Advanced Search (OLGA)

Gene: Septin3 (septin 3) Rattus norvegicus

Analyze

Symbol:

Septin3

Name:

septin 3

RGD ID:

621745

Description:

Enables GTP binding activity. Predicted to be involved in cytoskeleton-dependent cytokinesis; protein catabolic process at presynapse; and protein localization. Located in presynaptic membrane. Is active in presynapse. Orthologous to human SEPTIN3 (septin 3); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dibromophenyl 2,4,5-tribromophenyl ether; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

G-septin alpha; neuronal-specific septin-3; P40; Sep3; Sept3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SEPTIN3 (septin 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Septin3 (septin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Septin3 (septin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SEPTIN3 (septin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SEPTIN3 (septin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Septin3 (septin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SEPTIN3 (septin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SEPTIN3 (septin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Septin3 (septin 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SEPTIN3 (septin 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Septin3 (septin 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sept3 (septin 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CDC10	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	septin3	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	115,659,414 - 115,691,173 (+)	NCBI		GRCr8
mRatBN7.2	7	113,783,217 - 113,811,089 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	113,783,095 - 113,811,087 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	115,545,644 - 115,566,998 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	117,769,160 - 117,790,514 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	117,738,608 - 117,759,964 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	123,506,535 - 123,526,542 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	123,510,804 - 123,526,542 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	123,491,254 - 123,511,261 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	120,650,069 - 120,669,466 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	120,684,297 - 120,703,696 (+)	NCBI
Celera	7	110,104,873 - 110,124,400 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenylosuccinase lyase deficiency (ISO)

common variable immunodeficiency 4 (ISO)

intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,6-tribromophenol (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-chloropropane-1,2-diol (EXP)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

atrazine (ISO)

benzene (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[k]fluoranthene (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

C60 fullerene (EXP)

carbon nanotube (ISO)

chrysene (ISO)

cisplatin (ISO)

Cuprizon (EXP)

dioxygen (EXP)

endosulfan (EXP)

ethanol (ISO)

flavonoids (EXP)

Indeno[1,2,3-cd]pyrene (ISO)

ivermectin (ISO)

lipopolysaccharide (ISO)

methamphetamine (EXP)

methimazole (EXP)

Nutlin-3 (ISO)

pentanal (ISO)

propanal (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tetraphene (ISO)

triptonide (ISO)

vinclozolin (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cytoskeleton-dependent cytokinesis (IBA)

protein catabolic process at presynapse (ISO)

protein localization (IBA)

Cellular Component

cell division site (IBA)

cytoplasm (IEA)

cytoskeleton (IEA)

microtubule cytoskeleton (IBA)

presynapse (IDA,ISO)

presynaptic membrane (IDA)

septin complex (IBA,ISO,ISS)

septin ring (IBA)

Molecular Function

GTP binding (IDA,IEA)

GTPase activity (IBA)

identical protein binding (ISO)

molecular adaptor activity (IBA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Biochemical characterization of membrane-associated septin from rat brain.	Maimaitiyiming M, etal., J Neurochem. 2008 Aug;106(3):1175-83. Epub 2008 May 3.
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Phosphorylation of septin 3 on Ser-91 by cGMP-dependent protein kinase-I in nerve terminals.	Xue J, etal., Biochem J. 2004 Aug 1;381(Pt 3):753-60.
7.	Phosphorylation of a new brain-specific septin, G-septin, by cGMP-dependent protein kinase.	Xue J, etal., J Biol Chem 2000 Apr 7;275(14):10047-56.
8.	Septin 3 (G-septin) is a developmentally regulated phosphoprotein enriched in presynaptic nerve terminals.	Xue J, etal., J Neurochem. 2004 Nov;91(3):579-90.

Additional References at PubMed

PMID:18809578	PMID:22871113	PMID:25416956	PMID:29476059

Genomics

Comparative Map Data

Septin3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	115,659,414 - 115,691,173 (+)	NCBI		GRCr8
mRatBN7.2	7	113,783,217 - 113,811,089 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	113,783,095 - 113,811,087 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	7	115,545,644 - 115,566,998 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	117,769,160 - 117,790,514 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	117,738,608 - 117,759,964 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	123,506,535 - 123,526,542 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	123,510,804 - 123,526,542 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	7	123,491,254 - 123,511,261 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	7	120,650,069 - 120,669,466 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	7	120,684,297 - 120,703,696 (+)	NCBI
Celera	7	110,104,873 - 110,124,400 (+)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI

SEPTIN3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	41,969,443 - 41,998,221 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	41,969,443 - 41,998,221 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	42,365,447 - 42,394,225 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	40,702,877 - 40,724,171 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	22	40,697,495 - 40,718,570	NCBI
Celera	22	26,179,152 - 26,200,449 (+)	NCBI		Celera
Cytogenetic Map	22	q13.2	NCBI
HuRef	22	25,339,389 - 25,360,426 (+)	NCBI		HuRef
CHM1_1	22	42,333,143 - 42,354,415 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	42,449,051 - 42,477,828 (+)	NCBI		T2T-CHM13v2.0

Septin3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	82,153,003 - 82,178,775 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	82,153,003 - 82,178,775 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	82,268,802 - 82,294,574 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	82,268,802 - 82,294,574 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	82,105,365 - 82,124,872 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	82,102,657 - 82,119,825 (+)	NCBI		MGSCv36	mm8
Celera	15	84,399,152 - 84,418,538 (+)	NCBI		Celera
Cytogenetic Map	15	E1	NCBI
cM Map	15	38.56	NCBI

Septin3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955413	27,381,103 - 27,400,899 (+)	NCBI	ChiLan1.0	ChiLan1.0

SEPTIN3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	51,788,767 - 51,827,843 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	54,487,960 - 54,527,047 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	22,860,671 - 22,890,643 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	40,953,369 - 40,974,210 (+)	NCBI	panpan1.1	PanPan1.1	panPan2

SEPTIN3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	23,370,393 - 23,396,922 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	23,371,558 - 23,396,205 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	23,304,474 - 23,331,048 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	24,115,099 - 24,141,685 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	24,115,112 - 24,151,564 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	23,832,430 - 23,855,170 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	24,153,414 - 24,179,997 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	24,327,530 - 24,354,096 (-)	NCBI		UU_Cfam_GSD_1.0

Septin3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	7,020,768 - 7,045,298 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936492	31,182 - 55,866 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SEPTIN3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	5	6,623,265 - 6,660,702 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	5	6,631,750 - 6,657,837 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	5	3,698,534 - 3,721,309 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SEPTIN3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	24,503,235 - 24,532,092 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666045	100,878,157 - 100,905,434 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Septin3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624752	6,737,704 - 6,757,920 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	118
Count of miRNA genes:	88
Interacting mature miRNAs:	103
Transcripts:	ENSRNOT00000010233, ENSRNOT00000010491
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300179	Kidm5	Kidney mass QTL 5	3.51		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	92388565	119280177	Rat
1331728	Bp214	Blood pressure QTL 214	2.825		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	82111245	123048330	Rat
1331731	Bp216	Blood pressure QTL 216	2.851		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	104186212	135371468	Rat
70159	Bp61	Blood pressure QTL 61		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	73618702	118618702	Rat
631687	Hcas1	Hepatocarcinoma susceptibility QTL 1	3.9	0.001	liver integrity trait (VT:0010547)	liver tumorous lesion volume to total liver volume ratio (CMO:0001082)	7	93302009	131686183	Rat
61397	Bw17	Body weight QTL 17	6.3		body mass (VT:0001259)	body weight (CMO:0000012)	7	95485047	137014596	Rat
1358914	Bp266	Blood pressure QTL 266			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	115313999	136544683	Rat
631504	Cm27	Cardiac mass QTL 27	3.45		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	7	46307490	127866166	Rat
634322	Bw12	Body weight QTL 12	0		body mass (VT:0001259)	body weight (CMO:0000012)	7	85043242	130043242	Rat
70173	Niddm19	Non-insulin dependent diabetes mellitus QTL 19	4.33	0.00005	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	7	85497398	130497398	Rat
1549899	Stresp8	Stress response QTL 8	4.37	0.0008	stress-related behavior trait (VT:0010451)	defensive burying duration (CMO:0001961)	7	92362341	137014596	Rat
2317052	Aia17	Adjuvant induced arthritis QTL 17	2.13		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	7	83626689	128626689	Rat
631529	Tls2	T-lymphoma susceptibility QTL 2	0	0.001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	7	82111382	132099989	Rat
731176	Glom5	Glomerulus QTL 5	2.5	0.0035	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	7	98549867	137014596	Rat
7411607	Foco15	Food consumption QTL 15		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
631201	Panci1	Pancreas inflammation QTL 1	0	0.001	pancreas integrity trait (VT:0010560)	percentage of study population displaying chronic pancreatitis at a point in time (CMO:0001214)	7	73557047	118557047	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	1509236	116977875	Rat
1331768	Kidm10	Kidney mass QTL 10	4.62096		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	7	82111245	123048330	Rat
61357	Bp38	Blood pressure QTL 38	1.6	0.052	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	40540077	123682549	Rat
2313102	Bmd79	Bone mineral density QTL 79	2.3	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	7	96700404	118618702	Rat
2316947	Rf58	Renal function QTL 58	7.8		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	7	49682832	115766396	Rat
1331748	Bp215	Blood pressure QTL 215	4.043		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	110725024	135371468	Rat
10450862	Kidm55	Kidney mass QTL 55	4.9		kidney mass (VT:0002707)	kidney weight (CMO:0000081)	7	72725037	117725037	Rat
61428	Scl3	Serum cholesterol level QTL 3	3.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	7	100548246	137014596	Rat
1331746	Kidm9	Kidney mass QTL 9	3.934		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	7	82111245	134948181	Rat
10450856	Livw4	Liver weight QTL 4	3.8		liver mass (VT:0003402)	liver weight (CMO:0000092)	7	72725037	117725037	Rat
7411654	Foco25	Food consumption QTL 25	9.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	7	77807807	122807807	Rat
2316955	Stl24	Serum triglyceride level QTL 24	7.1		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	7	49682832	115766396	Rat
10402855	Bp379	Blood pressure QTL 379		0.21	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	78682549	123682549	Rat
2316952	Pur22	Proteinuria QTL 22	5.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	7	49682832	115766396	Rat
631540	Bw9	Body weight QTL 9	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	7	71621154	119349044	Rat
1358891	Bp265	Blood pressure QTL 265	2.21		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	7	71827901	136544683	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	10	49	113	87	86	55	25	55	6	203	96	93	35	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019375	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079788	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039079790	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063264164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC107527	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF111179	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF111180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF111181	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010491 ⟹ ENSRNOP00000010491

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	113,794,138 - 113,811,087 (+)	Ensembl
Rnor_6.0 Ensembl	7	123,510,804 - 123,526,542 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104535 ⟹ ENSRNOP00000082443

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	113,786,092 - 113,807,797 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104827 ⟹ ENSRNOP00000083723

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	113,783,095 - 113,811,087 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108676 ⟹ ENSRNOP00000094557

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	113,783,095 - 113,808,612 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118624 ⟹ ENSRNOP00000086729

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	113,789,722 - 113,811,087 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118944 ⟹ ENSRNOP00000086657

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	7	113,797,358 - 113,808,612 (+)	Ensembl

RefSeq Acc Id:

NM_019375 ⟹ NP_062248

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	115,669,807 - 115,691,171 (+)	NCBI
mRatBN7.2	7	113,789,722 - 113,811,087 (+)	NCBI
Rnor_6.0	7	123,506,535 - 123,526,542 (+)	NCBI
Rnor_5.0	7	123,491,254 - 123,511,261 (+)	NCBI
RGSC_v3.4	7	120,650,069 - 120,669,466 (+)	RGD
Celera	7	110,104,873 - 110,124,400 (+)	RGD

Sequence:

show sequence

GGAATTCCGGGCGCGGGACAAAGGAGGATTCATGTCCAAAGGGCTCCCAGAGGCTAGGACGGAC
ACAGCCATGTCAGAGCTGGTGCCCGAGCCCAGGCCTAAGCCGGCGGTGCCCATGAAGCCGGTCA
GCATCAACTCCAACCTACTAGGCTGCATTGGCATTGACACCATTATCGAACAGATGCGCAAGAA
GACCATGAAGACTGGTTTTGACTTCAACATCATGGTCGTTGGCCAGAGTGGACTGGGCAAGTCG
ACGCTGGTCAACACACTATTCAAGTCTCAAGTGAGCCGGAAGGCCTCCAGCTGGAACCGGGAGG
AGAAGATCCCGAAGACAGTGGAGATCAAAGCGATTGGGCATGTGATAGAGGAAGGTGGTATCAA
AATGAAGCTGACGGTCATCGACACGCCAGGCTTTGGAGACCAGATCAACAATGAAAACTGCTGG
GAGCCCATTGAGAAGTACATCAATGAACAGTATGAAAAGTTCCTCAAAGAGGAGGTTAATATTG
CCAGGAAGAAGCGCATCCCTGACACCCGGGTCCACTGCTGCCTCTACTTCATCTCCCCAACGGG
ACACTCCTTACGACCACTTGATCTTGAGTTCATGAAACACCTCAGCAAAGTGGTGAACGTCATT
CCTGTCATTGCCAAGGCTGACACCATGACCCTGGAGGAGAAGTCTGAATTCAAGCAGAGGGTTC
GCAAAGAGCTTGAAGTAAACGGCATTGAGTTCTACCCTCAGAAGGAGTTTGATGAGGATTTGGA
GGACAAGACAGAGAATGACAAAATCCGGCAGGAGAGCATGCCCTTCGCGGTGGTGGGGAGTGAC
AAGGAGTACCAAGTGAATGGCAAGAGGGTCCTCGGGAGAAAAACACCCTGGGGGATCATCGAAG
TCGAAAACCTCAACCACTGTGAGTTTGCCCTGCTTCGAGACTTCGTCATCAGGACTCACCTCCA
GGACCTCAAAGAAGTAACACACAACATCCACTATGAAACTTACAGGGCCAAGAGGCTCAATGAC
AATGGAGGCCTCCCTCCGGGAGAAGGCCTCCTGGGCACTGTCCTTCCACCTGTGCCAGCCACCC
CCTGCCCCACCGCTGAATGA

hide sequence

RefSeq Acc Id:

XM_039079788 ⟹ XP_038935716

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	115,664,271 - 115,691,173 (+)	NCBI
mRatBN7.2	7	113,784,212 - 113,811,089 (+)	NCBI

RefSeq Acc Id:

XM_039079790 ⟹ XP_038935718

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	115,669,399 - 115,691,173 (+)	NCBI
mRatBN7.2	7	113,789,312 - 113,811,089 (+)	NCBI

RefSeq Acc Id:

XM_063264163 ⟹ XP_063120233

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	115,663,538 - 115,691,173 (+)	NCBI

RefSeq Acc Id:

XM_063264164 ⟹ XP_063120234

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	115,659,414 - 115,691,173 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_062248	(Get FASTA)	NCBI Sequence Viewer
	XP_038935716	(Get FASTA)	NCBI Sequence Viewer
	XP_038935718	(Get FASTA)	NCBI Sequence Viewer
	XP_063120233	(Get FASTA)	NCBI Sequence Viewer
	XP_063120234	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD21035	(Get FASTA)	NCBI Sequence Viewer
	AAD21036	(Get FASTA)	NCBI Sequence Viewer
	AAD21037	(Get FASTA)	NCBI Sequence Viewer
	EDM15664	(Get FASTA)	NCBI Sequence Viewer
	EDM15665	(Get FASTA)	NCBI Sequence Viewer
	EDM15666	(Get FASTA)	NCBI Sequence Viewer
	EDM15667	(Get FASTA)	NCBI Sequence Viewer
	EDM15668	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010491.6
	ENSRNOP00000082443.1
	ENSRNOP00000083723.1
	ENSRNOP00000086657.1
	ENSRNOP00000086729.1
	ENSRNOP00000094557.1
GenBank Protein	Q9WU34	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062248 ⟸ NM_019375

