Symbol:
Gfer
Name:
growth factor, augmenter of liver regeneration
RGD ID:
62137
MGI Page
MGI
Description:
Predicted to enable flavin adenine dinucleotide binding activity and flavin-dependent sulfhydryl oxidase activity. Predicted to be involved in several processes, including liver regeneration; negative regulation of natural killer cell mediated cytotoxicity; and positive regulation of DNA biosynthetic process. Located in mitochondrion. Human ortholog(s) of this gene implicated in kidney failure and renal fibrosis. Orthologous to human GFER (growth factor, augmenter of liver regeneration).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Alr; augmenter of liver regeneration; ER; ERV1; FAD-linked sulfhydryl oxidase ALR; growth factor, erv1 (S. cerevisiae)-like (augmenter of liver regeneration); growth factor, erv1-like (augmenter of liver regeneration)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
GFER (growth factor, augmenter of liver regeneration) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Gfer (growth factor, augmenter of liver regeneration) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Gfer (growth factor, augmenter of liver regeneration) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
GFER (growth factor, augmenter of liver regeneration) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
GFER (growth factor, augmenter of liver regeneration) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Gfer (growth factor, augmenter of liver regeneration) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
GFER (growth factor, augmenter of liver regeneration) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
GFER (growth factor, augmenter of liver regeneration) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Gfer (growth factor, augmenter of liver regeneration) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Gfer (growth factor, augmenter of liver regeneration)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
GFER (growth factor, augmenter of liver regeneration)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
gfer (growth factor, augmenter of liver regeneration (ERV1 homolog, S. cerevisiae))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Drosophila melanogaster (fruit fly):
Alr
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
ERV1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
F56C11.3
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
gfer
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 24,912,164 - 24,915,065 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 24,912,161 - 24,915,503 (-) Ensembl GRCm39 Ensembl GRCm38 17 24,693,190 - 24,696,156 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 24,693,187 - 24,696,156 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 24,830,136 - 24,833,101 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 24,420,790 - 24,423,748 (-) NCBI MGSCv36 mm8 Celera 17 25,216,107 - 25,219,071 (-) NCBI Celera Cytogenetic Map 17 A3.3 NCBI cM Map 17 12.48 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gfer Mouse 1,2,4-trimethylbenzene decreases expression ISO RGD:61845 6480464 pseudocumene results in decreased expression of GFER protein CTD PMID:17337753 Gfer Mouse 1,2-dimethylhydrazine multiple interactions EXP 6480464 Folic Acid inhibits the reaction [1,2-Dimethylhydrazine results in increased expression of GFER mRNA] CTD PMID:22206623 Gfer Mouse 1,2-dimethylhydrazine increases expression EXP 6480464 1,2-Dimethylhydrazine results in increased expression of GFER mRNA CTD PMID:22206623 Gfer Mouse 17beta-estradiol decreases expression ISO RGD:61845 6480464 Estradiol results in decreased expression of GFER mRNA CTD PMID:32145629 Gfer Mouse 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of GFER mRNA CTD PMID:39298647 Gfer Mouse 2,2',4,4'-Tetrabromodiphenyl ether affects expression EXP 6480464 2,2',4,4'-tetrabromodiphenyl ether affects the expression of GFER mRNA CTD PMID:30294300 Gfer Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in increased expression of GFER mRNA; [TIPARP gene more ... CTD PMID:16214954|PMID:25975270 Gfer Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GFER