Slc25a20 (solute carrier family 25 member 20)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Slc25a20 (solute carrier family 25 member 20) Rattus norvegicus

Analyze

Symbol:

Slc25a20

Name:

solute carrier family 25 member 20

RGD ID:

621443

Description:

Enables acyl carnitine transmembrane transporter activity. Involved in carnitine transmembrane transport. Predicted to be located in cytosol and mitochondrion. Predicted to be active in mitochondrial envelope. Human ortholog(s) of this gene implicated in carnitine-acylcarnitine translocase deficiency. Orthologous to human SLC25A20 (solute carrier family 25 member 20); PARTICIPATES IN adrenoleukodystrophy pathway; carnitine-acylcarnitine translocase deficiency; fatty acid beta degradation pathway; INTERACTS WITH (R)-carnitine; 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

CAC; CACT; carnitine/acylcarnitine translocase; MGC93269; mitochondrial carnitine/acylcarnitine carrier protein; solute carrier family 25 (carnitine/acylcarnitine translocase), member 20; solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	109,365,056 - 109,386,512 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	109,365,002 - 109,386,512 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	114,983,063 - 115,004,624 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	8	113,182,398 - 113,203,797 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	8	111,025,038 - 111,046,601 (+)	NCBI	Rnor_WKY
Rnor_6.0	8	117,455,308 - 117,476,762 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	117,455,262 - 117,476,734 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	116,800,146 - 116,821,558 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	113,715,211 - 113,737,063 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	113,734,665 - 113,756,518 (+)	NCBI
Celera	8	108,660,802 - 108,681,758 (+)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Aicardi-Goutieres Syndrome 1 (ISO)

carnitine-acylcarnitine translocase deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(R)-carnitine (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

aconitine (EXP)

aflatoxin B1 (EXP)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

ampicillin (EXP)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

buspirone (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

carbon nanotube (ISO)

cefalotin (EXP)

cefazolin (EXP)

cefonicid (EXP)

chloroacetaldehyde (ISO)

chromium(6+) (ISO)

cidofovir anhydrous (ISO)

ciprofibrate (EXP)

cisplatin (ISO)

clodronic acid (ISO)

clofibrate (EXP,ISO)

Clofop (ISO)

copper(II) sulfate (ISO)

cyclosporin A (EXP,ISO)

dexamethasone (ISO)

dibutyl phthalate (EXP)

dichloroacetic acid (ISO)

dicrotophos (ISO)

dioxygen (ISO)

dithioerythritol (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (EXP)

epoxiconazole (ISO)

farnesol (ISO)

fenofibrate (EXP,ISO)

finasteride (EXP)

flutamide (ISO)

folic acid (ISO)

glutathione (ISO)

GW 4064 (ISO)

GW 7647 (ISO)

hexadecanoic acid (EXP)

hydrogen peroxide (EXP)

ibuprofen (EXP)

ifosfamide (ISO)

isoprenaline (EXP)

L-cysteine (EXP)

lamivudine (ISO)

leflunomide (EXP)

lenvatinib (EXP,ISO)

lipopolysaccharide (ISO)

mercury dichloride (ISO)

metformin (EXP)

methapyrilene (EXP,ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (ISO)

Muraglitazar (EXP)

N,N-diethyl-m-toluamide (EXP)

N-acetyl-L-cysteine (EXP,ISO)

nefazodone (EXP)

nickel atom (ISO)

nimesulide (EXP)

O-acetyl-L-carnitine (EXP)

ochratoxin A (EXP)

oleic acid (EXP,ISO)

paracetamol (ISO)

PCB138 (EXP)

perfluorododecanoic acid (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

permethrin (EXP)

phenobarbital (EXP)

phenylmercury acetate (ISO)

piperacillin (EXP)

pirinixic acid (EXP,ISO)

potassium chromate (ISO)

pravastatin (ISO)

propiconazole (ISO)

