]pyrene decreases expression ISO RGD:733367 6480464 Benzo(a)pyrene results in decreased expression of FAH mRNA CTD PMID:32234424 Fah Mouse benzo[a]pyrene multiple interactions ISO RGD:733367 6480464 [Soot co-treated with Benzo(a)pyrene] results in increased expression of FAH protein CTD PMID:24464499 Fah Mouse benzo[a]pyrene increases expression ISO RGD:733367 6480464 Benzo(a)pyrene results in increased expression of FAH mRNA CTD PMID:20106945|PMID:21632981|PMID:30453624 Fah Mouse benzo[e]pyrene increases methylation ISO RGD:733367 6480464 benzo(e)pyrene results in increased methylation of FAH intron CTD PMID:30157460 Fah Mouse benzoates increases expression ISO RGD:733367 6480464 Benzoates analog results in increased expression of FAH mRNA CTD PMID:29472718 Fah Mouse bis(2-ethylhexyl) phthalate multiple interactions ISO RGD:61932 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of FAH more ... CTD PMID:23359474 Fah Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of FAH mRNA CTD PMID:34319233 Fah Mouse bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Fah Mouse bisphenol A multiple interactions ISO RGD:61932 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of FAH more ... CTD PMID:23359474 Fah Mouse bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of FAH protein CTD PMID:35999755 Fah Mouse bisphenol A decreases expression ISO RGD:733367 6480464 bisphenol A results in decreased expression of FAH protein CTD PMID:34186270 Fah Mouse bisphenol A decreases expression ISO RGD:61932 6480464 bisphenol A results in decreased expression of FAH protein CTD PMID:32145629 Fah Mouse bisphenol A increases methylation ISO RGD:61932 6480464 bisphenol A results in increased methylation of FAH gene CTD PMID:28505145 Fah Mouse bisphenol A multiple interactions ISO RGD:733367 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Fah Mouse bisphenol A increases expression ISO RGD:61932 6480464 bisphenol A results in increased expression of FAH mRNA CTD PMID:25181051 Fah Mouse bisphenol AF increases expression ISO RGD:733367 6480464 bisphenol AF results in increased expression of FAH protein CTD PMID:34186270 Fah Mouse Bisphenol B increases expression ISO RGD:733367 6480464 bisphenol B results in increased expression of FAH protein CTD PMID:34186270 Fah Mouse bisphenol F increases expression ISO RGD:733367 6480464 bisphenol F results in increased expression of FAH protein CTD PMID:34186270 Fah Mouse bromobenzene affects binding ISO RGD:61932 6480464 bromobenzene metabolite binds to FAH protein CTD PMID:17305373 Fah Mouse Butylbenzyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Fah Mouse butyric acid affects splicing ISO RGD:733367 6480464 Butyric Acid affects the splicing of FAH mutant form CTD PMID:23895425 Fah Mouse cadmium atom multiple interactions ISO RGD:733367 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of FAH more ... CTD PMID:35301059 Fah Mouse cadmium dichloride increases expression ISO RGD:733367 6480464 Cadmium Chloride results in increased expression of FAH protein CTD PMID:24527689 Fah Mouse cadmium dichloride multiple interactions ISO RGD:733367 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of FAH more ... CTD PMID:35301059 Fah Mouse CGP 52608 multiple interactions ISO RGD:733367 6480464 CGP 52608 promotes the reaction [RORA protein binds to FAH gene] CTD PMID:28238834 Fah Mouse CHIR 99021 multiple interactions ISO RGD:733367 6480464 [4-(2-(5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-naphthalenyl)-1-propenyl)benzoic acid co-treated with Chir 99021 co-treated with 3-(4-pyridyl)-1H-indole co-treated with Hydrocortisone co-treated with EGF more ... CTD PMID:34480604 Fah Mouse cisplatin increases expression ISO RGD:61932 6480464 Cisplatin results in increased expression of FAH protein CTD PMID:25677510 Fah Mouse cisplatin increases expression ISO RGD:733367 6480464 Cisplatin results in increased expression of FAH mRNA CTD PMID:27392435 Fah Mouse cisplatin multiple interactions ISO RGD:733367 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of FAH mRNA CTD PMID:27392435 Fah Mouse clofibrate decreases expression EXP 6480464 Clofibrate results in decreased expression of FAH mRNA CTD PMID:17585979 Fah Mouse clofibrate decreases expression ISO RGD:61932 6480464 Clofibrate results in decreased expression of FAH protein CTD PMID:16470657 Fah Mouse clofibrate multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of FAH mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Fah Mouse cobalt dichloride decreases expression ISO RGD:61932 6480464 cobaltous chloride results in decreased expression of FAH mRNA CTD PMID:24386269 Fah Mouse cortisol