mRNA CTD PMID:21570461|PMID:24680724 Gfer Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:61845 6480464 Tetrachlorodibenzodioxin results in increased expression of GFER mRNA CTD PMID:18796159|PMID:21215274|PMID:33387578 Gfer Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GFER mRNA CTD PMID:18796159 Gfer Mouse 2,4-dinitrotoluene affects expression ISO RGD:61845 6480464 2,4-dinitrotoluene affects the expression of GFER mRNA CTD PMID:21346803 Gfer Mouse 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4,4'-diaminodiphenylmethane results in decreased expression of GFER mRNA CTD PMID:18648102 Gfer Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of GFER mRNA CTD PMID:39298647 Gfer Mouse actinomycin D increases secretion ISO RGD:61845 6480464 Dactinomycin results in increased secretion of GFER protein CTD PMID:23073658 Gfer Mouse actinomycin D multiple interactions ISO RGD:61845 6480464 Dactinomycin promotes the reaction [lipopolysaccharide, Escherichia coli O111 B4 results in increased secretion of GFER more ... CTD PMID:23073658 Gfer Mouse ammonium chloride affects expression ISO RGD:61845 6480464 Ammonium Chloride affects the expression of GFER mRNA CTD PMID:16483693 Gfer Mouse aristolochic acid A increases expression ISO RGD:736290 6480464 aristolochic acid I results in increased expression of GFER mRNA CTD PMID:33212167 Gfer Mouse Aroclor 1254 increases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in increased expression of GFER mRNA CTD PMID:23650126 Gfer Mouse benzo[a]pyrene increases methylation ISO RGD:736290 6480464 Benzo(a)pyrene results in increased methylation of GFER 3' UTR CTD PMID:27901495 Gfer Mouse beta-naphthoflavone multiple interactions ISO RGD:61845 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of GFER mRNA CTD PMID:18164116 Gfer Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of GFER mRNA CTD PMID:33754040 Gfer Mouse bisphenol A increases expression ISO RGD:61845 6480464 bisphenol A results in increased expression of GFER mRNA CTD PMID:25181051|PMID:30816183|PMID:32528016|PMID:34947998 Gfer Mouse bisphenol A increases methylation ISO RGD:61845 6480464 bisphenol A results in increased methylation of GFER gene CTD PMID:28505145 Gfer Mouse cadmium atom decreases activity ISO RGD:61845 6480464 Cadmium results in decreased activity of GFER protein CTD PMID:15999536 Gfer Mouse cadmium atom decreases expression ISO RGD:61845 6480464 Cadmium results in decreased expression of GFER mRNA CTD PMID:39025289 Gfer Mouse caffeine decreases phosphorylation ISO RGD:736290 6480464 Caffeine results in decreased phosphorylation of GFER protein CTD PMID:35688186 Gfer Mouse carnosic acid increases expression EXP 6480464 salvin results in increased expression of GFER protein CTD PMID:35926579 Gfer Mouse chlorpyrifos affects expression EXP 6480464 Chlorpyrifos affects the expression of GFER mRNA CTD PMID:37019170 Gfer Mouse choline multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Gfer Mouse chromium(6+) affects expression EXP 6480464 chromium hexavalent ion affects the expression of GFER mRNA CTD PMID:28472532 Gfer Mouse cisplatin decreases expression ISO RGD:736290 6480464 Cisplatin results in decreased expression of GFER mRNA CTD PMID:27392435 Gfer Mouse cobalt dichloride increases expression ISO RGD:736290 6480464 cobaltous chloride results in increased expression of GFER mRNA CTD PMID:19376846 Gfer Mouse copper(II) sulfate decreases expression ISO RGD:736290 6480464 Copper Sulfate results in decreased expression of GFER mRNA CTD PMID:19549813 Gfer Mouse cyclosporin A increases expression ISO RGD:736290 6480464 Cyclosporine results in increased expression of GFER mRNA CTD PMID:25562108 Gfer Mouse dibutyl phthalate decreases expression ISO RGD:61845 6480464 Dibutyl Phthalate results in decreased expression of GFER mRNA CTD PMID:21266533 Gfer Mouse dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of GFER mRNA CTD PMID:17361019 Gfer Mouse dioxygen multiple interactions EXP 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of GFER mRNA CTD PMID:30529165 Gfer Mouse endosulfan increases expression ISO RGD:61845 6480464 Endosulfan results in increased expression of GFER mRNA CTD PMID:29391264 Gfer Mouse enzyme inhibitor multiple interactions ISO RGD:736290 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Gfer Mouse epoxiconazole increases expression EXP 6480464 epoxiconazole results in increased expression of GFER mRNA CTD PMID:35436446 Gfer Mouse ethanol affects expression EXP 6480464 Ethanol affects the expression of GFER mRNA CTD PMID:30319688 Gfer Mouse finasteride increases expression ISO RGD:61845 6480464 Finasteride results in increased expression of GFER mRNA CTD PMID:24136188 Gfer Mouse folic acid multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992|PMID:22206623 Gfer Mouse hydrogen peroxide affects response to substance ISO RGD:736290 6480464 GFER protein affects the susceptibility to Hydrogen Peroxide CTD PMID:14980112 Gfer Mouse L-methionine multiple interactions EXP 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Gfer Mouse methotrexate decreases expression ISO RGD:736290 6480464 Methotrexate results in decreased expression of GFER mRNA CTD PMID:24449571 Gfer Mouse methyl methanesulfonate increases secretion ISO RGD:61845 6480464 Methyl Methanesulfonate results in increased secretion of GFER protein CTD PMID:23073658 Gfer Mouse N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of GFER mRNA CTD PMID:17942915 Gfer Mouse N-nitrosodiethylamine multiple interactions ISO RGD:61845 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of GFER mRNA; [Diethylnitrosamine co-treated with caffeic more ... CTD PMID:18164116|PMID:20360939 Gfer Mouse N-nitrosodiethylamine multiple interactions EXP 6480464 MET protein inhibits the reaction [Diethylnitrosamine results in increased expression of GFER mRNA] CTD PMID:17942915 Gfer Mouse naphthalenes decreases expression ISO RGD:61845 6480464 Naphthalenes results in decreased expression of GFER protein CTD PMID:17337753 Gfer Mouse nitrates multiple interactions EXP 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of GFER more ... CTD PMID:35964746 Gfer Mouse obeticholic acid multiple interactions EXP 6480464 [Dietary Fats co-treated with obeticholic acid] results in decreased expression of GFER mRNA; [Dietary Fats more ... CTD PMID:35267068 Gfer Mouse oxaliplatin multiple interactions ISO RGD:61845 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of GFER mRNA CTD PMID:25729387 Gfer Mouse paracetamol decreases expression ISO RGD:736290 6480464 Acetaminophen results in decreased expression of GFER mRNA CTD PMID:25704631 Gfer Mouse paracetamol increases expression ISO RGD:61845 6480464 Acetaminophen results in increased expression of GFER mRNA CTD PMID:33387578 Gfer Mouse paraquat increases expression ISO RGD:61845 6480464 Paraquat results in increased expression of GFER mRNA CTD PMID:32680482 Gfer Mouse perfluorooctanoic acid increases expression ISO RGD:736290 6480464 perfluorooctanoic acid results in increased expression of GFER protein CTD PMID:26879310 Gfer Mouse phenethyl caffeate multiple interactions ISO RGD:61845 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of GFER mRNA CTD PMID:20360939 Gfer Mouse silicon dioxide increases expression ISO RGD:736290 6480464 Silicon Dioxide analog results in increased expression of GFER mRNA CTD PMID:25895662 Gfer Mouse tert-butyl hydroperoxide increases expression ISO RGD:736290 6480464 tert-Butylhydroperoxide results in increased expression of GFER mRNA CTD PMID:15336504 Gfer Mouse testosterone decreases expression ISO RGD:736290 6480464 Testosterone results in decreased expression of GFER mRNA CTD PMID:33359661 Gfer Mouse tetrachloromethane affects response to substance ISO RGD:736290 6480464 GFER protein affects the susceptibility to Carbon Tetrachloride CTD PMID:14980112 Gfer Mouse thioacetamide increases expression ISO RGD:61845 6480464 Thioacetamide results in increased expression of GFER mRNA CTD PMID:34492290 Gfer Mouse titanium dioxide increases expression EXP 6480464 titanium dioxide results in increased expression of GFER mRNA CTD PMID:27760801 Gfer Mouse toluene decreases expression ISO RGD:736290 6480464 Toluene results in decreased expression of GFER mRNA CTD PMID:28245982 Gfer Mouse