Pyridostigmine bromide (EXP)

quercetin (ISO)

rotenone (EXP,ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

sodium arsenite (EXP,ISO)

streptozocin (EXP)

sunitinib (ISO)

Tesaglitazar (EXP)

testosterone (ISO)

tetrachloroethene (ISO)

tetracycline (ISO)

thalidomide (ISO)

thapsigargin (ISO)

thioacetamide (EXP)

tributylstannane (ISO)

trichloroethene (ISO)

trichostatin A (ISO)

troglitazone (EXP)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

zaragozic acid A (EXP,ISO)

zidovudine (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acyl carnitine transmembrane transport (IEA)

carnitine transmembrane transport (IBA,IDA)

in utero embryonic development (IEA,ISO)

lipid transport (IEA)

mitochondrial transport (IBA)

Cellular Component

cytosol (IEA,ISO)

membrane (IEA)

mitochondrial envelope (IBA)

mitochondrial inner membrane (TAS)

mitochondrion (IEA,ISO)

Molecular Function

acyl carnitine transmembrane transporter activity (IBA,IDA,ISO)

protein binding (ISO)

transmembrane transporter activity (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

adrenoleukodystrophy pathway (ISO)

carnitine-acylcarnitine translocase deficiency (ISO)

fatty acid beta degradation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Bacterial overexpression, purification, and reconstitution of the carnitine/acylcarnitine carrier from rat liver mitochondria.	Indiveri C, etal., Biochem Biophys Res Commun. 1998 Aug 28;249(3):589-94. doi: 10.1006/bbrc.1998.9197.
4.	The mitochondrial carnitine carrier protein: cDNA cloning, primary structure and comparison with other mitochondrial transport proteins.	Indiveri C, etal., Biochem J 1997 Feb 1;321 ( Pt 3):713-9.
5.	Site-directed mutagenesis and chemical modification of the six native cysteine residues of the rat mitochondrial carnitine carrier: implications for the role of cysteine-136.	Indiveri C, etal., Biochemistry 2002 Jul 9;41(27):8649-56.
6.	Identification and purification of the carnitine carrier from rat liver mitochondria.	Indiveri C, etal., Biochim Biophys Acta. 1990 Oct 24;1020(1):81-6.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Structural insight into function and regulation of carnitine palmitoyltransferase.	Rufer AC, etal., Cell Mol Life Sci. 2009 Aug;66(15):2489-501. Epub 2009 May 9.
15.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:9399886	PMID:12865426	PMID:15757911	PMID:18614015	PMID:20833797	PMID:22365929	PMID:24898781	PMID:27864727	PMID:27996060	PMID:28438511

Genomics

Comparative Map Data

Slc25a20
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	109,365,056 - 109,386,512 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	109,365,002 - 109,386,512 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	114,983,063 - 115,004,624 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	8	113,182,398 - 113,203,797 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	8	111,025,038 - 111,046,601 (+)	NCBI	Rnor_WKY
Rnor_6.0	8	117,455,308 - 117,476,762 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	117,455,262 - 117,476,734 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	116,800,146 - 116,821,558 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	113,715,211 - 113,737,063 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	113,734,665 - 113,756,518 (+)	NCBI
Celera	8	108,660,802 - 108,681,758 (+)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

SLC25A20
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	48,856,926 - 48,898,882 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	3	48,856,926 - 48,898,904 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	48,894,359 - 48,936,315 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	48,869,368 - 48,911,333 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	48,869,368 - 48,911,333	NCBI
Celera	3	48,850,594 - 48,892,435 (-)	NCBI		Celera
Cytogenetic Map	3	p21.31	NCBI
HuRef	3	48,952,554 - 48,994,892 (-)	NCBI		HuRef
CHM1_1	3	48,846,459 - 48,888,551 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	48,885,896 - 48,927,887 (-)	NCBI		T2T-CHM13v2.0

