Advanced Search (OLGA)

Gene: Kcnj9 (potassium inwardly-rectifying channel, subfamily J, member 9) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Kcnj9

Name:

potassium inwardly-rectifying channel, subfamily J, member 9

RGD ID:

621440

Description:

Enables PDZ domain binding activity. Predicted to be involved in potassium ion import across plasma membrane; regulation of monoatomic ion transmembrane transport; and regulation of presynaptic membrane potential. Predicted to be part of monoatomic ion channel complex. Predicted to be active in parallel fiber to Purkinje cell synapse and presynaptic membrane. Orthologous to human KCNJ9 (potassium inwardly rectifying channel subfamily J member 9); INTERACTS WITH 6-propyl-2-thiouracil; acetamide; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

G protein-activated inward rectifier potassium channel 3; GIRK-3; Girk3; inward rectifier K(+) channel Kir3.3; inwardly rectifier K(+) channel Kir3.3; Kir3.3; potassium channel, inwardly rectifying subfamily J member 9; potassium channel, inwardly rectifying subfamily J, member 9; potassium voltage-gated channel subfamily J member 9

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	87,313,191 - 87,320,293 (-)	NCBI		GRCr8
mRatBN7.2	13	84,780,826 - 84,787,928 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	84,779,741 - 84,787,928 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	87,284,139 - 87,291,241 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	88,684,415 - 88,691,517 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	85,868,710 - 85,875,816 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	90,703,046 - 90,710,148 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	90,703,036 - 90,710,287 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	95,224,229 - 95,231,331 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	88,311,500 - 88,318,875 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	88,500,392 - 88,507,759 (-)	NCBI
Celera	13	84,391,114 - 84,398,216 (-)	NCBI		Celera
RH 3.4 Map	13	561.5	RGD
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnj9	Rat	autoimmune interstitial lung, joint, and kidney disease		ISO	KCNJ9 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Autoimmune interstitial lung disease-arthritis syndrome	ClinVar	PMID:28492532
Kcnj9	Rat	EAST syndrome		ISO	KCNJ9 (Homo sapiens)	8554872	ClinVar Annotator: match by term: EAST syndrome	ClinVar	PMID:28492532
Kcnj9	Rat	familial hemiplegic migraine		ISO	KCNJ9 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial hemiplegic migraine	ClinVar	PMID:28492532
Kcnj9	Rat	gastrointestinal stromal tumor		ISO	KCNJ9 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Gastrointestinal stromal tumor	ClinVar	PMID:28492532
Kcnj9	Rat	parathyroid carcinoma		ISO	KCNJ9 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Parathyroid carcinoma	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnj9	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Kcnj9 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of KCNJ9 mRNA	CTD	PMID:24680724
Kcnj9	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of KCNJ9 mRNA	CTD	PMID:30047161
Kcnj9	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of KCNJ9 mRNA	CTD	PMID:31881176
Kcnj9	Rat	aflatoxin B1	decreases methylation	ISO	KCNJ9 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of KCNJ9 gene	CTD	PMID:27153756
Kcnj9	Rat	all-trans-retinoic acid	affects expression	ISO	KCNJ9 (Homo sapiens)	6480464	Tretinoin affects the expression of KCNJ9 mRNA	CTD	PMID:31600526
Kcnj9	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of KCNJ9 mRNA	CTD	PMID:30047161
Kcnj9	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of KCNJ9 mRNA	CTD	PMID:16483693
Kcnj9	Rat	Azoxymethane	multiple interactions	ISO	Kcnj9 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of KCNJ9 mRNA	CTD	PMID:29950665
Kcnj9	Rat	benzo[a]pyrene	affects methylation	ISO	KCNJ9 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of KCNJ9 5' UTR and Benzo(a)pyrene affects the methylation of KCNJ9 promoter	CTD	PMID:27901495