topotecan multiple interactions ISO RGD:61845 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of GFER mRNA CTD PMID:25729387 Gfer Mouse topotecan increases expression ISO RGD:61845 6480464 Topotecan results in increased expression of GFER mRNA CTD PMID:25729387 Gfer Mouse trichloroethene increases expression ISO RGD:61845 6480464 Trichloroethylene results in increased expression of GFER mRNA CTD PMID:33387578 Gfer Mouse valproic acid increases methylation ISO RGD:736290 6480464 Valproic Acid results in increased methylation of GFER gene CTD PMID:29154799 Gfer Mouse valproic acid affects expression ISO RGD:736290 6480464 Valproic Acid affects the expression of GFER mRNA CTD PMID:25979313
1,2,4-trimethylbenzene (ISO) 1,2-dimethylhydrazine (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4'-Tetrabromodiphenyl ether (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (EXP) actinomycin D (ISO) ammonium chloride (ISO) aristolochic acid A (ISO) Aroclor 1254 (EXP) benzo[a]pyrene (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) cadmium atom (ISO) caffeine (ISO) carnosic acid (EXP) chlorpyrifos (EXP) choline (EXP) chromium(6+) (EXP) cisplatin (ISO) cobalt dichloride (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dibutyl phthalate (EXP,ISO) dioxygen (EXP) endosulfan (ISO) enzyme inhibitor (ISO) epoxiconazole (EXP) ethanol (EXP) finasteride (ISO) folic acid (EXP) hydrogen peroxide (ISO) L-methionine (EXP) methotrexate (ISO) methyl methanesulfonate (ISO) N-nitrosodiethylamine (EXP,ISO) naphthalenes (ISO) nitrates (EXP) obeticholic acid (EXP) oxaliplatin (ISO) paracetamol (ISO) paraquat (ISO) perfluorooctanoic acid (ISO) phenethyl caffeate (ISO) silicon dioxide (ISO) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (ISO) titanium dioxide (EXP) toluene (ISO) topotecan (ISO) trichloroethene (ISO) valproic acid (ISO)
1.
Augmenter of liver regeneration ameliorates renal fibrosis in rats with obstructive nephropathy.
Chen GT, etal., Biosci Rep. 2014 Sep 5;34(5). pii: BSR20140038. doi: 10.1042/BSR20140038.
2.
[Expression of augmenter of liver regeneration in cryptorchidism spermatogenic cells and its implication].
Chen X, etal., Zhonghua Nan Ke Xue. 2007 Aug;13(8):700-5.
3.
Transient GFER knockdown in vivo impairs liver regeneration after partial hepatectomy.
Francavilla A, etal., Int J Biochem Cell Biol. 2014 Aug;53:343-51. doi: 10.1016/j.biocel.2014.05.029. Epub 2014 May 28.
4.
Augmenter of liver regeneration may be a candidate for prognosis of HBV related acute-on-chronic liver failure as a regenerative marker.
Hongbo S, etal., Hepatogastroenterology. 2012 Sep;59(118):1933-8. doi: 10.5754/hge11679.
5.
Correlation between augmenter of liver regeneration and IFN-gamma expression in graft after rat orthotopic liver transplantation.
Liang S, etal., J Surg Res. 2012 Dec;178(2):968-73. doi: 10.1016/j.jss.2012.06.032. Epub 2012 Jul 5.
6.
Augmenter of liver regeneration protects kidneys from ischaemia/reperfusion injury in rats.
Liao XH, etal., Nephrol Dial Transplant. 2010 Sep;25(9):2921-9. doi: 10.1093/ndt/gfq151. Epub 2010 Mar 23.
7.
Expression of augmenter of liver regeneration in rats with gentamicin-induced acute renal failure and its protective effect on kidney.
Liao XH, etal., Ren Fail. 2009;31(10):946-55. doi: 10.3109/08860220903216154.
8.
Augmentor of liver regeneration ameliorates renal tubular epithelial cell injury after rat liver transplantation.
Long FW, etal., Transplant Proc. 2008 Oct;40(8):2696-9. doi: 10.1016/j.transproceed.2008.08.015.
9.
Iron-sulfur cluster biogenesis in mammalian cells: New insights into the molecular mechanisms of cluster delivery.
Maio N and Rouault TA, Biochim Biophys Acta. 2015 Jun;1853(6):1493-512. doi: 10.1016/j.bbamcr.2014.09.009. Epub 2014 Sep 19.
10.
Electronic Transfer of Homolog Data
MGD and Homologene mouse data transfer
11.
MGDs mouse GO annotations
MGD data from the GO Consortium
12.
Integrated analysis of protein composition, tissue diversity, and gene regulation in mouse mitochondria.
Mootha VK, etal., Cell 2003 Nov 26;115(5):629-40.
13.
The MIA pathway: a key regulator of mitochondrial oxidative protein folding and biogenesis.