- UniProtKB:

Q9WU35 (UniProtKB/Swiss-Prot), Q9WU34 (UniProtKB/Swiss-Prot), Q9R245 (UniProtKB/Swiss-Prot), A0A8I6A6E2 (UniProtKB/TrEMBL), A6HT54 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSKGLPEARTDTAMSELVPEPRPKPAVPMKPVSINSNLLGCIGIDTIIEQMRKKTMKTGFDFNI
MVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGIKMKLTVIDTPG
FGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFISPTGHSLRPLDLEF
MKHLSKVVNVIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQKEFDEDLEDKTENDKIRQ
ESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEFALLRDFVIRTHLQDLKEVTHNIH
YETYRAKRLNDNGGLPPGEGLLGTVLPPVPATPCPTAE

hide sequence

Ensembl Acc Id:

ENSRNOP00000010491 ⟸ ENSRNOT00000010491

RefSeq Acc Id:	XP_038935716 ⟸ XM_039079788
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6G9D9 (UniProtKB/TrEMBL), A0A8I5ZX16 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038935718 ⟸ XM_039079790
- Peptide Label:	isoform X3
- UniProtKB:	A6HT56 (UniProtKB/TrEMBL), F1LMH0 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000094557 ⟸ ENSRNOT00000108676

Ensembl Acc Id:

ENSRNOP00000086729 ⟸ ENSRNOT00000118624

Ensembl Acc Id:

ENSRNOP00000082443 ⟸ ENSRNOT00000104535

Ensembl Acc Id:

ENSRNOP00000086657 ⟸ ENSRNOT00000118944

Ensembl Acc Id:

ENSRNOP00000083723 ⟸ ENSRNOT00000104827

RefSeq Acc Id:	XP_063120234 ⟸ XM_063264164
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I5ZX16 (UniProtKB/TrEMBL), A0A8I6AME4 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063120233 ⟸ XM_063264163
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I5ZX16 (UniProtKB/TrEMBL), A0A8I6AME4 (UniProtKB/TrEMBL)

Protein Domains

Septin-type G

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9WU34-F1-model_v2	AlphaFold	Q9WU34	1-358	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621745	AgrOrtholog
BioCyc Gene	G2FUF-32632	BioCyc
Ensembl Genes	ENSRNOG00000007686	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000010491.7	UniProtKB/TrEMBL
	ENSRNOT00000104535.1	UniProtKB/TrEMBL
	ENSRNOT00000104827.1	UniProtKB/TrEMBL
	ENSRNOT00000108676.1	UniProtKB/TrEMBL
	ENSRNOT00000118624.1	UniProtKB/TrEMBL
	ENSRNOT00000118944.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	G_SEPTIN_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Septin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Septin3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:56003	UniProtKB/Swiss-Prot
NCBI Gene	56003	ENTREZGENE
PANTHER	NEURONAL-SPECIFIC SEPTIN-3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SEPTIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Septin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	3-Sep	RGD
PhenoGen	Septin3	PhenoGen
PIRSF	Septin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS	SEPTIN3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_SEPTIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000007686	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZX16	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A6E2	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A6F5_RAT	UniProtKB/TrEMBL
	A0A8I6AME4	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6G9D9	ENTREZGENE, UniProtKB/TrEMBL
	A6HT54	ENTREZGENE, UniProtKB/TrEMBL
	A6HT56	ENTREZGENE, UniProtKB/TrEMBL
	F1LMH0	ENTREZGENE, UniProtKB/TrEMBL
	Q9R245	ENTREZGENE
	Q9WU34	ENTREZGENE
	Q9WU35	ENTREZGENE
	SEPT3_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q9R245	UniProtKB/Swiss-Prot
	Q9WU35	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-08-05	Septin3	septin 3	Sept3	septin 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Sept3	septin 3	3-Sep	septin 3	Symbol and Name status set to approved	1299863	APPROVED
2004-09-10	Sept3	septin 3			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	3-Sep				Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in brain and testis	634004
gene_function	a GTP-binding protein	634004

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar