Symbol:
Kcne2
Name:
potassium voltage-gated channel subfamily E regulatory subunit 2
RGD ID:
621383
Description:
Enables several functions, including identical protein binding activity; transmembrane transporter binding activity; and voltage-gated potassium channel activity. Contributes to delayed rectifier potassium channel activity and inward rectifier potassium channel activity. Involved in several processes, including potassium ion transmembrane transport; regulation of monoatomic ion transmembrane transporter activity; and tongue development. Located in cell surface and plasma membrane. Part of voltage-gated potassium channel complex. Human ortholog(s) of this gene implicated in atrial fibrillation; familial atrial fibrillation; long QT syndrome; and long QT syndrome 6. Orthologous to human KCNE2 (potassium voltage-gated channel subfamily E regulatory subunit 2); PARTICIPATES IN acebutolol pharmacodynamics pathway; adrenergic beta receptor agonist and beta-blocker pharmacodynamics pathway; amiodarone pharmacodynamics pathway; INTERACTS WITH 17alpha-ethynylestradiol; 6-propyl-2-thiouracil; amitrole.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
MGC108602; minimum potassium ion channel-related peptide 1; minK-related peptide 1; Mirp1; potassium channel subunit beta MiRP1; potassium channel, voltage gated subfamily E regulatory beta subunit 2; potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 2; potassium voltage-gated channel subfamily E member 2; potassium voltage-gated channel, Isk-related family, member 2; potassium voltage-gated channel, Isk-related subfamily, gene 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
KCNE2 (potassium voltage-gated channel subfamily E regulatory subunit 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Kcne2 (potassium voltage-gated channel, Isk-related subfamily, gene 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Kcne2 (potassium voltage-gated channel subfamily E regulatory subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC106634235 (uncharacterized LOC106634235) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
KCNE2 (potassium voltage-gated channel subfamily E regulatory subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Kcne2 (potassium voltage-gated channel subfamily E regulatory subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
KCNE2 (potassium voltage-gated channel subfamily E regulatory subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
KCNE2 (potassium voltage-gated channel subfamily E regulatory subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Kcne2 (potassium voltage-gated channel subfamily E regulatory subunit 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
KCNE2 (potassium voltage-gated channel subfamily E regulatory subunit 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Kcne2 (potassium voltage-gated channel, Isk-related subfamily, gene 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 45,003,468 - 45,015,942 (+) NCBI GRCr8 mRatBN7.2 11 31,517,176 - 31,530,026 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 31,295,614 - 31,530,043 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 40,212,209 - 40,224,677 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 32,883,668 - 32,896,136 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 32,047,012 - 32,054,013 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 32,434,786 - 32,447,264 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 32,440,237 - 32,447,259 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 36,038,539 - 36,051,121 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 32,277,711 - 32,290,828 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 32,339,411 - 32,347,070 (+) NCBI Celera 11 31,171,793 - 31,183,884 (+) NCBI Celera Cytogenetic Map 11 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Kcne2 Rat 1,2-dimethylhydrazine decreases expression ISO Kcne2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of KCNE2 mRNA CTD PMID:22206623 Kcne2 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of KCNE2 mRNA CTD PMID:29097150 Kcne2 Rat 17beta-estradiol increases expression ISO Kcne2 (Mus musculus) 6480464 Estradiol results in increased expression of KCNE2 mRNA CTD PMID:19484750 Kcne2 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Kcne2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kcne2 Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Kcne2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kcne2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Kcne2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KCNE2 mRNA CTD PMID:33956508 Kcne2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of KCNE2 mRNA CTD PMID:22504374 Kcne2 Rat 6-propyl-2-thiouracil multiple interactions ISO Kcne2 (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of KCNE2 mRNA CTD PMID:36706583 Kcne2 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of KCNE2 mRNA CTD PMID:25825206 and PMID:30047161 Kcne2 Rat acrylamide decreases expression ISO Kcne2 (Mus musculus) 6480464 Acrylamide results in decreased expression of KCNE2 mRNA CTD PMID:35032568 Kcne2 Rat aflatoxin B1 increases methylation ISO KCNE2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of KCNE2 intron CTD PMID:30157460 Kcne2 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of KCNE2 mRNA CTD PMID:30047161 Kcne2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KCNE2 mRNA CTD PMID:16483693 Kcne2 Rat arsane affects methylation ISO KCNE2 (Homo sapiens) 6480464 Arsenic affects the methylation of KCNE2 gene CTD PMID:25304211 Kcne2 Rat arsenic atom affects methylation ISO KCNE2 (Homo sapiens) 6480464 Arsenic affects the methylation of KCNE2 gene CTD PMID:25304211 Kcne2 Rat benzo[a]pyrene increases expression ISO Kcne2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of KCNE2 mRNA CTD PMID:27195522 Kcne2 Rat benzo[a]pyrene increases methylation ISO KCNE2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of KCNE2 promoter CTD PMID:27901495 Kcne2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of KCNE2 mRNA CTD PMID:25181051 and PMID:29097150 Kcne2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of KCNE2 mRNA CTD PMID:30816183 more ... Kcne2 Rat bisphenol F decreases expression ISO Kcne2 (Mus musculus) 6480464 bisphenol F results in decreased expression of KCNE2 mRNA CTD PMID:36706583 Kcne2 Rat cadmium dichloride decreases expression ISO KCNE2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of KCNE2 mRNA CTD PMID:38382870 Kcne2 Rat carbon nanotube decreases expression ISO Kcne2 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of KCNE2 mRNA CTD PMID:25554681 Kcne2 Rat CGP 52608 multiple interactions ISO KCNE2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to KCNE2 gene] CTD PMID:28238834 Kcne2 Rat chloroprene decreases expression EXP 6480464 Chloroprene results in decreased expression of KCNE2 mRNA CTD PMID:23125180 Kcne2 Rat clarithromycin multiple interactions ISO KCNE2 (Homo sapiens) 6480464 [KCNE2 protein mutant form binds to KCNH2 protein] which results in increased susceptibility to Clarithromycin CTD PMID:10219239 Kcne2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of KCNE2 mRNA CTD PMID:26577399 Kcne2 Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of KCNE2 mRNA CTD PMID:23640034 Kcne2 Rat dexamethasone affects expression ISO KCNE2 (Homo sapiens) 6480464 Dexamethasone affects the expression of KCNE2 mRNA CTD PMID:34742744 Kcne2 Rat diazinon decreases expression EXP 6480464 Diazinon results in decreased expression of KCNE2 mRNA CTD PMID:29108742 Kcne2 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of KCNE2 mRNA CTD PMID:36653537 Kcne2 Rat diiodine multiple interactions ISO Kcne2 (Mus musculus) 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of KCNE2 mRNA CTD PMID:36706583 Kcne2 Rat dioxygen multiple interactions ISO Kcne2 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of KCNE2 mRNA CTD PMID:30529165 Kcne2 Rat E-4031 multiple interactions ISO KCNE2 (Homo sapiens) 6480464 [KCNE2 protein binds to KCNH2 protein] which results in increased susceptibility to E 4031 and E 4031 results in decreased activity of [KCNE2 protein binds to KCNH2 protein] CTD PMID:10219239 Kcne2 Rat folic acid increases expression ISO Kcne2 (Mus musculus) 6480464 Folic Acid results in increased expression of KCNE2 mRNA CTD PMID:25629700 Kcne2 Rat genistein increases expression ISO Kcne2 (Mus musculus) 6480464 Genistein results in increased expression of KCNE2 mRNA CTD PMID:32186404 Kcne2 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of KCNE2 mRNA CTD PMID:33387578 Kcne2 Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of KCNE2 mRNA CTD PMID:24395379 Kcne2 Rat ketoconazole increases expression EXP 6480464 Ketoconazole results in increased expression of KCNE2 mRNA CTD PMID:36653537 Kcne2 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of KCNE2 mRNA CTD PMID:22504374 Kcne2 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of KCNE2 mRNA CTD PMID:30047161 Kcne2 Rat paracetamol affects expression ISO Kcne2 (Mus musculus) 6480464 Acetaminophen affects the expression of KCNE2 mRNA CTD PMID:17562736 Kcne2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of KCNE2 mRNA CTD PMID:33387578 Kcne2 Rat paracetamol decreases expression ISO KCNE2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of KCNE2 mRNA CTD PMID:22230336 Kcne2 Rat paracetamol increases expression ISO KCNE2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of KCNE2 mRNA CTD PMID:26690555 Kcne2 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of KCNE2 mRNA CTD PMID:32680482 Kcne2 Rat paraquat decreases expression ISO Kcne2 (Mus musculus) 6480464 Paraquat results in decreased expression of KCNE2 mRNA CTD PMID:21463325 Kcne2 Rat PCB138 multiple interactions ISO Kcne2 (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Kcne2 Rat perfluorohexanesulfonic acid decreases expression ISO Kcne2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in decreased expression of KCNE2 mRNA CTD PMID:37995155 Kcne2 Rat phenobarbital increases expression ISO KCNE2 (Homo sapiens) 6480464 Phenobarbital results in increased expression of KCNE2 mRNA CTD PMID:19084549 Kcne2 Rat potassium atom multiple interactions ISO KCNE2 (Homo sapiens) 6480464 [KCNH2 protein binds to KCNE2 protein] which results in increased transport of Potassium CTD PMID:15679475 Kcne2 Rat propranolol multiple interactions ISO KCNE2 (Homo sapiens) 6480464 Propranolol results in decreased activity of [KCNH2 protein binds to KCNE2 protein] CTD PMID:15679475 Kcne2 Rat rotenone increases expression ISO KCNE2 (Homo sapiens) 6480464 Rotenone results in increased expression of KCNE2 mRNA CTD PMID:29955902 Kcne2 Rat silicon dioxide increases expression ISO KCNE2 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of KCNE2 mRNA CTD PMID:23806026 Kcne2 Rat silicon dioxide decreases expression ISO KCNE2 (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of KCNE2 mRNA CTD PMID:25351596 Kcne2 Rat sodium arsenite increases expression ISO KCNE2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of KCNE2 mRNA CTD PMID:29301061 Kcne2 Rat sulforaphane decreases expression ISO Kcne2 (Mus musculus) 6480464 sulforaphane results in decreased expression of KCNE2 mRNA CTD PMID:30529165 Kcne2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of KCNE2 mRNA CTD PMID:33387578 Kcne2 Rat titanium dioxide decreases expression ISO Kcne2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of KCNE2 mRNA CTD PMID:23557971 Kcne2 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of KCNE2 gene CTD PMID:27618143 Kcne2 Rat triptonide increases expression ISO Kcne2 (Mus musculus) 6480464 triptonide results in increased expression of KCNE2 mRNA CTD PMID:33045310 Kcne2 Rat valproic acid affects expression ISO Kcne2 (Mus musculus) 6480464 Valproic Acid affects the expression of KCNE2 mRNA CTD PMID:17963808 Kcne2 Rat valproic acid affects expression ISO KCNE2 (Homo sapiens) 6480464 Valproic Acid affects the expression of KCNE2 mRNA CTD PMID:34742744 Kcne2 Rat valproic acid decreases methylation ISO KCNE2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of KCNE2 gene CTD PMID:29154799 Kcne2 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of KCNE2 promoter CTD PMID:20927350
Imported Annotations - SMPDB
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 6-propyl-2-thiouracil (EXP,ISO) acrylamide (ISO) aflatoxin B1 (ISO) amitrole (EXP) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP) bisphenol F (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloroprene (EXP) clarithromycin (ISO) Cuprizon (EXP) decabromodiphenyl ether (EXP) dexamethasone (ISO) diazinon (EXP) diethylstilbestrol (EXP) diiodine (ISO) dioxygen (ISO) E-4031 (ISO) folic acid (ISO) genistein (ISO) gentamycin (EXP) glycidol (EXP) ketoconazole (EXP) methimazole (EXP) paracetamol (EXP,ISO) paraquat (EXP,ISO) PCB138 (ISO) perfluorohexanesulfonic acid (ISO) phenobarbital (ISO) potassium atom (ISO) propranolol (ISO) rotenone (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulforaphane (ISO) tetrachloromethane (EXP) titanium dioxide (ISO) trichloroethene (EXP) triptonide (ISO) valproic acid (ISO) vinclozolin (EXP)
Biological Process
cardiac muscle cell action potential involved in contraction (ISO) cellular response to xenobiotic stimulus (IDA,ISO) establishment of localization in cell (ISO) iodide transport (ISO) membrane repolarization (IDA,ISO) membrane repolarization during action potential (IBA,IDA,ISO) membrane repolarization during ventricular cardiac muscle cell action potential (ISO) monoatomic ion transmembrane transport (IEA) monoatomic ion transport (IEA) multicellular organismal response to stress (ISO) myo-inositol transport (ISO) negative regulation of delayed rectifier potassium channel activity (IDA,ISO) negative regulation of voltage-gated potassium channel activity (IDA) positive regulation of proteasomal protein catabolic process (ISO) positive regulation of voltage-gated calcium channel activity (IDA) potassium ion export across plasma membrane (IBA,IDA,ISO) potassium ion import across plasma membrane (IMP,ISO) potassium ion transmembrane transport (IDA,IEA,ISO) potassium ion transport (IEA) protein localization (ISO) regulation of cyclic nucleotide-gated ion channel activity (IDA) regulation of heart rate by cardiac conduction (IBA,ISO) regulation of membrane repolarization (IDA,ISO) regulation of potassium ion transmembrane transport (IDA,ISO) regulation of ventricular cardiac muscle cell membrane repolarization (IBA,ISO) tongue development (IEP) ventricular cardiac muscle cell action potential (IBA,ISO)
Molecular Function
delayed rectifier potassium channel activity (IBA,IDA,ISO) identical protein binding (IPI) inward rectifier potassium channel activity (IDA,ISO) monoatomic cation channel activity (TAS) potassium channel activity (IEA) potassium channel regulator activity (IBA,IDA,ISO) protein binding (IPI,ISO) transmembrane transporter binding (IBA,IDA,IPI,ISO) voltage-gated potassium channel activity (IDA,IEA) voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization (IBA,ISO)
1.
MiRP1 forms IKr potassium channels with HERG and is associated with cardiac arrhythmia.
Abbott GW, etal., Cell 1999 Apr 16;97(2):175-87.
2.
Expression of the IKr components KCNH2 (rERG) and KCNE2 (rMiRP1) during late rat heart development.
Chun KR, etal., Exp Mol Med. 2004 Aug 31;36(4):367-71.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
Altered gene expression may underlie prolonged duration of the QT interval and ventricular action potential in streptozotocin-induced diabetic rat heart.
Howarth FC, etal., Mol Cell Biochem. 2009 Aug;328(1-2):57-65. doi: 10.1007/s11010-009-0074-9. Epub 2009 Mar 8.
6.
KCNE2 protein is expressed in ventricles of different species, and changes in its expression contribute to electrical remodeling in diseased hearts.
Jiang M, etal., Circulation. 2004 Apr 13;109(14):1783-8. Epub 2004 Apr 5.
7.
KCNE1 and KCNE2 inhibit forward trafficking of homomeric N-type voltage-gated potassium channels.
Kanda VA, etal., Biophys J. 2011 Sep 21;101(6):1354-63. doi: 10.1016/j.bpj.2011.08.015. Epub 2011 Sep 20.
8.
The stoichiometric relationship between KCNH-2 and KCNE-2 in I(Kr) channel formation.
Kim DG, etal., Int J Cardiol. 2010 Nov 19;145(2):272-4. doi: 10.1016/j.ijcard.2009.09.552. Epub 2009 Nov 13.
9.
MinK, MiRP1, and MiRP2 diversify Kv3.1 and Kv3.2 potassium channel gating.
Lewis A, etal., J Biol Chem. 2004 Feb 27;279(9):7884-92. Epub 2003 Dec 16.
10.
Regulation of the Kv2.1 potassium channel by MinK and MiRP1.
McCrossan ZA, etal., J Membr Biol. 2009 Mar;228(1):1-14. doi: 10.1007/s00232-009-9154-8. Epub 2009 Feb 14.
11.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
12.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.
Molecular and functional characterization of ERG, KCNQ, and KCNE subtypes in rat stomach smooth muscle.
Ohya S, etal., Am J Physiol Gastrointest Liver Physiol 2002 Feb;282(2):G277-87.
14.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
15.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
16.
MiRP1 modulates HCN2 channel expression and gating in cardiac myocytes.
Qu J, etal., J Biol Chem. 2004 Oct 15;279(42):43497-502. Epub 2004 Aug 2.
17.
GOA pipeline
RGD automated data pipeline
18.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
20.
Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing.
Tester DJ, etal., Heart Rhythm. 2005 May;2(5):507-17.
21.
Dynamic changes in HCN2, HCN4, KCNE1, and KCNE2 expression in ventricular cells from acute myocardial infarction rat hearts.
Xia S, etal., Biochem Biophys Res Commun. 2010 May 7;395(3):330-5. doi: 10.1016/j.bbrc.2010.04.003. Epub 2010 Apr 8.
22.
Identification of a KCNE2 gain-of-function mutation in patients with familial atrial fibrillation.
Yang Y, etal., Am J Hum Genet. 2004 Nov;75(5):899-905. Epub 2004 Sep 13.
23.
MinK-related peptide 1: A beta subunit for the HCN ion channel subunit family enhances expression and speeds activation.
Yu H, etal., Circ Res. 2001 Jun 22;88(12):E84-7.
Kcne2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 45,003,468 - 45,015,942 (+) NCBI GRCr8 mRatBN7.2 11 31,517,176 - 31,530,026 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 31,295,614 - 31,530,043 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 40,212,209 - 40,224,677 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 32,883,668 - 32,896,136 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 32,047,012 - 32,054,013 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 32,434,786 - 32,447,264 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 32,440,237 - 32,447,259 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 36,038,539 - 36,051,121 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 32,277,711 - 32,290,828 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 32,339,411 - 32,347,070 (+) NCBI Celera 11 31,171,793 - 31,183,884 (+) NCBI Celera Cytogenetic Map 11 q11 NCBI
KCNE2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 21 34,364,006 - 34,371,381 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 21 34,180,729 - 34,371,381 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 21 35,736,305 - 35,743,680 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 21 34,658,193 - 34,665,310 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 21 34,658,192 - 34,665,310 NCBI Celera 21 20,935,893 - 20,943,010 (+) NCBI Celera Cytogenetic Map 21 q22.11 NCBI HuRef 21 21,214,794 - 21,221,877 (+) NCBI HuRef CHM1_1 21 35,298,575 - 35,305,689 (+) NCBI CHM1_1 T2T-CHM13v2.0 21 32,746,055 - 32,753,431 (+) NCBI T2T-CHM13v2.0
Kcne2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 92,089,277 - 92,095,021 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 92,089,277 - 92,095,017 (+) Ensembl GRCm39 Ensembl GRCm38 16 92,292,389 - 92,298,133 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 92,292,389 - 92,298,129 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 92,292,634 - 92,298,374 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 92,181,248 - 92,186,988 (+) NCBI MGSCv36 mm8 Celera 16 93,375,548 - 93,381,246 (+) NCBI Celera Cytogenetic Map 16 C4 NCBI cM Map 16 53.55 NCBI
Kcne2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955407 33,735,148 - 33,735,513 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955407 33,734,969 - 33,736,609 (+) NCBI ChiLan1.0 ChiLan1.0
LOC106634235 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 22 30,299,137 - 30,446,379 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 21 25,157,322 - 25,304,548 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 21 20,548,631 - 20,739,999 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 21 34,000,211 - 34,063,718 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 21 34,107,443 - 34,107,814 (+) Ensembl panpan1.1 panPan2 PanPan1.1 Ensembl 21 34,107,443 - 34,107,814 (+) NCBI panpan1.1 panPan2
KCNE2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 31 29,777,154 - 29,777,839 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 31 29,581,658 - 29,777,525 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 31 28,876,722 - 28,877,407 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 31 29,070,854 - 29,078,555 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 31 28,944,202 - 28,944,887 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 31 28,958,946 - 28,959,631 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 31 29,458,093 - 29,458,778 (+) NCBI UU_Cfam_GSD_1.0
Kcne2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404971 29,395,302 - 29,399,661 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936500 8,068,188 - 8,068,553 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936500 8,067,009 - 8,072,383 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
KCNE2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 197,980,145 - 197,980,516 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 197,979,749 - 197,980,974 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 207,798,714 - 207,809,529 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KCNE2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 57,833,459 - 57,841,052 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 57,833,629 - 57,834,000 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666071 335,337 - 336,729 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Kcne2
.
Predicted Target Of
Count of predictions: 74 Count of miRNA genes: 68 Interacting mature miRNAs: 71 Transcripts: ENSRNOT00000040844 Prediction methods: Microtar, Rnahybrid Result types: miRGate_prediction
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 1598842 Glom10 Glomerulus QTL 10 3.4 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 1 35331169 Rat 8694376 Bw156 Body weight QTL 156 2.25 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 10755497 Bp388 Blood pressure QTL 388 2.76 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 19456205 76331918 Rat 724517 Uae18 Urinary albumin excretion QTL 18 3.7 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 16472047 44285911 Rat 10058952 Gmadr6 Adrenal mass QTL 6 2.29 0.0072 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 22959403 67959403 Rat 1300130 Rf20 Renal function QTL 20 4.44 kidney glomerulus integrity trait (VT:0010546) kidney glomerulus diameter (CMO:0001166) 11 29528418 60324829 Rat 1558659 Tescar1 Testicular tumor resistance QTL 1 3.9 testis integrity trait (VT:0010572) percentage of study population developing testis tumors during a period of time (CMO:0001261) 11 1041931 66113562 Rat 2298551 Neuinf10 Neuroinflammation QTL 10 3.7 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 11 31239134 78851519 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 9589032 Epfw10 Epididymal fat weight QTL 10 9.29 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 11 23280456 68280456 Rat 9590313 Scort20 Serum corticosterone level QTL 20 6.51 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 11 23280456 68280456 Rat 8694424 Bw162 Body weight QTL 162 3.8 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat 1641927 Alcrsp10 Alcohol response QTL 10 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 11 8436674 53436674 Rat
Kcne2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 31,528,523 - 31,528,771 (+) MAPPER mRatBN7.2 Rnor_6.0 11 32,445,766 - 32,446,013 NCBI Rnor6.0 Rnor_5.0 11 36,049,623 - 36,049,870 UniSTS Rnor5.0 RGSC_v3.4 11 32,289,334 - 32,289,581 UniSTS RGSC3.4 Celera 11 31,182,390 - 31,182,637 UniSTS Cytogenetic Map 11 q11 UniSTS
RH139863
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 31,529,744 - 31,529,941 (+) MAPPER mRatBN7.2 Rnor_6.0 11 32,446,987 - 32,447,183 NCBI Rnor6.0 Rnor_5.0 11 36,050,844 - 36,051,040 UniSTS Rnor5.0 RGSC_v3.4 11 32,290,555 - 32,290,751 UniSTS RGSC3.4 Celera 11 31,183,611 - 31,183,807 UniSTS RH 3.4 Map 11 204.5 UniSTS Cytogenetic Map 11 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
86
85
54
25
54
6
213
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000040844 ⟹ ENSRNOP00000045279
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 31,469,632 - 31,530,043 (+) Ensembl Rnor_6.0 Ensembl 11 32,440,237 - 32,447,259 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093948 ⟹ ENSRNOP00000081079
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 31,295,614 - 31,530,022 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000094999 ⟹ ENSRNOP00000078157
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 31,522,449 - 31,530,024 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000099713 ⟹ ENSRNOP00000080461
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 31,523,332 - 31,530,043 (+) Ensembl
RefSeq Acc Id:
NM_133603 ⟹ NP_598287
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 45,003,468 - 45,015,942 (+) NCBI mRatBN7.2 11 31,517,544 - 31,530,018 (+) NCBI Rnor_6.0 11 32,434,786 - 32,447,260 (+) NCBI Rnor_5.0 11 36,038,539 - 36,051,121 (+) NCBI RGSC_v3.4 11 32,277,711 - 32,290,828 (+) RGD Celera 11 31,171,793 - 31,183,884 (+) RGD
Sequence:
GCCGCGCGCAGCAAGCAACCCAGCTCTCAGGAGGTGCTGACTACACCCAGTGTGGACGGTTGGCTGGAGGGGGACTCCATCTGTGCAGCCGTGGGGAAATCTTCGTCCAATCGTGCGTGGGGCTCTTT
hide sequence
RefSeq Acc Id:
NP_598287 ⟸ NM_133603
- UniProtKB:
Q5FVT9 (UniProtKB/Swiss-Prot), P63161 (UniProtKB/Swiss-Prot), A6JLI9 (UniProtKB/TrEMBL)
- Sequence:
MTTLANLTQTLEDAFKKVFITYMDSWRRNTTAEQQALQARVDAENFYYVILYLMVMIGMFAFIVVAILVSTVKSKRREHSQDPYHQYIVEDWQQKYRSQILHLEDSKATIHENLGATGFTVSP
hide sequence
Ensembl Acc Id:
ENSRNOP00000045279 ⟸ ENSRNOT00000040844
Ensembl Acc Id:
ENSRNOP00000078157 ⟸ ENSRNOT00000094999
Ensembl Acc Id:
ENSRNOP00000081079 ⟸ ENSRNOT00000093948
Ensembl Acc Id:
ENSRNOP00000080461 ⟸ ENSRNOT00000099713
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-11
Kcne2
potassium voltage-gated channel subfamily E regulatory subunit 2
Kcne2
potassium channel, voltage gated subfamily E regulatory beta subunit 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-01-27
Kcne2
potassium channel, voltage gated subfamily E regulatory beta subunit 2
Kcne2
potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2015-01-26
Kcne2
potassium channel, voltage-gated Isk-related subfamily E regulatory beta subunit 2
Kcne2
potassium voltage-gated channel, Isk-related family, member 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2011-04-29
Kcne2
potassium voltage-gated channel, Isk-related family, member 2
Kcne2
potassium voltage-gated channel, Isk-related subfamily, gene 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-02-22
Kcne2
potassium voltage-gated channel, Isk-related subfamily, gene 2
Kcne2
potassium voltage-gated channel, Isk-related family, member 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Kcne2
potassium voltage-gated channel, Isk-related family, member 2
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Kcne2
potassium voltage-gated channel, Isk-related family, member 2
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_disease
gene associated to cardiac arrhythmia
633041
gene_domains
contains two N-linked glycosylation sites, single transmembrane segment and two PKC-mediated phosphorylation sites
633041
gene_function
ion channel subunit, effects the channels formed by HERG subunits
633041
gene_protein
123 amino acids protein
633041