Slc25a20
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	108,539,335 - 108,561,841 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	108,539,287 - 108,561,840 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	108,662,136 - 108,684,642 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	108,662,088 - 108,684,641 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	108,564,429 - 108,586,972 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	108,519,502 - 108,542,045 (+)	NCBI		MGSCv36	mm8
Celera	9	108,275,033 - 108,292,081 (+)	NCBI		Celera
Cytogenetic Map	9	F2	NCBI

Slc25a20
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955532	902,937 - 921,174 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955532	902,937 - 933,675 (-)	NCBI	ChiLan1.0	ChiLan1.0

SLC25A20
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	3	49,863,259 - 49,901,839 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	49,863,259 - 49,901,839 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	3	48,782,960 - 48,824,616 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

SLC25A20
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	40,244,222 - 40,271,100 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	40,244,229 - 40,270,433 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	40,161,526 - 40,188,235 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	40,601,674 - 40,627,761 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	40,601,718 - 40,755,942 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	39,967,112 - 39,993,969 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	40,370,902 - 40,397,702 (+)	NCBI		UNSW_CanFamBas_1.0

Slc25a20
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	63,846,541 - 63,871,412 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936529	606,804 - 631,991 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936529	607,035 - 631,872 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SLC25A20
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	31,523,821 - 31,553,286 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	31,523,820 - 31,553,289 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	34,777,394 - 34,804,819 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC25A20
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	10,261,772 - 10,300,878 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	10,261,634 - 10,300,778 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	156,788,381 - 156,827,761 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Slc25a20
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	2,832,233 - 2,860,796 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	2,833,785 - 2,860,711 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Slc25a20
111 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	110
Count of miRNA genes:	83
Interacting mature miRNAs:	100
Transcripts:	ENSRNOT00000027520
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	8	46531639	119088624	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088624	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	82460758	122812818	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	89265192	114019816	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	93535351	123900184	Rat
1358893	Bp263	Blood pressure QTL 263	5.01		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
1358903	Bp252	Blood pressure QTL 252	7	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	93965141	123900184	Rat
738014	Anxrr15	Anxiety related response QTL 15	3.6	0.005	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	95718998	123900184	Rat
2300182	Bmd56	Bone mineral density QTL 56	5.4		femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	95718998	123900184	Rat
724539	Cm19	Cardiac mass QTL 19	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	8	100149864	120994388	Rat

Markers in Region

RH143998

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	109,380,452 - 109,380,561 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	117,470,703 - 117,470,811	NCBI	Rnor6.0
Rnor_5.0	8	116,815,541 - 116,815,649	UniSTS	Rnor5.0
RGSC_v3.4	8	113,731,004 - 113,731,112	UniSTS	RGSC3.4
Celera	8	108,675,780 - 108,675,888	UniSTS
RH 3.4 Map	8	1115.1	UniSTS
Cytogenetic Map	8	q32	UniSTS

BE106540

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	109,385,003 - 109,385,727 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	117,475,254 - 117,475,977	NCBI	Rnor6.0
Rnor_5.0	8	116,820,050 - 116,820,773	UniSTS	Rnor5.0
RGSC_v3.4	8	113,735,555 - 113,736,278	UniSTS	RGSC3.4
Celera	8	108,680,274 - 108,680,973	UniSTS
RH 3.4 Map	8	1115.7	UniSTS
Cytogenetic Map	8	q32	UniSTS

RH136924

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	109,386,242 - 109,386,440 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	117,476,493 - 117,476,690	NCBI	Rnor6.0
Rnor_5.0	8	116,821,289 - 116,821,486	UniSTS	Rnor5.0
RGSC_v3.4	8	113,736,794 - 113,736,991	UniSTS	RGSC3.4
Celera	8	108,681,489 - 108,681,686	UniSTS
Cytogenetic Map	8	q32	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053965	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC107280	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC081749	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209681	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210606	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X97831	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000027520 ⟹ ENSRNOP00000027520

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	109,365,002 - 109,386,512 (+)	Ensembl
Rnor_6.0 Ensembl	8	117,455,262 - 117,476,734 (+)	Ensembl