Kcnj9	Rat	benzo[a]pyrene	multiple interactions	ISO	KCNJ9 (Homo sapiens)	6480464	[AHR gene mutant form affects the susceptibility to Benzo(a)pyrene] which results in decreased expression of KCNJ9 mRNA	CTD	PMID:38036013
Kcnj9	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of KCNJ9 mRNA	CTD	PMID:25181051
Kcnj9	Rat	bisphenol A	decreases expression	ISO	Kcnj9 (Mus musculus)	6480464	bisphenol A results in decreased expression of KCNJ9 mRNA	CTD	PMID:32156529
Kcnj9	Rat	cadmium dichloride	increases expression	ISO	KCNJ9 (Homo sapiens)	6480464	Cadmium Chloride results in increased expression of KCNJ9 mRNA	CTD	PMID:38568856
Kcnj9	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of KCNJ9 mRNA	CTD	PMID:26033743
Kcnj9	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of KCNJ9 mRNA	CTD	PMID:26033743
Kcnj9	Rat	cyclosporin A	increases methylation	ISO	KCNJ9 (Homo sapiens)	6480464	Cyclosporine results in increased methylation of KCNJ9 promoter	CTD	PMID:27989131
Kcnj9	Rat	cypermethrin	decreases expression	EXP		6480464	cypermethrin results in decreased expression of KCNJ9 mRNA	CTD	PMID:22528246
Kcnj9	Rat	dextran sulfate	multiple interactions	ISO	Kcnj9 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of KCNJ9 mRNA	CTD	PMID:29950665
Kcnj9	Rat	enzyme inhibitor	multiple interactions	ISO	KCNJ9 (Homo sapiens)	6480464	[Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of KCNJ9 protein	CTD	PMID:23301498
Kcnj9	Rat	ethanol	affects splicing	ISO	Kcnj9 (Mus musculus)	6480464	Ethanol affects the splicing of KCNJ9 mRNA	CTD	PMID:30319688
Kcnj9	Rat	ethanol	increases expression	ISO	Kcnj9 (Mus musculus)	6480464	Ethanol results in increased expression of KCNJ9 mRNA	CTD	PMID:30319688
Kcnj9	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of KCNJ9 mRNA	CTD	PMID:33387578
Kcnj9	Rat	lead(0)	affects expression	ISO	KCNJ9 (Homo sapiens)	6480464	Lead affects the expression of KCNJ9 mRNA	CTD	PMID:28903495
Kcnj9	Rat	methamphetamine	decreases expression	ISO	Kcnj9 (Mus musculus)	6480464	Methamphetamine results in decreased expression of KCNJ9 mRNA	CTD	PMID:21886566
Kcnj9	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of KCNJ9 mRNA	CTD	PMID:30047161
Kcnj9	Rat	N-nitrosodiethylamine	multiple interactions	ISO	Kcnj9 (Mus musculus)	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of KCNJ9 gene	CTD	PMID:23968726
Kcnj9	Rat	paracetamol	increases expression	EXP		6480464	Acetaminophen results in increased expression of KCNJ9 mRNA	CTD	PMID:33387578
Kcnj9	Rat	piperonyl butoxide	multiple interactions	ISO	Kcnj9 (Mus musculus)	6480464	[Piperonyl Butoxide co-treated with Diethylnitrosamine] affects the methylation of KCNJ9 gene	CTD	PMID:23968726
Kcnj9	Rat	pirinixic acid	decreases expression	EXP		6480464	pirinixic acid results in decreased expression of KCNJ9 mRNA	CTD	PMID:19162173
Kcnj9	Rat	pregnenolone 16alpha-carbonitrile	decreases expression	EXP		6480464	Pregnenolone Carbonitrile results in decreased expression of KCNJ9 mRNA	CTD	PMID:30047161
Kcnj9	Rat	propiconazole	decreases expression	EXP		6480464	propiconazole results in decreased expression of KCNJ9 mRNA	CTD	PMID:30047161
Kcnj9	Rat	resveratrol	multiple interactions	ISO	KCNJ9 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of KCNJ9 mRNA	CTD	PMID:23557933
Kcnj9	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of KCNJ9 mRNA	CTD	PMID:30047161
Kcnj9	Rat	titanium dioxide	multiple interactions	ISO	Kcnj9 (Mus musculus)	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of KCNJ9 mRNA	CTD	PMID:29950665
Kcnj9	Rat	titanium dioxide	increases methylation	ISO	Kcnj9 (Mus musculus)	6480464	titanium dioxide results in increased methylation of KCNJ9 gene	CTD	PMID:35295148
Kcnj9	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of KCNJ9 mRNA	CTD	PMID:33387578
Kcnj9	Rat	valproic acid	decreases methylation	ISO	KCNJ9 (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of KCNJ9 gene	CTD	PMID:29154799