Mordas A and Tokatlidis K, Acc Chem Res. 2015 Aug 18;48(8):2191-9. doi: 10.1021/acs.accounts.5b00150. Epub 2015 Jul 27.
14.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
15.
Mouse MP Annotation Import Pipeline
RGD automated import pipeline
16.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
17.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
18.
Augmenter of liver regeneration (ALR) gene therapy attenuates CCl(4)-induced liver injury and fibrosis in rats.
Song M, etal., Biochem Biophys Res Commun. 2011 Nov 11;415(1):152-6. doi: 10.1016/j.bbrc.2011.10.039. Epub 2011 Oct 18.
19.
Augmenter of liver regeneration (ALR) is a novel biomarker of hepatocellular stress/inflammation: in vitro, in vivo and in silico studies.
Vodovotz Y, etal., Mol Med. 2013 Jan 22;18:1421-9. doi: 10.2119/molmed.2012.00183.
20.
Augmenter of liver regeneration improves therapeutic effect of hepatocyte homotransplantation in acute liver failure rats.
Wang N, etal., Int Immunopharmacol. 2013 Feb;15(2):325-32. doi: 10.1016/j.intimp.2013.01.002. Epub 2013 Jan 19.
21.
Effect of naked eukaryotic expression plasmid encoding rat augmenter of liver regeneration on acute hepatic injury and hepatic failure in rats.
Zhang LM, etal., World J Gastroenterol. 2005 Jun 28;11(24):3680-5.
Gfer Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 24,912,164 - 24,915,065 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 24,912,161 - 24,915,503 (-) Ensembl GRCm39 Ensembl GRCm38 17 24,693,190 - 24,696,156 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 24,693,187 - 24,696,156 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 24,830,136 - 24,833,101 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 24,420,790 - 24,423,748 (-) NCBI MGSCv36 mm8 Celera 17 25,216,107 - 25,219,071 (-) NCBI Celera Cytogenetic Map 17 A3.3 NCBI cM Map 17 12.48 NCBI
GFER Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 16 1,984,193 - 1,987,749 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 16 1,984,193 - 1,987,749 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 16 2,034,194 - 2,037,750 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 16 1,974,151 - 1,977,751 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 16 1,974,150 - 1,977,749 NCBI Celera 16 2,246,329 - 2,249,928 (+) NCBI Celera Cytogenetic Map 16 p13.3 NCBI HuRef 16 1,958,203 - 1,961,803 (+) NCBI HuRef CHM1_1 16 2,034,076 - 2,037,676 (+) NCBI CHM1_1 T2T-CHM13v2.0 16 2,004,138 - 2,007,694 (+) NCBI T2T-CHM13v2.0
Gfer Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 14,223,023 - 14,225,736 (-) NCBI GRCr8 mRatBN7.2 10 13,718,489 - 13,721,782 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 13,718,489 - 13,720,869 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 18,465,172 - 18,467,528 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 17,954,025 - 17,956,381 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 13,453,227 - 13,455,583 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 14,059,347 - 14,061,703 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 14,059,347 - 14,061,703 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 13,876,328 - 13,878,685 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 13,946,311 - 13,948,665 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 10 13,946,310 - 13,948,665 (-) NCBI Celera 10 13,398,231 - 13,400,587 (-) NCBI Celera Cytogenetic Map 10 q12 NCBI
Gfer Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955442 15,281,419 - 15,283,266 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955442 15,280,753 - 15,283,405 (-) NCBI ChiLan1.0 ChiLan1.0
GFER Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 18 2,359,690 - 2,363,217 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 16 6,141,337 - 6,144,864 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 16 716,640 - 720,196 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 16 2,073,064 - 2,076,592 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 16 2,073,064 - 2,076,592 (+) Ensembl panpan1.1 panPan2
GFER Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 38,948,927 - 38,951,300 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 38,949,484 - 38,951,703 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 40,188,617 - 40,190,946 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 39,265,945 - 39,268,274 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 39,266,502 - 39,268,893 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 38,942,725 - 38,945,054 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 38,915,028 - 38,917,357 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 39,393,915 - 39,396,244 (-) NCBI UU_Cfam_GSD_1.0
Gfer Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 104,655,651 - 104,658,098 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936694 2,051,325 - 2,053,818 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936694 2,051,362 - 2,053,812 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
GFER Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 39,981,940 - 39,984,991 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 39,981,938 - 39,984,451 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 42,197,274 - 42,199,315 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GFER Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 5 1,880,025 - 1,886,829 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 5 1,879,968 - 1,883,696 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666068 29,184,259 - 29,187,914 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gfer
.
Predicted Target Of
Count of predictions: 356 Count of miRNA genes: 273 Interacting mature miRNAs: 301 Transcripts: ENSMUST00000046839 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1558807 Ceat1_m chronic experimental autoimmune thyroiditis 1 (mouse) Not determined 17 12636682 26401133 Mouse 12910528 Nrq1_m noise-induced hearing loss resistant QTL 1 (mouse) 17 1 29198453 Mouse 1302038 Radpf1_m radiation pulmonary fibrosis 1 (mouse) Not determined 17 16835455 33819843 Mouse 1300890 Bhr3_m bronchial hyperresponsiveness 3 (mouse) Not determined 17 3974890 48866091 Mouse 1300995 Fembrs4_m femur breaking strength 4 (mouse) Not determined 17 15061652 49061760 Mouse 4142507 Obrq13_m obesity resistance QTL 13 (mouse) Not determined 12198329 25076769 Mouse 1300613 Pcyts4_m plasmacytoma susceptibility 4 (mouse) Not determined 17 1 27081639 Mouse 4141608 Phl1_m progressive hearing loss 1 (mouse) Not determined 17 7875843 29487423 Mouse 1302152 Skull25_m skull morphology 25 (mouse) Not determined 17 16819721 50819843 Mouse 1302028 Asbb3_m autoimmune susceptibility in C57BL/6J and BALB/c 3 (mouse) Not determined 17 10878119 44878219 Mouse 15039354 Nmrs36_m NAFLD-associated magnetic resonance shift 36 (mouse) 17 19145025 53145025 Mouse 4141215 Mnic1_m macronutrient intake, carbohydrate 1 (mouse) Not determined 4854752 45670266 Mouse 1300787 Cd8mts5_m CD8 memory T cell subset 5 (mouse) Not determined 17 8584914 42585149 Mouse 13524847 Asrq8a_m acoustic startle response 8a (mouse) 17 12646961 46646961 Mouse 1300914 Pcir4_m periosteal circumference 4 (mouse) Not determined 17 15061652 49061760 Mouse 13452396 Leusq3_m leucocytosis susceptibility QTL 3 (mouse) 17 17462208 51462345 Mouse 13452399 Leusq6_m leucocytosis susceptibility QTL 6 (mouse) 17 17462208 51462345 Mouse 1300535 Char3_m P. chabaudi malaria resistance QTL 3 (mouse) Not determined 17 17462208 51462345 Mouse 1302070 Tbbmd7_m total body bone mineral density 7 (mouse) Not determined 17 15061652 49061760 Mouse 10412214 Sxbq3_m SGC/Knj cross B6 QTL 3 (mouse) Not determined 17 17462208 51462345 Mouse 10412083 Sm2_m susceptibility to Schistosoma mansoni infection 2 (mouse) Not determined 17 17029943 51030078 Mouse 10043949 Pbft7_m percent body fat 7 (mouse) Not determined 17 6893936 40893936 Mouse 4141067 Hbnr2_m Heligmosomoides bakeri nematode resistance 2 (mouse) Not determined 11885971 45886119 Mouse 12904946 Tammq8_m tibialis anterior muscle mass QTL 8 (mouse) 17 12451787 46451787 Mouse 4142342 Lfnq4_m lung function QTL 4 (mouse) Not determined 11206484 39364059 Mouse 1357743 Lith3_m lithogenic gene 3 (mouse) Not determined 17 1 26194456 Mouse 1301935 Skull24_m skull morphology 24 (mouse) Not determined 17 8584914 42585149 Mouse 13524851 Asrq8_m acoustic startle response 8 (mouse) 17 1 31030170 Mouse 1301331 Lbw1_m lupus NZB x NZW 1 (mouse) Not determined 17 18418357 52420983 Mouse 12910982 Pifs2_m peptide-induced fatal syndrome 2 (mouse) 17 1 26189355 Mouse 1301840 Ssial4_m susceptibility to sialadenitiss 4 (mouse) Not determined 17 18175412 52178214 Mouse 1302100 Circp2_m circadian photosensitivity 2 (mouse) Not determined 17 1 29198453 Mouse 1357789 Kdnw3_m kidney weight 3 (mouse) Not determined 17 4854752 47885665 Mouse 1301338 Lmr1_m leishmaniasis resistance 1 (mouse) Not determined 17 10081340 86996400 Mouse 1301056 Pas2_m pulmonary adenoma susceptibility 2 (mouse) Not determined 17 18422141 52424327 Mouse 1357902 Obq19_m obesity QTL 19 (mouse) Not determined 17 1 25662076 Mouse 1301327 Lmr7_m leishmaniasis resistance 7 (mouse) Not determined 17 4854752 27715939 Mouse 1301454 Eae5_m susceptibility to experimental allergic encephalomyelitis 5 (mouse) Not determined 17 24612750 58612864 Mouse 14747010 Mancz14_m mandible centroid size 14 (mouse) 17 11998184 45998184 Mouse 1357680 Idd23_m insulin dependent diabetes susceptibility 23 (mouse) Not determined 17 3974890 26401133 Mouse 4141272 Tfv1_m total food volume 1 (mouse) Not determined 4854752 65637357 Mouse 10412276 Leci2_m leukocyte endothelial cell interactions 2 (mouse) Not determined 17 3348175 37348299 Mouse 1302140 Wta4_m weight adult 4 (mouse) Not determined 17 16819721 50819843 Mouse 1300706 Alan1_m alloantigen response 1 (mouse) Not determined 17 4854752 46469702 Mouse 1558886 Lgth9_m body length 9 (mouse) Not determined 17 15061652 49061760 Mouse 12910769 Rtmq1_m renal tumor modifier QTL 1 (mouse) 17 22900036 25721472 Mouse 4142150 Stheal11_m soft tissue heal 11 (mouse) Not determined 17 12286211 83361768 Mouse 11081168 Tir7_m trypanosome infection response 7 (mouse) 17 14123372 48123496 Mouse 12910527 Nrq1a_m noise-induced hearing loss resistant QTL 1a (mouse) 17 1 29198453 Mouse 1301615 Cfld3_m cystic fibrosis lung disease 3 (mouse) Not determined 17 1 27081639 Mouse
U40494
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 17 24,693,467 - 24,693,592 UniSTS GRCm38 MGSCv37 17 24,830,412 - 24,830,537 UniSTS GRCm37 Celera 17 25,216,383 - 25,216,508 UniSTS Celera 17 23,396,603 - 23,396,728 UniSTS Cytogenetic Map 17 A3.3 UniSTS Whitehead/MRC_RH 17 312.77 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000046839 ⟹ ENSMUSP00000049186
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 24,912,164 - 24,915,130 (-) Ensembl GRCm38.p6 Ensembl 17 24,693,190 - 24,696,156 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000234197 ⟹ ENSMUSP00000157329
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 24,912,161 - 24,915,067 (-) Ensembl GRCm38.p6 Ensembl 17 24,693,187 - 24,696,093 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000234235 ⟹ ENSMUSP00000157249
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 24,913,159 - 24,915,064 (-) Ensembl GRCm38.p6 Ensembl 17 24,694,185 - 24,696,090 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000234520 ⟹ ENSMUSP00000157116
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 24,912,164 - 24,915,086 (-) Ensembl GRCm38.p6 Ensembl 17 24,693,190 - 24,696,112 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000234811
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 24,912,161 - 24,913,960 (-) Ensembl GRCm38.p6 Ensembl 17 24,693,187 - 24,694,986 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000234859 ⟹ ENSMUSP00000157365
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 24,912,164 - 24,914,680 (-) Ensembl GRCm38.p6 Ensembl 17 24,693,190 - 24,695,706 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000249874 ⟹ ENSMUSP00000159970
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 17 24,913,170 - 24,915,503 (-) Ensembl
RefSeq Acc Id:
NM_001379038 ⟹ NP_001365967
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 24,912,164 - 24,915,065 (-) NCBI GRCm38 17 24,693,190 - 24,696,091 (-) NCBI
Sequence:
CCCCGCTGCCCGCACGCCAGCAAGATGGCGGCGCCCAGCGAGCCGGCGGGCTTCCCTCGCGGCAGTCGCTTCTCCTTCCTGCCGGGCGGCGCGCGCTCCGAGATGACCGACGACCTGGTGACTGACGC
hide sequence
RefSeq Acc Id:
NM_001379039 ⟹ NP_001365968
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 24,912,164 - 24,915,065 (-) NCBI GRCm38 17 24,693,190 - 24,696,091 (-) NCBI
Sequence:
CCCCGCTGCCCGCACGCCAGCAAGATGGCGGCGCCCAGCGAGCCGGCGGGCTTCCCTCGCGGCA
hide sequence
RefSeq Acc Id:
NM_001409977 ⟹ NP_001396906
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 24,912,164 - 24,915,065 (-) NCBI
RefSeq Acc Id:
NM_001409981 ⟹ NP_001396910
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 24,912,164 - 24,915,065 (-) NCBI
RefSeq Acc Id:
NM_023040 ⟹ NP_075527
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 24,912,164 - 24,915,065 (-) NCBI GRCm38 17 24,693,191 - 24,696,156 (-) NCBI MGSCv37 17 24,830,136 - 24,833,101 (-) RGD Celera 17 25,216,107 - 25,219,071 (-) RGD cM Map 17 ENTREZGENE
Sequence:
CCTGCCGCCGCGCGCCGGCGGTGGCGTGCACGCTCCTCCGAACTGTCGCCGGCACGCCCTCTTGGCCCCGCTGCCCGCACGCCAGCAAGATGGCGGCGCCCAGCGAGCCGGCGGGCTTCCCTCGCGGC
hide sequence
RefSeq Acc Id:
NR_176925
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 24,912,164 - 24,915,065 (-) NCBI
RefSeq Acc Id:
NR_176926
RefSeq Status:
VALIDATED
Type:
NON-CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 17 24,912,164 - 24,915,065 (-) NCBI
RefSeq Acc Id:
NP_075527 ⟸ NM_023040
- Peptide Label:
isoform 1
- UniProtKB:
Q8CIF8 (UniProtKB/Swiss-Prot), Q9JJE6 (UniProtKB/Swiss-Prot), P56213 (UniProtKB/Swiss-Prot)
- Sequence:
MAAPSEPAGFPRGSRFSFLPGGARSEMTDDLVTDARGRGARHRDDTTPAAAPAPQGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRHTWAFLHTLAAYYPDRPTPEQQQDMAQFIHI
hide sequence
RefSeq Acc Id:
NP_001365967 ⟸ NM_001379038
- Peptide Label:
isoform 2
- UniProtKB:
A0A3Q4EGL6 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001365968 ⟸ NM_001379039
- Peptide Label:
isoform 3
Ensembl Acc Id:
ENSMUSP00000049186 ⟸ ENSMUST00000046839
Ensembl Acc Id:
ENSMUSP00000157365 ⟸ ENSMUST00000234859
Ensembl Acc Id:
ENSMUSP00000157116 ⟸ ENSMUST00000234520
Ensembl Acc Id:
ENSMUSP00000157329 ⟸ ENSMUST00000234197
Ensembl Acc Id:
ENSMUSP00000157249 ⟸ ENSMUST00000234235
RefSeq Acc Id:
NP_001396910 ⟸ NM_001409981
- Peptide Label:
5
RefSeq Acc Id:
NP_001396906 ⟸ NM_001409977
- Peptide Label:
4
Ensembl Acc Id:
ENSMUSP00000159970 ⟸ ENSMUST00000249874
RGD ID: 13675056 Promoter ID: EPDNEW_M21677 Type: initiation region Name: Gfer_1 Description: Mus musculus growth factor, augmenter of liver regeneration ,mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 17 24,696,087 - 24,696,147 EPDNEW
RGD ID: 6828419 Promoter ID: MM_KWN:22538 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4 Transcripts: NM_023040, OTTMUST00000049755 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 17 24,832,051 - 24,833,957 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2017-09-05
Gfer
growth factor, augmenter of liver regeneration
growth factor, erv1 (S. cerevisiae)-like (augmenter of liver regeneration)
Symbol and/or name change
5135510 APPROVED