RefSeq Acc Id:

NM_053965 ⟹ NP_446417

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	8	109,365,056 - 109,386,512 (+)	NCBI
Rnor_6.0	8	117,455,308 - 117,476,762 (+)	NCBI
Rnor_5.0	8	116,800,146 - 116,821,558 (+)	NCBI
RGSC_v3.4	8	113,715,211 - 113,737,063 (+)	RGD
Celera	8	108,660,802 - 108,681,758 (+)	RGD

Sequence:

show sequence

CGCCCACCTTAATGTAGGTGAAAGGTCGGTGTAGCCGCTTGGACAGCGGAGCAAGATCAAGACT
GCCAGGAGCTGCAAGTAGACTGACAGAAGACTGACCATGGCAGAGGAGCCGAAACCCATCAGTC
CGCTTAAGAACCTCCTTGCCGGCGGCTTTGGCGGCGTGTGCCTGGTGTTTGTGGGGCACCCCTT
GGACACGGTCAAGGTCCGACTGCAGACACAACCACCAAGTTTGCCTGGGCAGCCACCTATGTAC
TCTGGGACCATCGACTGTTTCCGGAAGACTCTTTTTAGAGAGGGCATCACAGGGCTGTATCGGG
GCATGGCTGCACCCATCATTGGAGTCACCCCTATGTTTGCCGTGTGCTTCTTTGGGTTTGGTTT
GGGGAAGAGACTACAGCAGAAATCTCCAGAGGATGAACTTACCTACCCGCAGCTGTTTACAGCT
GGGATGTTATCTGGTGTGTTCACCACAGGAATCATGACCCCTGGAGAACGGATCAAATGCTTAC
TGCAGATTCAGGCTTCTTCAGGGAAAAACAAATACAGTGGTACCTTGGACTGTGCAAAGAAGCT
GTATCAGGAGTTTGGGATCCGTGGCTTCTACAAAGGGACTGTGCTCACTCTCATGCGAGATGTT
CCTGCCAGTGGGATGTATTTCATGACATACGAATGGCTTAAAAATCTCTTCACTCCACAGGGAA
AGAGTGTCCATGACCTCAGTGTGCCTCGGGTCCTGGTGGCTGGCGGCTTTGCAGGGATCTTCAA
TTGGGTTGTGGCAATCCCCCCAGACGTGCTCAAGTCTCGATTCCAGACCGCACCTCCTGGAAAA
TATCCTAATGGTTTCAGAGATGTGTTGAGAGAGCTGATCCGAGAAGAAGGAGTCACCTCCTTGT
ACAAAGGGTTCAATGCAGTCATGATCCGAGCCTTCCCAGCCAATGCTGCCTGTTTCCTTGGCTT
TGAAATTGCCATGAAGATCCTCAATTGGATTGCCCCCAACTTGTGAGGCTGAAGACTGTTGAAG
ACCTTTGGATGCTGGAAGACTGTTGCCGAGAAGCAGGGGCAGGACTGGGAAGCCCTGAGGGTGA
GGGGAGGGAAGTGGTGTGATCAGAGCCCCAGGCATGACTGTGATGGTGAAACTGTTGCCTTAAT
GACATCCTCTACCTTATGTAACTTGGTGCCATTTTGAAACTTGAATATAGAAGGTTTCCAGAGA
ATTGGAGATGGAATAAATAGTTTATAGACTCGCTACCTTTGACCAAATTGCCACCTACTGGTTG
ACTGAAGGCCCTACTTACTATACTCAAATACTCCTTACCAAAGAGTTGATGGCTGACTCTCTGG
ATGCCCCTTGCCTATTCTCAACCAGCTAACCCAGGAGCTGGAATCTTTAATTGCTAGCCATGAA
AACCCAAGAGATGTCCACAGTACCATCTACTCCTGGCCATACACAGGGATGTGGATGTGAAGCA
CACATCTGTCTGCCCAAAGGACTAGGCAGACAATACCTAAGGTTAGCCCACCTGTTATCCACTG
GTTTTTGATATTTTTACACAAGAAATACTAATAATAAAATGACAATTGTCTAAACCCCCTGGAG
AAGGTGGAGAATTTTCCCTCCTACACAGTGAAGACAGCCCCAGCCTCCTGGGATAAGTGTGAAA
GCCACAATGTAGGAAGGCTCTTTTTGCACATTCTTCCCCCATGAGAGCACTCAGTTTTAACAGG
AAACAATAAATATTGTTTCTAATTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_446417	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH81749	(Get FASTA)	NCBI Sequence Viewer
	CAA66410	(Get FASTA)	NCBI Sequence Viewer
	EDL77151	(Get FASTA)	NCBI Sequence Viewer
	EDL77152	(Get FASTA)	NCBI Sequence Viewer
	P97521	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_446417 ⟸ NM_053965