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnj9	Rat	biological_process		ND		1598407	06/2010: no relevant rat data	RGD
Kcnj9	Rat	monoatomic cation transmembrane transport	involved_in	IEA	GO:0005242	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Kcnj9	Rat	monoatomic cation transmembrane transport	involved_in	IEA	GO:0015467	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Kcnj9	Rat	monoatomic ion transmembrane transport	involved_in	IEA	UniProtKB-KW:KW-0407 and UniProtKB-KW:KW-0851	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnj9	Rat	monoatomic ion transport	involved_in	IEA	UniProtKB-KW:KW-0406	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnj9	Rat	potassium ion import across plasma membrane	involved_in	IBA	MGI:107501 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnj9	Rat	potassium ion transmembrane transport	involved_in	IEA	GO:0015467	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Kcnj9	Rat	potassium ion transmembrane transport	involved_in	IEA	GO:0005242	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Kcnj9	Rat	potassium ion transport	involved_in	IEA	InterPro:IPR003276 and InterPro:IPR016449	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnj9	Rat	potassium ion transport	involved_in	IEA	UniProtKB-KW:KW-0633	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnj9	Rat	regulation of monoatomic ion transmembrane transport	involved_in	IBA	MGI:1100508 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnj9	Rat	regulation of presynaptic membrane potential	involved_in	IEA	UniProtKB:P48543 and ensembl:ENSMUSP00000060110	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kcnj9	Rat	regulation of presynaptic membrane potential	involved_in	ISO	Kcnj9 (Mus musculus)	1624291	PMID:10956667	RGD	PMID:10956667

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnj9	Rat	inward rectifier potassium channel complex	part_of	ISO	Kcnj9 (Mus musculus)	1624291	PMID:10341034	RGD	PMID:10341034
Kcnj9	Rat	inward rectifier potassium channel complex	part_of	IEA	UniProtKB:P48543 and ensembl:ENSMUSP00000060110	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kcnj9	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnj9	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Kcnj9	Rat	membrane	located_in	IEA	InterPro:IPR003276 and InterPro:IPR016449	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnj9	Rat	monoatomic ion channel complex	part_of	IEA	UniProtKB-KW:KW-0851	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Kcnj9	Rat	parallel fiber to Purkinje cell synapse	is_active_in	ISO	Kcnj9 (Mus musculus)	1624291	PMID:19558451	RGD	PMID:19558451
Kcnj9	Rat	parallel fiber to Purkinje cell synapse	is_active_in	IEA	UniProtKB:P48543 and ensembl:ENSMUSP00000060110	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kcnj9	Rat	plasma membrane	is_active_in	IBA	MGI:104742 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnj9	Rat	presynaptic membrane	is_active_in	IEA	UniProtKB:P48543 and ensembl:ENSMUSP00000060110	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kcnj9	Rat	presynaptic membrane	is_active_in	ISO	Kcnj9 (Mus musculus)	1624291	PMID:19558451	RGD	PMID:19558451