multiple interactions ISO RGD:733367 6480464 [4-(2-(5,6,7,8-tetrahydro-5,5,8,8-tetramethyl-2-naphthalenyl)-1-propenyl)benzoic acid co-treated with Chir 99021 co-treated with 3-(4-pyridyl)-1H-indole co-treated with Hydrocortisone co-treated with EGF more ... CTD PMID:34480604 Fah Mouse coumestrol increases expression ISO RGD:733367 6480464 Coumestrol results in increased expression of FAH mRNA CTD PMID:19167446 Fah Mouse Cuprizon decreases expression ISO RGD:61932 6480464 Cuprizone results in decreased expression of FAH mRNA CTD PMID:27523638 Fah Mouse cyclosporin A decreases expression ISO RGD:733367 6480464 Cyclosporine results in decreased expression of FAH mRNA CTD PMID:20106945|PMID:22147139|PMID:23830897|PMID:27989131 Fah Mouse cyclosporin A decreases expression EXP 6480464 Cyclosporine results in decreased expression of FAH mRNA CTD PMID:19770486|PMID:23830897 Fah Mouse cyproconazole decreases expression EXP 6480464 cyproconazole results in decreased expression of FAH mRNA CTD PMID:22334560 Fah Mouse DDE increases expression ISO RGD:733367 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of FAH mRNA CTD PMID:38568856 Fah Mouse dexamethasone increases expression ISO RGD:61932 6480464 Dexamethasone results in increased expression of FAH mRNA CTD PMID:20032058 Fah Mouse dexamethasone multiple interactions ISO RGD:733367 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Fah Mouse dexamethasone multiple interactions ISO RGD:61932 6480464 Testosterone inhibits the reaction [Dexamethasone results in increased expression of FAH mRNA] CTD PMID:20032058 Fah Mouse dibutyl phthalate decreases expression ISO RGD:61932 6480464 Dibutyl Phthalate results in decreased expression of FAH mRNA CTD PMID:21266533 Fah Mouse dibutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Fah Mouse dibutyl phthalate multiple interactions ISO RGD:61932 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of FAH more ... CTD PMID:23359474 Fah Mouse diethyl maleate affects expression ISO RGD:733367 6480464 diethyl maleate affects the expression of FAH mRNA CTD PMID:34480604 Fah Mouse diethyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Fah Mouse diisobutyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Fah Mouse diisononyl phthalate multiple interactions EXP 6480464 [diethyl phthalate co-treated with Diethylhexyl Phthalate co-treated with diisononyl phthalate co-treated with Dibutyl Phthalate co-treated more ... CTD PMID:39150890 Fah Mouse dorsomorphin multiple interactions ISO RGD:733367 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Fah Mouse endosulfan decreases expression ISO RGD:61932 6480464 Endosulfan results in decreased expression of FAH mRNA CTD PMID:29391264 Fah Mouse epoxiconazole decreases expression EXP 6480464 epoxiconazole results in decreased expression of FAH mRNA CTD PMID:22334560 Fah Mouse ethylisopropylamiloride affects splicing ISO RGD:733367 6480464 ethylisopropylamiloride affects the splicing of FAH mutant form CTD PMID:23895425 Fah Mouse fenofibrate increases expression ISO RGD:733367 6480464 Fenofibrate results in increased expression of FAH mRNA CTD PMID:25572481 Fah Mouse fenthion decreases expression EXP 6480464 Fenthion results in decreased expression of FAH mRNA CTD PMID:34813904 Fah Mouse flutamide decreases expression ISO RGD:61932 6480464 Flutamide results in decreased expression of FAH mRNA CTD PMID:24793618 Fah Mouse folic acid decreases expression EXP 6480464 Folic Acid results in decreased expression of FAH mRNA CTD PMID:25629700 Fah Mouse fumonisin B1 decreases expression EXP 6480464 fumonisin B1 results in decreased expression of FAH mRNA CTD PMID:16221962 Fah Mouse furan increases methylation ISO RGD:61932 6480464 furan results in increased methylation of FAH gene CTD PMID:22079235 Fah Mouse GSK-J4 decreases expression ISO RGD:733367 6480464 GSK-J4 results in decreased expression of FAH mRNA CTD PMID:29301935 Fah Mouse indometacin multiple interactions ISO RGD:733367 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ... CTD PMID:28628672 Fah Mouse ivermectin decreases expression ISO RGD:733367 6480464 Ivermectin results in decreased expression of FAH protein CTD PMID:32959892 Fah Mouse L-ascorbic acid multiple interactions ISO RGD:733367 6480464 [[Ascorbic Acid co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein co-treated with more ... CTD PMID:34480604 Fah Mouse L-ascorbic acid 2-phosphate multiple interactions ISO RGD:733367 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA more ... CTD PMID:34480604 Fah Mouse lead diacetate increases expression ISO RGD:61932 6480464 lead acetate results in increased expression of FAH mRNA CTD PMID:22641619 Fah Mouse manganese atom multiple interactions ISO RGD:733367 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Fah Mouse manganese(0) multiple interactions ISO RGD:733367 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Fah Mouse manganese(II) chloride multiple interactions ISO RGD:733367 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Fah Mouse methamphetamine decreases expression ISO RGD:61932 6480464 Methamphetamine results in decreased expression of FAH mRNA CTD PMID:19564919 Fah Mouse methapyrilene decreases expression ISO RGD:61932 6480464 Methapyrilene results in decreased expression of FAH mRNA CTD PMID:30467583 Fah Mouse methapyrilene increases methylation ISO RGD:733367 6480464 Methapyrilene results in increased methylation of FAH intron CTD PMID:30157460 Fah Mouse methidathion increases expression EXP 6480464 methidathion results in increased expression of FAH mRNA CTD PMID:34813904 Fah Mouse methimazole decreases expression ISO RGD:61932 6480464 Methimazole results in decreased expression of FAH mRNA CTD PMID:30047161 Fah Mouse methylmercury chloride decreases expression ISO RGD:733367 6480464 methylmercuric chloride results in decreased expression of FAH mRNA CTD PMID:27188386 Fah Mouse mifepristone decreases expression ISO RGD:733367 6480464 Mifepristone results in decreased expression of FAH mRNA CTD PMID:17584828 Fah Mouse mono(2-ethylhexyl) phthalate decreases expression ISO RGD:733367 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of FAH mRNA CTD PMID:38685446 Fah Mouse N-ethyl-N-nitrosourea increases mutagenesis EXP 6480464 Ethylnitrosourea results in increased mutagenesis of FAH gene CTD PMID:16180137|PMID:16724327 Fah Mouse N-nitrosodimethylamine increases expression ISO RGD:733367 6480464 Dimethylnitrosamine results in increased expression of FAH mRNA CTD PMID:17547211 Fah Mouse nicotine increases expression ISO RGD:733367 6480464 Nicotine results in increased expression of FAH mRNA CTD PMID:23825647 Fah Mouse nitrofen increases expression ISO RGD:61932 6480464 nitrofen results in increased expression of FAH mRNA CTD PMID:33484710 Fah Mouse okadaic acid decreases expression ISO RGD:733367 6480464 Okadaic Acid results in decreased expression of FAH mRNA; Okadaic Acid results in decreased expression more ... CTD PMID:38832940 Fah Mouse ozone multiple interactions ISO RGD:733367 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Fah Mouse paracetamol multiple interactions EXP 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of FAH mRNA; PPARA affects the reaction [[Clofibrate more ... CTD PMID:17585979 Fah Mouse paracetamol decreases expression ISO RGD:61932 6480464 Acetaminophen results in decreased expression of FAH mRNA CTD PMID:33387578 Fah Mouse paracetamol decreases expression ISO RGD:733367 6480464 Acetaminophen results in decreased expression of FAH mRNA CTD PMID:29067470 Fah Mouse paracetamol increases secretion EXP 6480464 Acetaminophen results in increased secretion of FAH protein CTD PMID:24038040 Fah Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of FAH mRNA CTD PMID:17562736 Fah Mouse paracetamol affects expression ISO RGD:61932 6480464 Acetaminophen affects the expression of FAH protein CTD PMID:16687475 Fah Mouse perfluorobutanesulfonic acid increases expression ISO RGD:733367 6480464 perfluorobutanesulfonic acid results in increased expression of FAH mRNA CTD PMID:33772556 Fah Mouse perfluorooctane-1-sulfonic acid increases expression ISO RGD:733367 6480464 perfluorooctane sulfonic acid results in increased expression of FAH mRNA CTD PMID:27153767|PMID:33772556 Fah Mouse perfluorooctanoic acid multiple interactions ISO RGD:61932 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of FAH mRNA CTD PMID:35163327 Fah Mouse perfluorooctanoic acid increases expression ISO RGD:733367 6480464 perfluorooctanoic acid results in increased expression of FAH mRNA CTD PMID:33772556 Fah Mouse pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of FAH mRNA CTD PMID:17426115 Fah Mouse pirinixic acid multiple interactions ISO RGD:733367 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in more ... CTD PMID:19710929 Fah Mouse propiconazole decreases expression EXP 6480464 propiconazole results in decreased expression of FAH mRNA CTD PMID:21278054|PMID:22334560 Fah Mouse pyrogallol decreases expression EXP 6480464 Pyrogallol results in decreased expression of FAH mRNA CTD PMID:20362636 Fah Mouse pyrogallol multiple interactions EXP 6480464 Silymarin inhibits the reaction [Pyrogallol results in decreased expression of FAH mRNA] CTD PMID:20362636 Fah Mouse quercetin decreases expression ISO RGD:733367 6480464 Quercetin results in decreased expression of FAH mRNA CTD PMID:21632981 Fah Mouse resveratrol affects splicing ISO RGD:733367 6480464 resveratrol affects the splicing of FAH mutant form CTD PMID:23895425 Fah Mouse rotenone increases expression ISO RGD:61932 6480464 Rotenone results in increased expression of FAH mRNA CTD PMID:19013527 Fah Mouse SB 431542 multiple interactions ISO RGD:733367 6480464 [LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with EGF protein co-treated with FGF2 protein] results in more ... CTD PMID:27188386|PMID:34480604 Fah Mouse sodium arsenite increases expression ISO RGD:61932 6480464 sodium arsenite results in increased expression of FAH protein CTD PMID:29459688 Fah Mouse sodium arsenite multiple interactions ISO RGD:733367 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased more ... CTD PMID:39836092 Fah Mouse sodium dichromate affects expression ISO RGD:61932 6480464 sodium bichromate affects the expression of FAH mRNA CTD PMID:22110744 Fah Mouse sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of FAH mRNA CTD PMID:31558096 Fah Mouse sodium dodecyl sulfate decreases expression ISO RGD:733367 6480464 Sodium Dodecyl Sulfate results in decreased expression of FAH mRNA CTD PMID:31734321 Fah Mouse sulfadimethoxine decreases expression ISO RGD:61932 6480464 Sulfadimethoxine results in decreased expression of FAH mRNA CTD PMID:30047161 Fah Mouse tauroursodeoxycholic acid decreases expression ISO RGD:61932 6480464 ursodoxicoltaurine results in decreased expression of FAH mRNA CTD PMID:15885361 Fah Mouse temozolomide decreases expression ISO RGD:733367 6480464 Temozolomide results in decreased expression of FAH mRNA CTD PMID:31758290 Fah Mouse tert-butyl hydroperoxide decreases expression ISO RGD:61932 6480464 tert-Butylhydroperoxide results in decreased expression of FAH protein CTD PMID:24394546 Fah Mouse testosterone multiple interactions ISO RGD:61932 6480464 Testosterone inhibits the reaction [Dexamethasone results in increased expression of FAH mRNA] CTD PMID:20032058 Fah Mouse testosterone multiple interactions EXP 6480464 1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane inhibits the reaction [Testosterone deficiency results in decreased expression of FAH mRNA] CTD PMID:33848595 Fah Mouse testosterone decreases expression EXP 6480464 Testosterone deficiency results in decreased expression of FAH mRNA CTD PMID:33848595 Fah Mouse tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of FAH mRNA CTD PMID:17484886 Fah Mouse tetrachloromethane decreases expression ISO RGD:61932 6480464 Carbon Tetrachloride results in decreased expression of FAH mRNA CTD PMID:31150632 Fah Mouse tetrachloromethane multiple interactions ISO RGD:61932 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of FAH mRNA] CTD PMID:31150632 Fah Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of FAH mRNA CTD PMID:27339419|PMID:31919559 Fah Mouse tetrahydropalmatine decreases expression ISO RGD:733367 6480464 tetrahydropalmatine results in decreased expression of FAH protein CTD PMID:20109541 Fah Mouse thimerosal decreases expression ISO RGD:733367 6480464 Thimerosal results in decreased expression of FAH mRNA CTD PMID:27188386 Fah Mouse thioacetamide decreases expression ISO RGD:61932 6480464 Thioacetamide results in decreased expression of FAH mRNA CTD PMID:34492290 Fah Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of FAH mRNA CTD PMID:23557971 Fah Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of FAH gene; titanium dioxide results in decreased methylation more ... CTD PMID:35295148 Fah Mouse triadimefon decreases expression ISO RGD:61932 6480464 triadimefon results in decreased expression of FAH mRNA CTD PMID:30047161 Fah Mouse trichostatin A increases expression ISO RGD:733367 6480464 trichostatin A results in increased expression of FAH mRNA CTD PMID:24935251 Fah Mouse triclosan increases expression ISO RGD:733367 6480464 Triclosan results in increased expression of FAH mRNA CTD PMID:30510588 Fah Mouse triphenyl phosphate affects expression ISO RGD:733367 6480464 triphenyl phosphate affects the expression of FAH mRNA CTD PMID:37042841 Fah Mouse tris(2-butoxyethyl) phosphate affects expression ISO RGD:733367 6480464 tris(2-butoxyethyl) phosphate affects the expression of FAH mRNA CTD PMID:29024780 Fah Mouse troglitazone increases expression ISO RGD:61932 6480464 troglitazone results in increased expression of FAH protein CTD PMID:21315101 Fah Mouse urethane decreases expression ISO RGD:733367 6480464 Urethane results in decreased expression of FAH mRNA CTD PMID:28818685 Fah Mouse valproic acid decreases methylation ISO RGD:733367 6480464 Valproic Acid results in decreased methylation of FAH gene CTD PMID:29154799|PMID:29501571 Fah Mouse valproic acid decreases expression ISO RGD:733367 6480464 Valproic Acid results in decreased expression of FAH mRNA; Valproic Acid results in decreased expression more ... CTD PMID:29501571 Fah Mouse valproic acid increases expression ISO RGD:733367 6480464 Valproic Acid results in increased expression of FAH mRNA CTD PMID:19101580|PMID:23179753|PMID:24383497|PMID:24935251|PMID:26272509|PMID:27188386|PMID:28001369 Fah Mouse valproic acid multiple interactions ISO RGD:733367 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ... CTD PMID:27188386 Fah Mouse valproic acid affects expression ISO RGD:733367 6480464 Valproic Acid affects the expression of FAH mRNA CTD PMID:25979313 Fah Mouse valproic acid increases expression ISO RGD:61932 6480464 Valproic Acid results in increased expression of FAH mRNA CTD PMID:23665938 Fah Mouse vancomycin increases expression EXP 6480464 Vancomycin results in increased expression of FAH mRNA CTD PMID:18930951 Fah Mouse vorinostat decreases expression ISO RGD:733367 6480464 vorinostat results in decreased expression of FAH protein CTD PMID:20543569 Fah Mouse XAV939 multiple interactions ISO RGD:733367 6480464 [[ascorbate-2-phosphate co-treated with Chir 99021 co-treated with XAV939 co-treated with BMP4 protein] co-treated with [INHBA more ... CTD PMID:34480604
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(+)-schisandrin B (ISO) (S)-nicotine (ISO) 1,1-dichloroethene (EXP) 1,2-dimethylhydrazine (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2,4-dinitrotoluene (ISO) 2-methoxyethanol (ISO) 3,3',4,4',5-pentachlorobiphenyl (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (EXP) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (ISO) acetamide (ISO) acrolein (ISO) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) alpha-Zearalanol (ISO) amitrole (ISO) ammonium chloride (ISO) amphetamine (EXP) arotinoid acid (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (EXP,ISO) benzo[e]pyrene (ISO) benzoates (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bromobenzene (ISO) Butylbenzyl phthalate (EXP) butyric acid (ISO) cadmium atom (ISO) cadmium dichloride (ISO) CGP 52608 (ISO) CHIR 99021 (ISO) cisplatin (ISO) clofibrate (EXP,ISO) cobalt dichloride (ISO) cortisol (ISO) coumestrol (ISO) Cuprizon (ISO) cyclosporin A (EXP,ISO) cyproconazole (EXP) DDE (ISO) dexamethasone (ISO) dibutyl phthalate (EXP,ISO) diethyl maleate (ISO) diethyl phthalate (EXP) diisobutyl phthalate (EXP) diisononyl phthalate (EXP) dorsomorphin (ISO) endosulfan (ISO) epoxiconazole (EXP) ethylisopropylamiloride (ISO) fenofibrate (ISO) fenthion (EXP) flutamide (ISO) folic acid (EXP) fumonisin B1 (EXP) furan (ISO) GSK-J4 (ISO) indometacin (ISO) ivermectin (ISO) L-ascorbic acid (ISO) L-ascorbic acid 2-phosphate (ISO) lead diacetate (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methamphetamine (ISO) methapyrilene (ISO) methidathion (EXP) methimazole (ISO) methylmercury chloride (ISO) mifepristone (ISO) mono(2-ethylhexyl) phthalate (ISO) N-ethyl-N-nitrosourea (EXP) N-nitrosodimethylamine (ISO) nicotine (ISO) nitrofen (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (EXP,ISO) perfluorobutanesulfonic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) pirinixic acid (EXP,ISO) propiconazole (EXP) pyrogallol (EXP) quercetin (ISO) resveratrol (ISO) rotenone (ISO) SB 431542 (ISO) sodium arsenite (ISO) sodium dichromate (EXP,ISO) sodium dodecyl sulfate (ISO) sulfadimethoxine (ISO) tauroursodeoxycholic acid (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (EXP,ISO) tetrachloromethane (EXP,ISO) tetrahydropalmatine (ISO) thimerosal (ISO) thioacetamide (ISO) titanium dioxide (EXP) triadimefon (ISO) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) tris(2-butoxyethyl) phosphate (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) vancomycin (EXP) vorinostat (ISO) XAV939 (ISO)
1.
Point mutations in the murine fumarylacetoacetate hydrolase gene: Animal models for the human genetic disorder hereditary tyrosinemia type 1.
Aponte JL, etal., Proc Natl Acad Sci U S A 2001 Jan 16;98(2):641-5.
2.
Silent Tyrosinemia Type I Without Elevated Tyrosine or Succinylacetone Associated with Liver Cirrhosis and Hepatocellular Carcinoma.
Blackburn PR, etal., Hum Mutat. 2016 Oct;37(10):1097-105. doi: 10.1002/humu.23047. Epub 2016 Aug 8.
3.
Dendrimer-Based Lipid Nanoparticles Deliver Therapeutic FAH mRNA to Normalize Liver Function and Extend Survival in a Mouse Model of Hepatorenal Tyrosinemia Type I.
Cheng Q, etal., Adv Mater. 2018 Dec;30(52):e1805308. doi: 10.1002/adma.201805308. Epub 2018 Oct 25.
4.
Complete rescue of lethal albino c14CoS mice by null mutation of 4-hydroxyphenylpyruvate dioxygenase and induction of apoptosis of hepatocytes in these mice by in vivo retrieval of the tyrosine catabolic pathway.
Endo F, etal., J Biol Chem 1997 Sep 26;272(39):24426-32.
5.
Pharmacological correction of neonatal lethal hepatic dysfunction in a murine model of hereditary tyrosinaemia type I.
Grompe M, etal., Nat Genet 1995 Aug;10(4):453-60.
6.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
7.
MGDs mouse GO annotations
MGD data from the GO Consortium
8.
MGD IEA
MGD IEA
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
12.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Cas9-nickase-mediated genome editing corrects hereditary tyrosinemia in rats.
Shao Y, etal., J Biol Chem. 2018 May 4;293(18):6883-6892. doi: 10.1074/jbc.RA117.000347. Epub 2018 Mar 5.
16.
Identification of hypertension-related genes through an integrated genomic-transcriptomic approach.
Yagil C, etal., Circ Res. 2005 Apr 1;96(6):617-25. Epub 2005 Feb 24.
17.
Efficient liver repopulation of transplanted hepatocyte prevents cirrhosis in a rat model of hereditary tyrosinemia type I.
Zhang L, etal., Sci Rep. 2016 Aug 11;6:31460. doi: 10.1038/srep31460.
Fah Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 7 84,234,367 - 84,255,150 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 7 84,234,367 - 84,255,930 (-) Ensembl GRCm39 Ensembl GRCm38 7 84,585,159 - 84,605,942 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 7 84,585,159 - 84,606,722 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 7 91,733,669 - 91,754,452 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 7 84,461,355 - 84,481,937 (-) NCBI MGSCv36 mm8 Celera 7 81,987,620 - 82,008,470 (-) NCBI Celera Cytogenetic Map 7 D3 NCBI cM Map 7 48.36 NCBI
FAH Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 15 80,152,789 - 80,186,949 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 15 80,152,490 - 80,186,946 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 15 80,445,131 - 80,479,291 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 15 78,232,396 - 78,265,737 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 15 78,232,395 - 78,265,737 NCBI Celera 15 57,382,789 - 57,416,130 (+) NCBI Celera Cytogenetic Map 15 q25.1 NCBI HuRef 15 57,208,400 - 57,236,922 (+) NCBI HuRef CHM1_1 15 80,563,191 - 80,596,880 (+) NCBI CHM1_1 T2T-CHM13v2.0 15 78,016,209 - 78,050,378 (+) NCBI T2T-CHM13v2.0
Fah Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 147,957,931 - 147,980,708 (-) NCBI GRCr8 mRatBN7.2 1 138,548,830 - 138,571,599 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 138,548,834 - 138,571,505 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 146,501,260 - 146,524,074 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 153,670,263 - 153,693,077 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 146,545,471 - 146,568,281 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 146,713,663 - 146,736,339 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 146,713,676 - 146,736,261 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 147,640,316 - 147,662,920 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 140,851,975 - 140,876,187 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 140,930,382 - 140,954,593 (-) NCBI Celera 1 130,566,888 - 130,589,532 (-) NCBI Celera Cytogenetic Map 1 q31 NCBI
Fah Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955533 904,295 - 921,730 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955533 904,294 - 921,730 (+) NCBI ChiLan1.0 ChiLan1.0
FAH Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 16 69,406,972 - 69,440,591 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 15 73,571,710 - 73,605,514 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 15 59,121,657 - 59,155,229 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 15 78,081,523 - 78,115,169 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 15 78,048,571 - 78,115,098 (+) Ensembl panpan1.1 panPan2
FAH Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 57,300,422 - 57,326,546 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 57,300,441 - 57,326,486 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 59,958,877 - 59,985,019 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 57,726,930 - 57,753,060 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 57,702,957 - 57,753,270 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 57,232,805 - 57,258,945 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 57,439,515 - 57,465,634 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 57,786,369 - 57,812,502 (-) NCBI UU_Cfam_GSD_1.0
Fah Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 120,292,223 - 120,326,410 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936471 38,140,273 - 38,174,702 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936471 38,140,324 - 38,174,472 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
FAH Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 49,047,902 - 49,087,783 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 49,047,833 - 49,087,790 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 54,556,153 - 54,596,338 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
FAH Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 26 3,223,327 - 3,259,367 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 26 3,223,079 - 3,258,657 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666048 138,616,632 - 138,652,526 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Fah
.
Predicted Target Of
Count of predictions: 553 Count of miRNA genes: 387 Interacting mature miRNAs: 437 Transcripts: ENSMUST00000032865, ENSMUST00000128460, ENSMUST00000134390, ENSMUST00000153126 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
25314307 Mlh1fc2_m MLH1 foci count 2 (mouse) 7 6502999 133501729 Mouse 27226781 Tibl3_m tibia length 3, 5 week (mouse) 7 74849748 122199223 Mouse 25314305 Vmm6_m variable multisystem mineralization 6, eye (mouse) 7 61849748 102749207 Mouse 27226778 Femd11_m femur midshaft diameter 11, 16 week (mouse) 7 56949748 134001729 Mouse 26884381 Bzwq2_m bi-zygomatic width QTL 2, 5 week (mouse) 7 65249748 96949207 Mouse 1301784 Ses2_m salmonella enteritidis susceptibility 2 (mouse) Not determined 7 67290094 101290240 Mouse 1301663 Skull9_m skull morphology 9 (mouse) Not determined 7 57326121 91326352 Mouse 14746989 Manh62_m mandible shape 62 (mouse) 7 75742528 109742528 Mouse 10043926 Bw1n_m body weight 1 in NSY (mouse) Not determined 7 45161966 118693530 Mouse 27226765 Tibl18_m tibia length 18, 16 week (mouse) 7 81849748 126499172 Mouse 1301383 Aem2_m anti-erythrocyte autoantibody modifier 2 (mouse) Not determined 7 64135424 98135653 Mouse 1301514 Rigs1_m radiation induced gastroschisis 1 (mouse) Not determined 7 36280015 92394346 Mouse 4142500 Morq1_m modifier of Rs1 QTL 1 (mouse) Not determined 80551681 114551791 Mouse 27095937 Ulnl7_m ulna length 7, 10 week (mouse) 7 66449748 98349207 Mouse 11565101 Tsve1_m variable short tail (Tsv) enhancer 1 (mouse) 7 55889508 87142720 Mouse 1300620 Pgia21_m proteoglycan induced arthritis 21 (mouse) Not determined 7 67290094 101290240 Mouse 13208555 Lgth10_m body length 10 (mouse) 7 51649748 125599172 Mouse 26884408 Bzwq13_m bi-zygomatic width QTL 13, 16 week (mouse) 7 61749748 121399223 Mouse 1300791 Abbp3_m A/J and C57BL/6 blood pressure 3 (mouse) Not determined 7 39673887 103510010 Mouse 10054064 Bwq11_m body weight QTL 11 (mouse) Not determined 7 51124954 85125093 Mouse 10053685 Eae43_m experimental allergic encephalomyelitis susceptibility 43 (mouse) Not determined 7 51124954 85125093 Mouse 1301566 Adip3_m adiposity 3 (mouse) Not determined 7 75394215 109394346 Mouse 26884404 Huml1_m humerus length 1, 5 week (mouse) 7 30199425 108999207 Mouse 1301155 Bpq7_m blood pressure QTL 7 (mouse) Not determined 7 70143137 104143379 Mouse 26884398 Humsd6_m humerus midshaft diameter 6, 16 week (mouse) 7 78649748 136901729 Mouse 1301158 Eae4_m susceptibility to experimental allergic encephalomyelitis 4 (mouse) Not determined 7 19147398 141919804 Mouse 10412199 Sst2_m susceptibility to tuberculosis 2 (mouse) Not determined 7 18728794 119485380 Mouse 4142212 Png1_m Postnatal growth 1 (mouse) Not determined 74326121 92394346 Mouse 1300654 Bomd1_m bone mineral density 1 (mouse) Not determined 7 68365595 102365702 Mouse 26884440 Sklq4_m skull length QTL 4, 5 week (mouse) 7 65249748 126499172 Mouse 27095903 Scvln10_m sacral vertebrae length 2, 10 week (mouse) 7 81449748 126499172 Mouse 27226715 Metcl3_m metatarsal-calcaneal length 3, 5 week (mouse) 7 67849748 119499223 Mouse 26884444 Sklq8_m skull length QTL 8, 10 week (mouse) 7 67849748 124199223 Mouse 25823170 Hrsq7_m host response to SARS QTL 7, log titer (mouse) 7 54819589 116822815 Mouse 1301082 Bbaa16_m B.burgdorferi-associated arthritis 16 (mouse) Not determined 7 36280015 116416877 Mouse 1301465 Egrm3_m early growth rate (mouse) Not determined 7 57326121 91326352 Mouse 1300952 Hcs1_m hepatocarcinogenesis susceptibility 1 (mouse) Not determined 7 57326121 91326352 Mouse 4142319 Powg_m post-ovarectomy weight gain (mouse) Not determined 72857105 92582163 Mouse 10412110 Cctq1_m central corneal thickness QTL 1 (mouse) Not determined 7 80551681 114551791 Mouse 12792978 Fbmd3_m femoral bone mineral density 3, females only (mouse) 7 7050288 142367832 Mouse 1301826 Pgia3_m proteoglycan induced arthritis 3 (mouse) Not determined 7 67290094 101290240 Mouse 26884418 Bzwq7_m bi-zygomatic width QTL 7, 10 week (mouse) 7 67849748 105449207 Mouse 10043973 Obq29_m obesity QTL 29 (mouse) Not determined 7 72263372 106263372 Mouse 27226751 Femd5_m femur midshaft diameter 5, 10 week (mouse) 7 53249748 143153737 Mouse 27095933 Ulnl3_m ulna length 3, 5 week (mouse) 7 73149748 143153737 Mouse 1300722 Sle3_m systemic lupus erythmatosus susceptibility 3 (mouse) Not determined 7 3511728 87142720 Mouse 12880418 V125Dq6_m vitamin D active form serum level QTL 6 (mouse) 7 52149748 86149748 Mouse 27226745 Metcl9_m metatarsal-calcaneal length 9, 10 week (mouse) 7 74849748 122199223 Mouse 27095930 Ulnl10_m ulna length 10, 16 week (mouse) 7 80849748 126699172 Mouse 27095923 Pglq3_m pelvic girdle length QTL 3, 5 week (mouse) 7 81249748 124199223 Mouse 27095916 Scvln15_m sacral vertebrae length 2, 16 week (mouse) 7 61749748 123699223 Mouse 12801463 Rta1_m retinal aging 1 (mouse) 7 67168027 89089989 Mouse 11553865 Stmm1c_m skin tumor modifier of MSM 1c (mouse) 7 65788986 99788986 Mouse 26884451 Sklq14_m skull length QTL 14, 16 week (mouse) 7 67849748 124999172 Mouse 11553866 Stmm1d_m skin tumor modifier of MSM 1d (mouse) 7 65788986 99788986 Mouse 27095910 Pglq13_m pelvic girdle length QTL 13, 16 week (mouse) 7 73049748 125699172 Mouse 25314303 Vmm4_m variable multisystem mineralization 4, kidney (mouse) 7 37299425 87049208 Mouse 11553869 Stmm2b_m skin tumor modifier of MSM 2a (mouse) 7 73725965 107725965 Mouse 27095907 Scvln4_m sacral vertebrae length 2, 5 week (mouse) 7 69949748 120499223 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000032865 ⟹ ENSMUSP00000032865
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 84,234,367 - 84,255,150 (-) Ensembl GRCm38.p6 Ensembl 7 84,585,159 - 84,605,942 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000128460 ⟹ ENSMUSP00000121439
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 84,244,737 - 84,255,930 (-) Ensembl GRCm38.p6 Ensembl 7 84,595,529 - 84,606,722 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000134390
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 84,250,829 - 84,254,937 (-) Ensembl GRCm38.p6 Ensembl 7 84,601,621 - 84,605,729 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000153126
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 84,250,285 - 84,251,308 (-) Ensembl GRCm38.p6 Ensembl 7 84,601,077 - 84,602,100 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000209112
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 7 84,246,256 - 84,255,112 (-) Ensembl GRCm38.p6 Ensembl 7 84,597,048 - 84,605,904 (-) Ensembl
RefSeq Acc Id:
NM_010176 ⟹ NP_034306
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 7 84,234,367 - 84,255,150 (-) NCBI GRCm38 7 84,585,159 - 84,605,942 (-) ENTREZGENE MGSCv37 7 91,733,669 - 91,754,452 (-) RGD Celera 7 81,987,620 - 82,008,470 (-) RGD cM Map 7 ENTREZGENE
Sequence:
GGGTGCTAAAAGAATCACTAGGGTGGGGAGGCGGTCCCAGTGGGGCGGGTAGGGGTGTGTGCCAGGTGGTACCGGGTATTGGCTGGAGGAAGGGCAGCCCGGGGTTCGGGGCGGTCCCTGAATCTAAA
hide sequence
RefSeq Acc Id:
NP_034306 ⟸ NM_010176
- UniProtKB:
Q3TY87 (UniProtKB/Swiss-Prot), Q9QW65 (UniProtKB/Swiss-Prot), P35505 (UniProtKB/Swiss-Prot)
- Sequence:
MSFIPVAEDSDFPIQNLPYGVFSTQSNPKPRIGVAIGDQILDLSVIKHLFTGPALSKHQHVFDETTLNNFMGLGQAAWKEARASLQNLLSASQARLRDDKELRQRAFTSQASATMHLPATIGDYTDFY
hide sequence
Ensembl Acc Id:
ENSMUSP00000032865 ⟸ ENSMUST00000032865
Ensembl Acc Id:
ENSMUSP00000121439 ⟸ ENSMUST00000128460
RGD ID: 8664689 Promoter ID: EPDNEW_M10376 Type: initiation region Name: Fah_1 Description: Mus musculus fumarylacetoacetate hydrolase , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 7 84,605,786 - 84,605,846 EPDNEW
RGD ID: 6841067 Promoter ID: MM_KWN:51416 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6 Transcripts: OTTMUST00000061684, OTTMUST00000061686 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 7 91,753,846 - 91,754,807 (-) MPROMDB
RGD ID: 6841065 Promoter ID: MM_KWN:51417 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Liver, Lung, MEF_B4, MEF_B6 Transcripts: OTTMUST00000061685 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 7 91,754,921 - 91,755,421 (-) MPROMDB