- UniProtKB:

Q66HP8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAEEPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTIDCFRKTLF
REGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKRLQQKSPEDELTYPQLFTAGMLSGVFTTGIM
TPGERIKCLLQIQASSGKNKYSGTLDCAKKLYQEFGIRGFYKGTVLTLMRDVPASGMYFMTYEW
LKNLFTPQGKSVHDLSVPRVLVAGGFAGIFNWVVAIPPDVLKSRFQTAPPGKYPNGFRDVLREL
IREEGVTSLYKGFNAVMIRAFPANAACFLGFEIAMKILNWIAPNL

hide sequence

RefSeq Acc Id:

ENSRNOP00000027520 ⟸ ENSRNOT00000027520

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P97521-F1-model_v2	AlphaFold	P97521	1-301	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696313

Promoter ID:

EPDNEW_R6838

Type:

initiation region

Name:

Slc25a20_1

Description:

solute carrier family 25 member 20

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R6839

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	117,455,286 - 117,455,346	EPDNEW

RGD ID:

13696314

Promoter ID:

EPDNEW_R6839

Type:

initiation region

Name:

Slc25a20_2

Description:

solute carrier family 25 member 20

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R6838

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	117,455,388 - 117,455,448	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621443	AgrOrtholog
BioCyc Gene	G2FUF-29121	BioCyc
Ensembl Genes	ENSRNOG00000020288	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000027520	ENTREZGENE
	ENSRNOP00000027520.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000027520	ENTREZGENE
	ENSRNOT00000027520.5	UniProtKB/TrEMBL
Gene3D-CATH	1.50.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7134670	IMAGE-MGC_LOAD
InterPro	Mitochondrial_sb/sol_carrier	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Mt_carrier_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:117035	UniProtKB/TrEMBL
MGC_CLONE	MGC:93269	IMAGE-MGC_LOAD
NCBI Gene	117035	ENTREZGENE
Pfam	Mito_carr	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Slc25a20	PhenoGen
PROSITE	SOLCAR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF103506	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	MCAT_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q66HP8	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-09	Slc25a20	solute carrier family 25 member 20	Slc25a20	solute carrier family 25 (carnitine/acylcarnitine translocase), member 20	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-19	Slc25a20	solute carrier family 25 (carnitine/acylcarnitine translocase), member 20	Slc25a20	solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Slc25a20	solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20		solute carrier family 25 (carnitine/acylcarnitine translocase), member 20	Name updated	1299863	APPROVED
2005-01-20	Slc25a20	solute carrier family 25 (carnitine/acylcarnitine translocase), member 20			Name updated	1299863	APPROVED
2002-08-07	Slc25a20	solute carrier family 25 (carnitine/acylcarnitine translocase), member 20			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	site-directed mutagenesis show that none of the native cysteines is essential for the transport mechanism	730058
gene_product	member of the mitochondrial carrier family	730031
gene_protein	protein contains 301 aa residues	730031

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB