Symbol:
Bud31
Name:
BUD31 homolog
RGD ID:
621103
Description:
Predicted to enable nuclear receptor binding activity and transcription coactivator activity. Predicted to be involved in mRNA splicing, via spliceosome. Predicted to be located in centrosome; chromatin; and nucleoplasm. Predicted to be part of U2-type catalytic step 2 spliceosome. Biomarker of schistosomiasis. Orthologous to human BUD31 (BUD31 homolog); PARTICIPATES IN spliceosome pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
BUD31 homolog (S. cerevisiae); BUD31 homolog (yeast); EDG-2; Edg2; G10; LPA1; maternal G10 transcript; protein BUD31 homolog; protein G10 homolog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BUD31 (BUD31 homolog) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Bud31 (BUD31 homolog) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Bud31 (BUD31 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BUD31 (BUD31 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BUD31 (BUD31 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Bud31 (BUD31 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BUD31 (BUD31 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BUD31 (BUD31 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Bud31 (BUD31 homolog) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Bud31 (BUD31 homolog)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
BUD31 (BUD31 homolog)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
bud31 (BUD31 homolog)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
BUD31
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
bud-31
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
l(1)10Bb
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
bud31
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 14,576,602 - 14,584,132 (-) NCBI GRCr8 mRatBN7.2 12 9,462,838 - 9,470,387 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 9,462,441 - 9,470,509 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 10,267,864 - 10,275,146 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 10,891,070 - 10,898,348 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 9,914,494 - 9,921,776 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 11,232,963 - 11,240,449 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 11,232,964 - 11,240,400 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 13,302,066 - 13,309,485 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 9,776,932 - 9,784,337 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 9,806,860 - 9,814,263 (-) NCBI Celera 12 11,267,999 - 11,275,310 (-) NCBI Celera Cytogenetic Map 12 p11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Bud31 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO BUD31 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of BUD31 mRNA CTD PMID:22079256 Bud31 Rat 1,2-dimethylhydrazine multiple interactions ISO Bud31 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of BUD31 mRNA CTD PMID:22206623 Bud31 Rat 1,2-dimethylhydrazine increases expression ISO Bud31 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of BUD31 mRNA CTD PMID:22206623 Bud31 Rat 17beta-estradiol increases expression ISO Bud31 (Mus musculus) 6480464 Estradiol results in increased expression of BUD31 mRNA CTD PMID:39298647 Bud31 Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Bud31 (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Bud31 Rat 2,2',4,4'-Tetrabromodiphenyl ether increases expression ISO BUD31 (Homo sapiens) 6480464 2 more ... CTD PMID:37385330 Bud31 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO BUD31 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BUD31 mRNA CTD PMID:19684285 Bud31 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of BUD31 mRNA CTD PMID:34747641 Bud31 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Bud31 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BUD31 mRNA CTD PMID:20702594 and PMID:21570461 Bud31 Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Bud31 (Mus musculus) 6480464 2 more ... CTD PMID:20702594 Bud31 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of BUD31 mRNA CTD PMID:21346803 Bud31 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of BUD31 mRNA CTD PMID:21346803 Bud31 Rat 2-hydroxypropanoic acid decreases expression ISO BUD31 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of BUD31 mRNA CTD PMID:30851411 Bud31 Rat 2-palmitoylglycerol increases expression ISO BUD31 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of BUD31 mRNA CTD PMID:37199045 Bud31 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Bud31 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of BUD31 mRNA CTD PMID:20188158 Bud31 Rat 4,4'-diaminodiphenylmethane affects expression ISO Bud31 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of BUD31 mRNA CTD PMID:18648102 Bud31 Rat 4,4'-sulfonyldiphenol increases expression ISO Bud31 (Mus musculus) 6480464 bisphenol S results in increased expression of BUD31 mRNA CTD PMID:39298647 Bud31 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of BUD31 mRNA CTD PMID:36041667 Bud31 Rat 4,4'-sulfonyldiphenol decreases methylation ISO Bud31 (Mus musculus) 6480464 bisphenol S results in decreased methylation of BUD31 exon CTD PMID:33297965 Bud31 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of BUD31 mRNA CTD PMID:30047161 Bud31 Rat acrolein multiple interactions ISO BUD31 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of BUD31 mRNA more ... CTD PMID:32699268 and PMID:32845096 Bud31 Rat acrylamide increases expression ISO BUD31 (Homo sapiens) 6480464 Acrylamide results in increased expression of BUD31 mRNA CTD PMID:32763439 Bud31 Rat aflatoxin B1 increases methylation ISO BUD31 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of BUD31 gene CTD PMID:27153756 Bud31 Rat alpha-pinene multiple interactions ISO BUD31 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of BUD31 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of BUD31 mRNA CTD PMID:32699268 Bud31 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of BUD31 mRNA CTD PMID:30047161 Bud31 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of BUD31 mRNA CTD PMID:16483693 Bud31 Rat Aroclor 1254 decreases expression ISO Bud31 (Mus musculus) 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of BUD31 mRNA CTD PMID:23650126 Bud31 Rat arsane multiple interactions ISO BUD31 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BUD31 mRNA CTD PMID:39836092 Bud31 Rat arsenic atom multiple interactions ISO BUD31 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BUD31 mRNA CTD PMID:39836092 Bud31 Rat benzo[a]pyrene increases expression ISO Bud31 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of BUD31 mRNA CTD PMID:22228805 Bud31 Rat benzo[a]pyrene affects methylation ISO BUD31 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BUD31 promoter CTD PMID:27901495 Bud31 Rat beta-lapachone increases expression ISO BUD31 (Homo sapiens) 6480464 beta-lapachone results in increased expression of BUD31 mRNA CTD PMID:38218311 Bud31 Rat bis(2-ethylhexyl) phthalate multiple interactions ISO BUD31 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of BUD31 5' UTR CTD PMID:33872906 Bud31 Rat bis(2-ethylhexyl) phthalate increases expression ISO Bud31 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of BUD31 mRNA CTD PMID:33754040 Bud31 Rat bisphenol A decreases methylation ISO Bud31 (Mus musculus) 6480464 bisphenol A results in decreased methylation of BUD31 promoter CTD PMID:27312807 Bud31 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of BUD31 mRNA CTD PMID:36041667 Bud31 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of BUD31 mRNA CTD PMID:32145629 Bud31 Rat bisphenol A affects expression ISO BUD31 (Homo sapiens) 6480464 bisphenol A affects the expression of BUD31 mRNA CTD PMID:30903817 Bud31 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of BUD31 gene CTD PMID:28505145 Bud31 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of BUD31 mRNA CTD PMID:36041667 Bud31 Rat butanal increases expression ISO BUD31 (Homo sapiens) 6480464 butyraldehyde results in increased expression of BUD31 mRNA CTD PMID:26079696 Bud31 Rat carbon nanotube increases expression ISO Bud31 (Mus musculus) 6480464 Nanotubes and Carbon analog results in increased expression of BUD31 mRNA CTD PMID:25554681 Bud31 Rat CGP 52608 multiple interactions ISO BUD31 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to BUD31 gene] CTD PMID:28238834 Bud31 Rat chloropicrin increases expression ISO BUD31 (Homo sapiens) 6480464 chloropicrin results in increased expression of BUD31 mRNA CTD PMID:26352163 Bud31 Rat copper(II) sulfate increases expression ISO BUD31 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of BUD31 mRNA CTD PMID:19549813 Bud31 Rat crocidolite asbestos decreases expression ISO Bud31 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of BUD31 mRNA CTD PMID:29279043 Bud31 Rat cyclosporin A increases expression ISO BUD31 (Homo sapiens) 6480464 Cyclosporine results in increased expression of BUD31 mRNA CTD PMID:20106945 and PMID:25562108 Bud31 Rat dibenzo[a,l]pyrene decreases expression ISO Bud31 (Mus musculus) 6480464 dibenzo(a and l)pyrene results in decreased expression of BUD31 mRNA CTD PMID:25908611 Bud31 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of BUD31 mRNA CTD PMID:21266533 Bud31 Rat doxorubicin increases expression ISO BUD31 (Homo sapiens) 6480464 Doxorubicin results in increased expression of BUD31 mRNA CTD PMID:29803840 Bud31 Rat ethyl methanesulfonate increases expression ISO BUD31 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of BUD31 mRNA CTD PMID:23649840 Bud31 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of BUD31 mRNA CTD PMID:24136188 Bud31 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of BUD31 mRNA CTD PMID:34044035 Bud31 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of BUD31 mRNA CTD PMID:24136188 Bud31 Rat folic acid multiple interactions ISO Bud31 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of BUD31 mRNA CTD PMID:22206623 Bud31 Rat folic acid decreases expression ISO Bud31 (Mus musculus) 6480464 Folic Acid results in decreased expression of BUD31 mRNA CTD PMID:25629700 Bud31 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of BUD31 mRNA CTD PMID:33387578 Bud31 Rat ivermectin decreases expression ISO BUD31 (Homo sapiens) 6480464 Ivermectin results in decreased expression of BUD31 protein CTD PMID:32959892 Bud31 Rat manganese atom multiple interactions ISO BUD31 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BUD31 mRNA CTD PMID:39836092 Bud31 Rat manganese(0) multiple interactions ISO BUD31 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BUD31 mRNA CTD PMID:39836092 Bud31 Rat manganese(II) chloride multiple interactions ISO BUD31 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BUD31 mRNA CTD PMID:39836092 Bud31 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of BUD31 mRNA CTD PMID:30047161 Bud31 Rat methyl methanesulfonate increases expression ISO BUD31 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of BUD31 mRNA CTD PMID:23649840 Bud31 Rat mono(2-ethylhexyl) phthalate multiple interactions ISO BUD31 (Homo sapiens) 6480464 [Diethylhexyl Phthalate results in increased abundance of mono-(2-ethylhexyl)phthalate] which results in decreased methylation of BUD31 5' UTR CTD PMID:33872906 Bud31 Rat nitrates multiple interactions ISO Bud31 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of BUD31 mRNA CTD PMID:35964746 Bud31 Rat ozone multiple interactions ISO BUD31 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of BUD31 mRNA more ... CTD PMID:32699268 and PMID:32845096 Bud31 Rat ozone multiple interactions ISO Bud31 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of BUD31 mRNA CTD PMID:34911549 Bud31 Rat paracetamol increases expression ISO BUD31 (Homo sapiens) 6480464 Acetaminophen results in increased expression of BUD31 mRNA CTD PMID:29067470 Bud31 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of BUD31 mRNA CTD PMID:33387578 Bud31 Rat phenobarbital affects expression ISO BUD31 (Homo sapiens) 6480464 Phenobarbital affects the expression of BUD31 mRNA CTD PMID:19159669 Bud31 Rat potassium chromate multiple interactions ISO BUD31 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of BUD31 mRNA CTD PMID:22079256 Bud31 Rat potassium chromate increases expression ISO BUD31 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of BUD31 mRNA CTD PMID:22079256 Bud31 Rat rac-lactic acid decreases expression ISO BUD31 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of BUD31 mRNA CTD PMID:30851411 Bud31 Rat resveratrol decreases expression ISO Bud31 (Mus musculus) 6480464 resveratrol results in decreased expression of BUD31 protein CTD PMID:25505154 Bud31 Rat sodium arsenite increases expression ISO BUD31 (Homo sapiens) 6480464 sodium arsenite results in increased expression of BUD31 mRNA CTD PMID:38568856 Bud31 Rat sodium arsenite multiple interactions ISO BUD31 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of BUD31 mRNA CTD PMID:39836092 Bud31 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of BUD31 mRNA CTD PMID:19281266 Bud31 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of BUD31 mRNA CTD PMID:30047161 Bud31 Rat sunitinib increases expression ISO BUD31 (Homo sapiens) 6480464 Sunitinib results in increased expression of BUD31 mRNA CTD PMID:31533062 Bud31 Rat tetrachloromethane increases expression ISO Bud31 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of BUD31 mRNA CTD PMID:31919559 Bud31 Rat thiram increases expression ISO BUD31 (Homo sapiens) 6480464 Thiram results in increased expression of BUD31 mRNA CTD PMID:38568856 Bud31 Rat triadimefon increases expression EXP 6480464 triadimefon results in increased expression of BUD31 mRNA CTD PMID:30047161 Bud31 Rat trichostatin A affects expression ISO BUD31 (Homo sapiens) 6480464 trichostatin A affects the expression of BUD31 mRNA CTD PMID:28542535 Bud31 Rat triphenyl phosphate affects expression ISO BUD31 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of BUD31 mRNA CTD PMID:37042841 Bud31 Rat tunicamycin increases expression ISO BUD31 (Homo sapiens) 6480464 Tunicamycin results in increased expression of BUD31 mRNA CTD PMID:29453283 Bud31 Rat urethane increases expression ISO BUD31 (Homo sapiens) 6480464 Urethane results in increased expression of BUD31 mRNA CTD PMID:28818685 Bud31 Rat valproic acid increases expression ISO BUD31 (Homo sapiens) 6480464 Valproic Acid results in increased expression of BUD31 mRNA CTD PMID:29154799 Bud31 Rat Yessotoxin decreases expression ISO BUD31 (Homo sapiens) 6480464 yessotoxin analog results in decreased expression of BUD31 mRNA CTD PMID:30679557 Bud31 Rat zearalenone increases expression ISO Bud31 (Mus musculus) 6480464 Zearalenone results in increased expression of BUD31 protein CTD PMID:36252740
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 2-hydroxypropanoic acid (ISO) 2-palmitoylglycerol (ISO) 3,4-methylenedioxymethamphetamine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) acrylamide (ISO) aflatoxin B1 (ISO) alpha-pinene (ISO) amitrole (EXP) ammonium chloride (EXP) Aroclor 1254 (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (EXP) butanal (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloropicrin (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) cyclosporin A (ISO) dibenzo[a,l]pyrene (ISO) dibutyl phthalate (EXP) doxorubicin (ISO) ethyl methanesulfonate (ISO) finasteride (EXP) fipronil (EXP) flutamide (EXP) folic acid (ISO) gentamycin (EXP) ivermectin (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methimazole (EXP) methyl methanesulfonate (ISO) mono(2-ethylhexyl) phthalate (ISO) nitrates (ISO) ozone (ISO) paracetamol (EXP,ISO) phenobarbital (ISO) potassium chromate (ISO) rac-lactic acid (ISO) resveratrol (ISO) sodium arsenite (ISO) Soman (EXP) sulfadimethoxine (EXP) sunitinib (ISO) tetrachloromethane (ISO) thiram (ISO) triadimefon (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) Yessotoxin (ISO) zearalenone (ISO)
1.
A rat G protein-coupled receptor selectively expressed in myelin-forming cells.
Allard J, etal., Eur J Neurosci. 1998 Mar;10(3):1045-53.
2.
Edg-2 in myelin-forming cells: isoforms, genomic mapping, and exclusion in Charcot-Marie-Tooth disease.
Allard J, etal., Glia. 1999 Apr;26(2):176-85.
3.
Immunohistological localization of the myelinating cell-specific receptor LP(A1).
Cervera P, etal., Glia. 2002 Apr 15;38(2):126-36.
4.
Splicing and beyond: the many faces of the Prp19 complex.
Chanarat S and Strasser K, Biochim Biophys Acta. 2013 Oct;1833(10):2126-34. doi: 10.1016/j.bbamcr.2013.05.023. Epub 2013 Jun 3.
5.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.
The temporal profile of genomic responses and protein synthesis in ischemic tolerance of the rat brain induced by repeated hyperbaric oxygen.
Hirata T, etal., Brain Res. 2007 Jan 26;1130(1):214-22. Epub 2006 Dec 13.
7.
Identification and profiling of circulating antigens by screening with the sera from schistosomiasis japonica patients.
Lu Y, etal., Parasit Vectors. 2012 Jun 11;5:115. doi: 10.1186/1756-3305-5-115.
8.
A functional SNP in EDG2 increases susceptibility to knee osteoarthritis in Japanese.
Mototani H, etal., Hum Mol Genet. 2008 Jun 15;17(12):1790-7. doi: 10.1093/hmg/ddn069. Epub 2008 Mar 6.
9.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
GOA pipeline
RGD automated data pipeline
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Hepatic oval (stem) cell expression of endothelial differentiation gene receptors for lysophosphatidic acid in mouse chronic liver injury.
Sautin YY, etal., J Hematother Stem Cell Res. 2002 Aug;11(4):643-9.
14.
Oligodendroglial expression of Edg-2 receptor: developmental analysis and pharmacological responses to lysophosphatidic acid.
Stankoff B, etal., Mol Cell Neurosci 2002 Jul;20(3):415-28.
Bud31 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 12 14,576,602 - 14,584,132 (-) NCBI GRCr8 mRatBN7.2 12 9,462,838 - 9,470,387 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 12 9,462,441 - 9,470,509 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 12 10,267,864 - 10,275,146 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 12 10,891,070 - 10,898,348 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 12 9,914,494 - 9,921,776 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 12 11,232,963 - 11,240,449 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 12 11,232,964 - 11,240,400 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 12 13,302,066 - 13,309,485 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 12 9,776,932 - 9,784,337 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 12 9,806,860 - 9,814,263 (-) NCBI Celera 12 11,267,999 - 11,275,310 (-) NCBI Celera Cytogenetic Map 12 p11 NCBI
BUD31 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 7 99,408,969 - 99,419,616 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 7 99,408,641 - 99,419,616 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 7 99,006,592 - 99,017,239 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 7 98,844,548 - 98,855,175 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 7 93,740,801 - 93,751,440 (+) NCBI Celera Cytogenetic Map 7 q22.1 NCBI HuRef 7 93,642,344 - 93,652,982 (+) NCBI HuRef CHM1_1 7 98,936,679 - 98,947,317 (+) NCBI CHM1_1 T2T-CHM13v2.0 7 100,647,870 - 100,658,517 (+) NCBI T2T-CHM13v2.0 CRA_TCAGchr7v2 7 98,366,375 - 98,377,013 (+) NCBI
Bud31 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 145,077,186 - 145,084,888 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 145,077,172 - 145,084,888 (+) Ensembl GRCm39 Ensembl GRCm38 5 145,140,376 - 145,148,078 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 145,140,362 - 145,148,078 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 145,901,266 - 145,908,943 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 145,393,924 - 145,401,601 (+) NCBI MGSCv36 mm8 Celera 5 142,132,269 - 142,139,945 (+) NCBI Celera Cytogenetic Map 5 G2 NCBI cM Map 5 85.05 NCBI
Bud31 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955460 15,083,472 - 15,092,217 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955460 15,083,472 - 15,092,217 (+) NCBI ChiLan1.0 ChiLan1.0
BUD31 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 6 117,266,324 - 117,277,347 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 7 165,531,235 - 165,541,982 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 7 91,382,353 - 91,393,112 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 7 104,884,088 - 104,894,865 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 7 104,884,088 - 104,894,865 (+) Ensembl panpan1.1 panPan2
BUD31 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 10,169,422 - 10,178,231 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 11,795,002 - 11,804,994 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 10,169,654 - 10,178,420 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 10,169,604 - 10,178,138 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 10,038,422 - 10,048,381 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 10,018,132 - 10,026,908 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 10,251,934 - 10,260,704 (-) NCBI UU_Cfam_GSD_1.0
Bud31 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 138,261,066 - 138,268,691 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936750 1,676,359 - 1,686,072 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936750 1,676,361 - 1,684,194 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
BUD31 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 3 6,355,244 - 6,361,207 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 3 6,355,249 - 6,361,211 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 3 6,693,614 - 6,699,369 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BUD31 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 28 13,734,417 - 13,750,749 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 28 13,733,391 - 13,749,692 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666070 2,552,479 - 2,562,333 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Bud31
.
Predicted Target Of
Count of predictions: 58 Count of miRNA genes: 55 Interacting mature miRNAs: 58 Transcripts: ENSRNOT00000001307 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2312418 Kidm41 Kidney mass QTL 41 3.7 0.0001 kidney mass (VT:0002707) single kidney wet weight to body weight ratio (CMO:0000622) 12 1 19611090 Rat 8552964 Pigfal17 Plasma insulin-like growth factor 1 level QTL 17 3.5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 7411641 Foco19 Food consumption QTL 19 27.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 1331739 Hrtrt14 Heart rate QTL 14 3.56232 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 12 9318216 12829686 Rat 9590147 Scort7 Serum corticosterone level QTL 7 13.61 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 12 1 42110980 Rat 8552912 Pigfal6 Plasma insulin-like growth factor 1 level QTL 6 5 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564498 46669029 Rat 10059594 Kidm46 Kidney mass QTL 46 3.79 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 12 6107579 46669029 Rat 61331 Eau2 Experimental allergic uveoretinitis QTL 2 0.0005 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 12 8525423 28064601 Rat 1581516 Cm56 Cardiac mass QTL 56 4.2 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 12 1 29333307 Rat 9590086 Insglur6 Insulin/glucose ratio QTL 6 18.97 0.001 blood insulin amount (VT:0001560) calculated plasma insulin level (CMO:0002170) 12 1 42110980 Rat 8552918 Pigfal7 Plasma insulin-like growth factor 1 level QTL 7 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 12 5564495 46669029 Rat 6893681 Bw109 Body weight QTL 109 2.3 0.004 body mass (VT:0001259) body weight (CMO:0000012) 12 1 23297788 Rat 1302792 Scl21 Serum cholesterol level QTL 21 3.8 0.0011 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 12 7196730 46669029 Rat 1598855 Bp294 Blood pressure QTL 294 3.5 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 12 1 34851688 Rat 1600391 Edcs2 Endometrial carcinoma susceptibility QTL2 3.5 0.01 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 12 6833190 17870186 Rat 10755457 Coatc14 Coat color QTL 14 0.01759 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 12 1 22591684 Rat 724526 Uae3 Urinary albumin excretion QTL 3 4.9 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 12 3906969 10373166 Rat 634351 Apr5 Acute phase response QTL 5 6.7 blood interleukin-6 amount (VT:0008595) plasma interleukin-6 level (CMO:0001927) 12 1 44503507 Rat 8694179 Bw150 Body weight QTL 150 2.9 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 634350 Apr4 Acute phase response QTL 4 6 orosomucoid 1 amount (VT:0010541) plasma orosomucoid 1 level (CMO:0001467) 12 1172005 46172005 Rat 7411545 Bw128 Body weight QTL 128 5.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 12 1 42110980 Rat 7411547 Bw129 Body weight QTL 129 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 6 5564495 46669029 Rat 7387292 Kidm42 Kidney mass QTL 42 3.03 0.0004 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 12 1 36247923 Rat 1300157 Rf21 Renal function QTL 21 4.4 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 12 9318216 32103380 Rat 737979 Pia22 Pristane induced arthritis QTL 22 53.1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 12 1 44465750 Rat 7411586 Foco5 Food consumption QTL 5 5.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 2303575 Insul14 Insulin level QTL 14 4 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 12 1 42450532 Rat 7411588 Foco6 Food consumption QTL 6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2302042 Pia38 Pristane induced arthritis QTL 38 3.5 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 12 1 44503507 Rat 7411595 Foco9 Food consumption QTL 9 4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat 7411597 Foco10 Food consumption QTL 10 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 5564495 46669029 Rat 2293086 Iddm30 Insulin dependent diabetes mellitus QTL 30 3.82 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 12 8449490 28302290 Rat 7411660 Foco28 Food consumption QTL 28 10.9 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 12 1 42110980 Rat
RH128787
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 9,462,946 - 9,464,356 (+) MAPPER mRatBN7.2 Rnor_6.0 12 11,233,072 - 11,234,481 NCBI Rnor6.0 Rnor_5.0 12 13,302,175 - 13,303,584 UniSTS Rnor5.0 RGSC_v3.4 12 9,777,041 - 9,778,450 UniSTS RGSC3.4 Celera 12 11,268,108 - 11,269,517 UniSTS RH 3.4 Map 3 1493.1 UniSTS Cytogenetic Map 12 p11 UniSTS
BI298983
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 12 9,463,074 - 9,463,234 (+) MAPPER mRatBN7.2 Rnor_6.0 12 11,233,200 - 11,233,359 NCBI Rnor6.0 Rnor_5.0 12 13,302,303 - 13,302,462 UniSTS Rnor5.0 RGSC_v3.4 12 9,777,169 - 9,777,328 UniSTS RGSC3.4 Celera 12 11,268,236 - 11,268,395 UniSTS RH 3.4 Map 12 101.68 UniSTS Cytogenetic Map 12 p11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001307 ⟹ ENSRNOP00000001307
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 9,462,841 - 9,470,302 (-) Ensembl Rnor_6.0 Ensembl 12 11,232,966 - 11,240,400 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000075987 ⟹ ENSRNOP00000068389
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 12 9,462,441 - 9,470,509 (-) Ensembl Rnor_6.0 Ensembl 12 11,232,964 - 11,240,399 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000076149 ⟹ ENSRNOP00000068388
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 12 11,234,561 - 11,240,383 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000076423 ⟹ ENSRNOP00000068416
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 12 11,234,436 - 11,240,101 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000088603 ⟹ ENSRNOP00000068574
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 12 11,232,964 - 11,239,521 (-) Ensembl
RefSeq Acc Id:
NM_053556 ⟹ NP_446008
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,576,602 - 14,584,007 (-) NCBI mRatBN7.2 12 9,462,838 - 9,470,245 (-) NCBI Rnor_6.0 12 11,232,963 - 11,240,368 (-) NCBI Rnor_5.0 12 13,302,066 - 13,309,485 (-) NCBI RGSC_v3.4 12 9,776,932 - 9,784,337 (-) RGD Celera 12 11,267,999 - 11,275,310 (-) RGD
Sequence:
CGGCACGAGCTTGAGTTTCCGATGAGACACAAGACTGAAGAGGAAAACTGATCTCCCCCAAAGACATAGAATAATTGGTAAATCTGGACGAGAACACAGGCTCATAACTGCGAAGAGCAAGGATTTTT
hide sequence
RefSeq Acc Id:
XM_006248887 ⟹ XP_006248949
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,576,602 - 14,584,132 (-) NCBI mRatBN7.2 12 9,462,838 - 9,470,387 (-) NCBI Rnor_6.0 12 11,232,963 - 11,240,449 (-) NCBI Rnor_5.0 12 13,302,066 - 13,309,485 (-) NCBI
Sequence:
TGGGCGGGGCCCCGCGAGGGCCTTATTCTGAAGAGTTTCTCACCGGAGCGGAAGCCGTCAATAA
hide sequence
RefSeq Acc Id:
XM_006248889 ⟹ XP_006248951
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,576,602 - 14,584,132 (-) NCBI mRatBN7.2 12 9,462,838 - 9,470,387 (-) NCBI Rnor_6.0 12 11,232,963 - 11,240,449 (-) NCBI Rnor_5.0 12 13,302,066 - 13,309,485 (-) NCBI
Sequence:
TGGGCGGGGCCCCGCGAGGGCCTTATTCTGAAGAGTTTCTCACCGGAGCGGAAGCCGTCAATAA
hide sequence
RefSeq Acc Id:
XM_039089844 ⟹ XP_038945772
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,576,602 - 14,584,065 (-) NCBI mRatBN7.2 12 9,462,838 - 9,470,220 (-) NCBI
RefSeq Acc Id:
XM_039089845 ⟹ XP_038945773
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,576,602 - 14,583,894 (-) NCBI mRatBN7.2 12 9,462,838 - 9,469,992 (-) NCBI
RefSeq Acc Id:
XM_039089846 ⟹ XP_038945774
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,576,602 - 14,583,809 (-) NCBI mRatBN7.2 12 9,462,838 - 9,469,995 (-) NCBI
RefSeq Acc Id:
XM_063271721 ⟹ XP_063127791
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,576,602 - 14,584,065 (-) NCBI
RefSeq Acc Id:
XM_063271723 ⟹ XP_063127793
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,576,602 - 14,583,808 (-) NCBI
RefSeq Acc Id:
XM_063271724 ⟹ XP_063127794
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 12 14,576,602 - 14,584,001 (-) NCBI
RefSeq Acc Id:
NP_446008 ⟸ NM_053556
- UniProtKB:
O70454 (UniProtKB/Swiss-Prot), Q6PDW3 (UniProtKB/Swiss-Prot), A6K1F5 (UniProtKB/TrEMBL)
- Sequence:
MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEV
hide sequence
RefSeq Acc Id:
XP_006248951 ⟸ XM_006248889
- Peptide Label:
isoform X1
- UniProtKB:
Q6PDW3 (UniProtKB/Swiss-Prot), O70454 (UniProtKB/Swiss-Prot), A6K1F5 (UniProtKB/TrEMBL)
- Sequence:
MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLF
hide sequence
RefSeq Acc Id:
XP_006248949 ⟸ XM_006248887
- Peptide Label:
isoform X1
- UniProtKB:
Q6PDW3 (UniProtKB/Swiss-Prot), O70454 (UniProtKB/Swiss-Prot), A6K1F5 (UniProtKB/TrEMBL)
- Sequence:
MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEV
hide sequence
Ensembl Acc Id:
ENSRNOP00000068389 ⟸ ENSRNOT00000075987
Ensembl Acc Id:
ENSRNOP00000001307 ⟸ ENSRNOT00000001307
Ensembl Acc Id:
ENSRNOP00000068388 ⟸ ENSRNOT00000076149
Ensembl Acc Id:
ENSRNOP00000068574 ⟸ ENSRNOT00000088603
Ensembl Acc Id:
ENSRNOP00000068416 ⟸ ENSRNOT00000076423
RefSeq Acc Id:
XP_038945772 ⟸ XM_039089844
- Peptide Label:
isoform X1
- UniProtKB:
O70454 (UniProtKB/Swiss-Prot), Q6PDW3 (UniProtKB/Swiss-Prot), A6K1F5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945774 ⟸ XM_039089846
- Peptide Label:
isoform X1
- UniProtKB:
O70454 (UniProtKB/Swiss-Prot), Q6PDW3 (UniProtKB/Swiss-Prot), A6K1F5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038945773 ⟸ XM_039089845
- Peptide Label:
isoform X1
- UniProtKB:
O70454 (UniProtKB/Swiss-Prot), Q6PDW3 (UniProtKB/Swiss-Prot), A6K1F5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063127791 ⟸ XM_063271721
- Peptide Label:
isoform X1
- UniProtKB:
Q6PDW3 (UniProtKB/Swiss-Prot), O70454 (UniProtKB/Swiss-Prot), A6K1F5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063127794 ⟸ XM_063271724
- Peptide Label:
isoform X1
- UniProtKB:
Q6PDW3 (UniProtKB/Swiss-Prot), O70454 (UniProtKB/Swiss-Prot), A6K1F5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063127793 ⟸ XM_063271723
- Peptide Label:
isoform X1
- UniProtKB:
Q6PDW3 (UniProtKB/Swiss-Prot), O70454 (UniProtKB/Swiss-Prot), A6K1F5 (UniProtKB/TrEMBL)
RGD ID: 13698417 Promoter ID: EPDNEW_R8941 Type: initiation region Name: Bud31_1 Description: BUD31 homolog SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 12 11,240,390 - 11,240,450 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-07-09
Bud31
BUD31 homolog
Bud31
BUD31 homolog (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2010-04-20
Bud31
BUD31 homolog (S. cerevisiae)
Bud31
BUD31 homolog (yeast)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2007-02-05
Bud31
BUD31 homolog (yeast)
G10
maternal G10 transcript
Symbol and Name updated to reflect Human and Mouse nomenclature
1299863 APPROVED
2005-01-20
G10
maternal G10 transcript
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
G10
maternal G10 transcript
Symbol and Name status set to provisional
70820 PROVISIONAL