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Kcnj9	Rat	G-protein activated inward rectifier potassium channel activity	contributes_to	ISO	Kcnj9 (Mus musculus)	1624291	PMID:10341034	RGD	PMID:10341034
Kcnj9	Rat	G-protein activated inward rectifier potassium channel activity	contributes_to	IEA	UniProtKB:P48543 and ensembl:ENSMUSP00000060110	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Kcnj9	Rat	G-protein activated inward rectifier potassium channel activity	enables	IEA	InterPro:IPR003276	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnj9	Rat	inward rectifier potassium channel activity	enables	IEA	InterPro:IPR016449	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Kcnj9	Rat	inward rectifier potassium channel activity	enables	IBA	FB:FBgn0039081 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Kcnj9	Rat	PDZ domain binding		IPI	Snx27 (Rattus norvegicus)	8554349		RGD
Kcnj9	Rat	PDZ domain binding	enables	IPI	UniProtKB:Q8K4V4	8554502	PMID:17828261	UniProt
Kcnj9	Rat	PDZ domain binding	enables	IPI	UniProtKB:Q8K4V4	8554349	PMID:21422294	UniProt
Kcnj9	Rat	protein binding	enables	ISO	KCNJ9 (Homo sapiens)	1624291	UniProtKB:P14416-1 more ...	RGD	PMID:12297500 and PMID:32296183

#	Reference Title	Reference Citation
1.	Mechanism underlying selective regulation of G protein-gated inwardly rectifying potassium channels by the psychostimulant-sensitive sorting nexin 27.	Balana B, etal., Proc Natl Acad Sci U S A. 2011 Apr 5;108(14):5831-6. doi: 10.1073/pnas.1018645108. Epub 2011 Mar 21.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Axonal sorting of Kir3.3 defines a GABA-containing neuron in the CA3 region of rodent hippocampus.	Grosse G, etal., Mol Cell Neurosci. 2003 Nov;24(3):709-24.
4.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
5.	A unique sorting nexin regulates trafficking of potassium channels via a PDZ domain interaction.	Lunn ML, etal., Nat Neurosci. 2007 Oct;10(10):1249-59. Epub 2007 Sep 2.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Comprehensive gene review and curation	RGD comprehensive gene curation
12.	Subunit interactions in the assembly of neuronal Kir3.0 inwardly rectifying K+ channels.	Wischmeyer E, etal., Mol Cell Neurosci. 1997;9(3):194-206.

PMID:8670306	PMID:18698588	PMID:18755244	PMID:19558451	PMID:20610389

Kcnj9
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	87,313,191 - 87,320,293 (-)	NCBI		GRCr8
mRatBN7.2	13	84,780,826 - 84,787,928 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	84,779,741 - 84,787,928 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	87,284,139 - 87,291,241 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	88,684,415 - 88,691,517 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	85,868,710 - 85,875,816 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	90,703,046 - 90,710,148 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	90,703,036 - 90,710,287 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	95,224,229 - 95,231,331 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	88,311,500 - 88,318,875 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	88,500,392 - 88,507,759 (-)	NCBI
Celera	13	84,391,114 - 84,398,216 (-)	NCBI		Celera
RH 3.4 Map	13	561.5	RGD
Cytogenetic Map	13	q24	NCBI

KCNJ9
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	160,081,538 - 160,090,563 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	160,081,538 - 160,090,563 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	160,051,328 - 160,060,353 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	158,317,984 - 158,325,836 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	156,864,432 - 156,872,285	NCBI
Celera	1	133,120,144 - 133,127,996 (+)	NCBI		Celera
Cytogenetic Map	1	q23.2	NCBI
HuRef	1	131,408,475 - 131,416,327 (+)	NCBI		HuRef
CHM1_1	1	161,446,723 - 161,454,597 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	159,218,495 - 159,227,640 (+)	NCBI		T2T-CHM13v2.0

Kcnj9
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	172,148,075 - 172,156,889 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	172,148,068 - 172,156,885 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	172,320,508 - 172,329,322 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	172,320,501 - 172,329,318 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	174,251,164 - 174,259,394 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	174,158,762 - 174,165,957 (-)	NCBI		MGSCv36	mm8
Celera	1	175,174,591 - 175,182,663 (-)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	79.66	NCBI

Kcnj9
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	11,868,535 - 11,877,298 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	11,868,358 - 11,877,298 (+)	NCBI	ChiLan1.0	ChiLan1.0

KCNJ9
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	89,763,359 - 89,821,789 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	89,498,393 - 89,561,800 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	135,433,895 - 135,447,397 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	139,356,387 - 139,365,444 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	139,356,387 - 139,365,444 (+)	Ensembl	panpan1.1		panPan2

KCNJ9
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	22,100,627 - 22,104,165 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	22,100,621 - 22,104,167 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	22,175,211 - 22,182,323 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	22,219,512 - 22,226,777 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	22,219,550 - 22,224,069 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	38	22,123,752 - 22,130,987 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	22,520,200 - 22,527,518 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	22,929,513 - 22,936,694 (-)	NCBI		UU_Cfam_GSD_1.0

Kcnj9
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	6,209,368 - 6,218,113 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936740	538,688 - 545,247 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936740	536,397 - 545,137 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KCNJ9
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	90,397,850 - 90,412,373 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	90,402,042 - 90,412,426 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	98,346,474 - 98,353,846 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

KCNJ9
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	3,853,906 - 3,913,049 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	3,856,705 - 3,860,665 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	2,912,803 - 2,920,292 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kcnj9
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	1,159,930 - 1,170,838 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	1,161,336 - 1,171,321 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Kcnj9
23 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	151
Count of miRNA genes:	110
Interacting mature miRNAs:	135
Transcripts:	ENSRNOT00000010113
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
7387280	Uae43	Urinary albumin excretion QTL 43	5.69	0.4174	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	66451204	106807694	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	74862117	85581182	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	59874408	85581182	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34663461	87525369	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	80753256	106807694	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	69060519	86800898	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	69060519	86800898	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	74023918	97213863	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
1302791	Stl29	Serum triglyceride level QTL 29	3.3	0.0011	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	13	84730788	86800898	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	69060519	86800898	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	74862117	101339893	Rat

Kcnj9

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	84,781,313 - 84,781,487 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	90,703,534 - 90,703,707	NCBI	Rnor6.0
Rnor_5.0	13	95,224,717 - 95,224,890	UniSTS	Rnor5.0
Celera	13	84,391,602 - 84,391,775	UniSTS
RH 3.4 Map	13	561.5	UniSTS
Cytogenetic Map	13	q24	UniSTS

G42052

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	84,784,420 - 84,784,649 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	90,706,641 - 90,706,869	NCBI	Rnor6.0
Rnor_5.0	13	95,227,824 - 95,228,052	UniSTS	Rnor5.0
RGSC_v3.4	13	88,315,368 - 88,315,596	UniSTS	RGSC3.4
Celera	13	84,394,709 - 84,394,937	UniSTS
Cytogenetic Map	13	q24	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	33	113	66	65	34	25	34	6	173	81	93	41	59	31


RefSeq Transcripts	NM_053834	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC095300	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L77929	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010113 ⟹ ENSRNOP00000010113

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	84,780,835 - 84,787,928 (-)	Ensembl
Rnor_6.0 Ensembl	13	90,703,055 - 90,710,148 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000080638 ⟹ ENSRNOP00000071010

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	84,779,741 - 84,787,928 (-)	Ensembl
Rnor_6.0 Ensembl	13	90,703,036 - 90,710,287 (-)	Ensembl

RefSeq Acc Id:

NM_053834 ⟹ NP_446286

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	87,313,191 - 87,320,293 (-)	NCBI
mRatBN7.2	13	84,780,826 - 84,787,928 (-)	NCBI
Rnor_6.0	13	90,703,046 - 90,710,148 (-)	NCBI
Rnor_5.0	13	95,224,229 - 95,231,331 (-)	NCBI
RGSC_v3.4	13	88,311,500 - 88,318,875 (-)	RGD
Celera	13	84,391,114 - 84,398,216 (-)	RGD

Sequence:

show sequence

GGCACGAGGTCTGCGGCTCCCACTCTCAGAGGGGACCTAGGGTATTGGGGGAGATGGTGTCAGGGACATGGACTCCAACCCCCAAGGGTCTCTGCTGCTGGCTACTCTCCTCTTCAGGCTCTGGGGCC
GTGAGAGCCTAGGGAAGGACCCTGGACATCCCGTCTCTCCGGGAAGATTTTAACACAGAGTGCTTCTCAGGGGGAAGAATTCGAAGCAAAACCAGACCCCGCAGGATCCCCGCTGCGGCCGCCATGGC
GCAGGAGAACGCCGCTTTCTCTCCCGGGTCGGAGGAGCCACCGCGGCGCCGCGGTCGCCAGCGCTACGTGGAGAAGGACGGGCGCTGCAACGTGCAGCAGGGCAACGTCCGCGAGACCTACCGCTACC
TGACCGACCTGTTCACCACGCTGGTAGATCTGCAGTGGCGCCTCAGCCTGCTCTTCTTCGTGCTCGCCTACGCGCTCACTTGGCTCTTCTTCGGCGCCATCTGGTGGCTCATCGCCTACGGCCGCGGC
GACCTGGAGCACCTGGAGGACACCGCGTGGACACCGTGCGTCAACAACCTCAACGGCTTCGTGGCCGCCTTCCTCTTCTCCATCGAGACAGAAACCACCATCGGCTATGGGCACCGTGTCATCACCGA
CCAGTGCCCCGAGGGCATCGTGCTGCTGCTGTTGCAAGCCATCCTGGGCTCCATGGTGAACGCTTTCATGGTGGGCTGCATGTTCGTCAAGATCTCGCAGCCCAACAAGCGCGCCGCCACGCTCGTCT
TCTCCTCGCACGCCGTGGTGTCTCTGCGCGACGGGCGCCTCTGTCTCATGTTTCGCGTGGGGGACCTGCGATCCTCGCACATCGTCGAGGCCTCCATCCGCGCCAAGCTCATCCGCTCGCGCCAGACG
CTCGAGGGCGAGTTCATCCCTCTGCACCAGACCGACCTCAGCGTGGGCTTCGACACGGGGGACGACCGCCTCTTCCTCGTCTCACCTCTCGTCATCAGCCATGAAATCGACGCCGCCAGCCCCTTCTG
GGAGGCATCGCGCCGCGCCCTCGAGAGGGACGACTTCGAGATCGTAGTCATTCTCGAGGGCATGGTGGAAGCCACGGGAATGACGTGCCAAGCTCGAAGCTCGTACCTGGTAGACGAAGTGTTGTGGG
GCCACCGATTCACATCCGTGCTCACCCTGGAGGACGGTTTCTATGAGGTGGACTACGCTAGCTTCCATGAAACCTTTGAGGTGCCCACACCCTCATGCAGTGCTCGGGAACTGGCAGAAGCTGCAGCC
CGCCTTGACGCCCATCTCTACTGGTCCATCCCCAGCAGGCTGGATGAGAAGGTGGAGGAAGAAGGGGCTGGGGAGGGGGCAGGCGCAGGAGATGGAGCTGACAAGGAGCAAAATGGCTGCCTGCCACC
CCCGGAGAGTGAGTCCAAGGTGTGACTGGTTTTCTACAACCCCCTGTGGCAGACCAGGGGGCCAGACACAGGTCCATGGAGGCTGCAGAATGGAGATGGAAGTAGAGGAGGCAGGCAGTGTCCCAAGG
AATGGTTAACGTTGGGAGAGGCCCACTGAGTCCAGGATCCAGTGGGGAAGGCCCAAGGTCCTGGTTTGAGGAAAATAGAGGGTGGGGGTGGAGAGAGATCATATCGGTCTGTCTGTGTTTGACTTTGA
CATCTGTTCATGGGTGGATGGATAGACAGAAGGATGGGCTTATGGGGGTTGAATGGGAAGGTGGGCAGAAAGAGACAGTCAATGGATAGCTTGGGTGGATTGACAGTTGGTGAACGGCCGGTGCAGCA
CTCCTTTGTGCAAAATCTACAGGCACCCTTTTCTTCCACGGCATGGGTAGCCCTTGAACCAAGGGTCCATGGCTTAGGGAGCAGATTGTCAGGTAGACTGCAGTCCCCACTCACCACCCCCCAACTGG
CCTCCCTATGTGTGGCATGCCTGCCCAACTAGACAAAGTGGCCACAGAGAAGAAAGCACTGGGTGGAGGTGGGCACAGATGTGGGTGCCCTCCCCACCTTCACTGTCCCATACCGATGGGTCAGAAAG
GTGCCAATGGCCTTAATCCTCAGGTTACAGGCAAACAAGCGGTGGAGGTAAACCCGGAGCAGGGGCCCTGGAGAGGGACCTGAGGAGACCCAAGGACAACTATTTTTCGAGAGAGAGGAATGAAACCT
TGCAGGTACTGCCGGAGAAGCAAGAAGGCAGAGAGAGATTCCGAAGGAAAAGAAAGGCCATGGGAGGGGTTGGGGATTTAGCTCAGCGGCTTGCCTAGCGAGCGCAAGGCCCTGGGTTCGGTCCCCAG
CTCCGGAAAAAAAAA

hide sequence


Protein RefSeqs	NP_446286	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB95433	(Get FASTA)	NCBI Sequence Viewer
	EDL94707	(Get FASTA)	NCBI Sequence Viewer
	EDL94708	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010113.2
GenBank Protein	Q63511	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446286 ⟸ NM_053834

- UniProtKB:

Q63511 (UniProtKB/Swiss-Prot), A6JG51 (UniProtKB/TrEMBL), A0A0G2JZD9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAQENAAFSPGSEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLSLLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETTIGYGHRVI
TDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASP
FWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGAGDGADKEQNGCL
PPPESESKV

hide sequence

Ensembl Acc Id:

ENSRNOP00000071010 ⟸ ENSRNOT00000080638

Ensembl Acc Id:

ENSRNOP00000010113 ⟸ ENSRNOT00000010113

Protein Domains

Inward rectifier potassium channel C-terminal Potassium channel inwardly rectifying transmembrane

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63511-F1-model_v2	AlphaFold	Q63511	1-393	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-17324	BioCyc
Ensembl Genes	ENSRNOG00000007645	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010113.5	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.287.70	UniProtKB/Swiss-Prot
	2.60.40.1400	UniProtKB/Swiss-Prot
InterPro	Ig_E-set	UniProtKB/Swiss-Prot
	IRK_C	UniProtKB/Swiss-Prot
	K_chnl_inward-rec_Kir	UniProtKB/Swiss-Prot
	K_chnl_inward-rec_Kir3.3	UniProtKB/Swiss-Prot
	K_chnl_inward-rec_Kir_cyto	UniProtKB/Swiss-Prot
	Kir_TM	UniProtKB/Swiss-Prot
KEGG Report	rno:116560	UniProtKB/Swiss-Prot
NCBI Gene	116560	ENTREZGENE
PANTHER	PTHR11767	UniProtKB/Swiss-Prot
	PTHR11767:SF17	UniProtKB/Swiss-Prot
Pfam	IRK	UniProtKB/Swiss-Prot
	IRK_C	UniProtKB/Swiss-Prot
PhenoGen	Kcnj9	PhenoGen
PIRSF	GIRK_kir	UniProtKB/Swiss-Prot
PRINTS	KIR33CHANNEL	UniProtKB/Swiss-Prot
	KIRCHANNEL	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007645	RatGTEx
Superfamily-SCOP	SSF81296	UniProtKB/Swiss-Prot
	Voltage-gated potassium channels	UniProtKB/Swiss-Prot
UniProt	A0A0G2JZD9	ENTREZGENE, UniProtKB/TrEMBL
	A6JG51	ENTREZGENE, UniProtKB/TrEMBL
	KCNJ9_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-07-19	Kcnj9	potassium inwardly-rectifying channel, subfamily J, member 9	Kcnj9	potassium voltage-gated channel subfamily J member 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-11	Kcnj9	potassium voltage-gated channel subfamily J member 9	Kcnj9	potassium channel, inwardly rectifying subfamily J, member 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-01-26	Kcnj9	potassium channel, inwardly rectifying subfamily J, member 9	Kcnj9	potassium inwardly-rectifying channel, subfamily J, member 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Kcnj9	potassium inwardly-rectifying channel, subfamily J, member 9			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Kcnj9	potassium inwardly-rectifying channel, subfamily J, member 9			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_expression	expressed in brain	729079

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar