Symbol:
Pdlim5
Name:
PDZ and LIM domain 5
RGD ID:
621076
Description:
Enables actin binding activity; actinin binding activity; and protein kinase C binding activity. Involved in cell growth involved in cardiac muscle cell development; regulation of dendritic spine morphogenesis; and regulation of postsynapse assembly. Located in cytosol; membrane; and postsynaptic density. Is active in glutamatergic synapse and postsynapse. Orthologous to human PDLIM5 (PDZ and LIM domain 5); INTERACTS WITH 1,2-dimethylhydrazine; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Enh; Enh1; enigma homolog; enigma-like PDZ and LIM domains protein; PDZ and LIM domain protein 5
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PDLIM5 (PDZ and LIM domain 5) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Pdlim5 (PDZ and LIM domain 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pdlim5 (PDZ and LIM domain 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PDLIM5 (PDZ and LIM domain 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PDLIM5 (PDZ and LIM domain 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pdlim5 (PDZ and LIM domain 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PDLIM5 (PDZ and LIM domain 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PDLIM5 (PDZ and LIM domain 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pdlim5 (PDZ and LIM domain 5) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PDLIM5 (PDZ and LIM domain 5)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pdlim5 (PDZ and LIM domain 5)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pdlim5a (PDZ and LIM domain 5a)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
pdlim5b (PDZ and LIM domain 5b)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
alp-1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
Zasp52
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
pdlim5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 233,625,478 - 233,793,582 (-) NCBI GRCr8 mRatBN7.2 2 230,952,251 - 231,120,329 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 230,952,248 - 231,120,275 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 238,713,360 - 238,878,372 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 236,606,376 - 236,771,391 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 231,471,039 - 231,636,044 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 247,815,214 - 247,989,198 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 247,818,243 - 247,988,462 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 266,345,722 - 266,518,817 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 240,177,301 - 240,304,192 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 240,164,042 - 240,283,654 (-) NCBI Celera 2 223,009,335 - 223,173,420 (-) NCBI Celera Cytogenetic Map 2 q44 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pdlim5 Rat (+)-catechin multiple interactions ISO RGD:1344700 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in decreased expression of PDLIM5 mRNA CTD PMID:24763279 Pdlim5 Rat (-)-epigallocatechin 3-gallate decreases expression ISO RGD:1344700 6480464 epigallocatechin gallate results in decreased expression of PDLIM5 mRNA CTD PMID:16084531 Pdlim5 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO RGD:1344700 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PDLIM5 mRNA CTD PMID:22079256 Pdlim5 Rat 1,2-dichloroethane increases expression ISO RGD:1553828 6480464 ethylene dichloride results in increased expression of PDLIM5 mRNA CTD PMID:28960355 Pdlim5 Rat 1,2-dimethylhydrazine multiple interactions EXP 6480464 [APC protein affects the susceptibility to 1,2-Dimethylhydrazine] which results in increased expression of PDLIM5 mRNA CTD PMID:27840820 Pdlim5 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:1553828 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PDLIM5 mRNA CTD PMID:22206623 Pdlim5 Rat 1,2-dimethylhydrazine affects expression ISO RGD:1553828 6480464 1,2-Dimethylhydrazine affects the expression of PDLIM5 mRNA CTD PMID:22206623 Pdlim5 Rat 17beta-estradiol multiple interactions ISO RGD:1344700 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of PDLIM5 mRNA CTD PMID:19619570 Pdlim5 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of PDLIM5 mRNA CTD PMID:32145629 Pdlim5 Rat 17beta-estradiol increases expression ISO RGD:1344700 6480464 Estradiol results in increased expression of PDLIM5 mRNA CTD PMID:19619570 Pdlim5 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO RGD:1344700 6480464 Dihydrotestosterone results in increased expression of PDLIM5 mRNA CTD PMID:29581250 Pdlim5 Rat 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO RGD:1344700 6480464 2,2',4,4'-tetrabromodiphenyl ether results in decreased expression of PDLIM5 protein CTD PMID:31675489 Pdlim5 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:1344700 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of PDLIM5 mRNA CTD PMID:19619570 Pdlim5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of PDLIM5 mRNA CTD PMID:34747641 Pdlim5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:1553828 6480464 Tetrachlorodibenzodioxin affects the expression of PDLIM5 mRNA CTD PMID:21570461 Pdlim5 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PDLIM5 mRNA CTD PMID:22298810 Pdlim5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of PDLIM5 mRNA CTD PMID:21215274|PMID:32109520 Pdlim5 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:1553828 6480464 Tetrachlorodibenzodioxin results in decreased expression of PDLIM5 mRNA CTD PMID:19933214 Pdlim5 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO RGD:1344700 6480464 Tetrachlorodibenzodioxin results in increased expression of PDLIM5 mRNA CTD PMID:19619570 Pdlim5 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2,3,7,8-tetrachlorodibenzofuran results in decreased expression of PDLIM5 mRNA CTD PMID:32109520 Pdlim5 Rat 2,4,6-tribromophenol decreases expression ISO RGD:1344700 6480464 2,4,6-tribromophenol results in decreased expression of PDLIM5 mRNA CTD PMID:31675489 Pdlim5 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2,4-dinitrotoluene affects the expression of PDLIM5 mRNA CTD PMID:21346803 Pdlim5 Rat 2,6-dimethoxyphenol multiple interactions ISO RGD:1344700 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of and affects the more ... CTD PMID:38598786 Pdlim5 Rat 2-bromohexadecanoic acid multiple interactions ISO RGD:1344700 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Pdlim5 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:1344700 6480464 tetrabromobisphenol A results in decreased expression of PDLIM5 protein CTD PMID:31675489 Pdlim5 Rat 3-methylcholanthrene decreases expression ISO RGD:1553828 6480464 Methylcholanthrene results in decreased expression of PDLIM5 mRNA CTD PMID:20713471 Pdlim5 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:1553828 6480464 bisphenol S results in increased expression of PDLIM5 mRNA CTD PMID:30951980|PMID:39298647 Pdlim5 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2,6-dinitrotoluene affects the expression of PDLIM5 mRNA CTD PMID:21346803 Pdlim5 Rat 4-hydroxyphenyl retinamide increases expression ISO RGD:1553828 6480464 Fenretinide results in increased expression of PDLIM5 mRNA CTD PMID:28973697 Pdlim5 Rat 5-fluorouracil affects response to substance ISO RGD:1344700 6480464 PDLIM5 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Pdlim5 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of PDLIM5 mRNA CTD PMID:36843608 Pdlim5 Rat acrolein multiple interactions ISO RGD:1344700 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Pdlim5 Rat aflatoxin B1 decreases methylation ISO RGD:1344700 6480464 Aflatoxin B1 results in decreased methylation of PDLIM5 gene CTD PMID:27153756 Pdlim5 Rat all-trans-retinoic acid increases expression ISO RGD:1344700 6480464 Tretinoin results in increased expression of PDLIM5 mRNA CTD PMID:23724009|PMID:33167477 Pdlim5 Rat alpha-pinene multiple interactions ISO RGD:1344700 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Pdlim5 Rat aristolochic acid A decreases expression ISO RGD:1344700 6480464 aristolochic acid I results in decreased expression of PDLIM5 mRNA CTD PMID:33212167 Pdlim5 Rat arsane multiple interactions ISO RGD:1344700 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PDLIM5 more ... CTD PMID:39836092 Pdlim5 Rat arsenic atom multiple interactions ISO RGD:1344700 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PDLIM5 more ... CTD PMID:39836092 Pdlim5 Rat arsenous acid decreases expression ISO RGD:1344700 6480464 Arsenic Trioxide results in decreased expression of PDLIM5 mRNA CTD PMID:20458559 Pdlim5 Rat benzatropine decreases expression ISO RGD:1344700 6480464 Benztropine results in decreased expression of PDLIM5 protein CTD PMID:34122009 Pdlim5 Rat benzo[a]pyrene decreases expression ISO RGD:1344700 6480464 Benzo(a)pyrene results in decreased expression of PDLIM5 mRNA CTD PMID:20064835 Pdlim5 Rat benzo[a]pyrene affects methylation ISO RGD:1344700 6480464 Benzo(a)pyrene affects the methylation of PDLIM5 3' UTR CTD PMID:27901495 Pdlim5 Rat benzo[a]pyrene increases methylation ISO RGD:1344700 6480464 Benzo(a)pyrene results in increased methylation of PDLIM5 promoter CTD PMID:27901495 Pdlim5 Rat benzo[a]pyrene increases expression ISO RGD:1344700 6480464 Benzo(a)pyrene results in increased expression of PDLIM5 mRNA CTD PMID:21871943|PMID:26238291 Pdlim5 Rat benzo[a]pyrene decreases expression ISO RGD:1553828 6480464 Benzo(a)pyrene results in decreased expression of PDLIM5 mRNA CTD PMID:19770486|PMID:22228805 Pdlim5 Rat benzo[a]pyrene increases expression ISO RGD:1553828 6480464 Benzo(a)pyrene results in increased expression of PDLIM5 mRNA CTD PMID:21569818 Pdlim5 Rat benzo[a]pyrene diol epoxide I decreases expression ISO RGD:1344700 6480464 7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in decreased expression of PDLIM5 mRNA CTD PMID:19150397|PMID:20018196 Pdlim5 Rat beta-lapachone increases expression ISO RGD:1344700 6480464 beta-lapachone results in increased expression of PDLIM5 mRNA CTD PMID:38218311 Pdlim5 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of PDLIM5 mRNA CTD PMID:25181051 Pdlim5 Rat bisphenol A increases expression ISO RGD:1344700 6480464 bisphenol A results in increased expression of PDLIM5 protein CTD PMID:37567409 Pdlim5 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PDLIM5 mRNA CTD PMID:34947998 Pdlim5 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PDLIM5 mRNA CTD PMID:32145629 Pdlim5 Rat bisphenol A increases expression ISO RGD:1553828 6480464 bisphenol A results in increased expression of PDLIM5 mRNA CTD PMID:30951980 Pdlim5 Rat bisphenol A decreases expression ISO RGD:1344700 6480464 bisphenol A results in decreased expression of PDLIM5 mRNA CTD PMID:29275510 Pdlim5 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PDLIM5 gene CTD PMID:28505145 Pdlim5 Rat bisphenol AF increases expression ISO RGD:1344700 6480464 bisphenol AF results in increased expression of PDLIM5 protein CTD PMID:34186270 Pdlim5 Rat Bisphenol B increases expression ISO RGD:1344700 6480464 bisphenol B results in increased expression of PDLIM5 protein CTD PMID:34186270 Pdlim5 Rat bisphenol F increases expression ISO RGD:1553828 6480464 bisphenol F results in increased expression of PDLIM5 mRNA CTD PMID:30951980 Pdlim5 Rat bleomycin A2 increases expression EXP 6480464 Bleomycin results in increased expression of PDLIM5 protein CTD PMID:25933445 Pdlim5 Rat Brodifacoum decreases expression EXP 6480464 bromfenacoum results in decreased expression of PDLIM5 protein CTD PMID:28903499 Pdlim5 Rat butanal increases expression ISO RGD:1344700 6480464 butyraldehyde results in increased expression of PDLIM5 mRNA CTD PMID:26079696 Pdlim5 Rat cadmium atom multiple interactions ISO RGD:1344700 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Pdlim5 Rat cadmium dichloride multiple interactions ISO RGD:1344700 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ... CTD PMID:38195004 Pdlim5 Rat caffeine affects phosphorylation ISO RGD:1344700 6480464 Caffeine affects the phosphorylation of PDLIM5 protein CTD PMID:35688186 Pdlim5 Rat cantharidin decreases expression ISO RGD:1553828 6480464 Cantharidin results in decreased expression of PDLIM5 mRNA CTD PMID:36907384 Pdlim5 Rat carbon nanotube multiple interactions ISO RGD:1553828 6480464 [Dibutyl Phthalate co-treated with Nanotubes, Carbon] results in increased expression of PDLIM5 protein CTD PMID:34864091 Pdlim5 Rat CGP 52608 multiple interactions ISO RGD:1344700 6480464 CGP 52608 promotes the reaction [RORA protein binds to PDLIM5 gene] CTD PMID:28238834 Pdlim5 Rat chlorpyrifos decreases expression ISO RGD:1553828 6480464 Chlorpyrifos results in decreased expression of PDLIM5 mRNA CTD PMID:37019170 Pdlim5 Rat chromium(6+) decreases expression ISO RGD:1344700 6480464 chromium hexavalent ion results in decreased expression of PDLIM5 mRNA CTD PMID:30690063 Pdlim5 Rat cisplatin multiple interactions ISO RGD:1344700 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of PDLIM5 mRNA CTD PMID:27392435 Pdlim5 Rat clozapine decreases expression ISO RGD:1344700 6480464 Clozapine results in decreased expression of PDLIM5 protein CTD PMID:34122009 Pdlim5 Rat cobalt dichloride decreases expression ISO RGD:1344700 6480464 cobaltous chloride results in decreased expression of PDLIM5 mRNA CTD PMID:19320972|PMID:19376846 Pdlim5 Rat copper atom multiple interactions ISO RGD:1344700 6480464 [Disulfiram binds to Copper] which results in increased expression of PDLIM5 mRNA CTD PMID:24690739 Pdlim5 Rat copper(0) multiple interactions ISO RGD:1344700 6480464 [Disulfiram binds to Copper] which results in increased expression of PDLIM5 mRNA CTD PMID:24690739 Pdlim5 Rat copper(II) sulfate increases expression ISO RGD:1344700 6480464 Copper Sulfate results in increased expression of PDLIM5 mRNA CTD PMID:19549813 Pdlim5 Rat corticosterone increases expression EXP 6480464 Corticosterone results in increased expression of PDLIM5 mRNA CTD PMID:15755911 Pdlim5 Rat coumarin affects phosphorylation ISO RGD:1344700 6480464 coumarin affects the phosphorylation of PDLIM5 protein CTD PMID:35688186 Pdlim5 Rat cyclosporin A increases expression ISO RGD:1344700 6480464 Cyclosporine results in increased expression of PDLIM5 mRNA CTD PMID:25562108 Pdlim5 Rat decabromodiphenyl ether decreases expression ISO RGD:1344700 6480464 decabromobiphenyl ether results in decreased expression of PDLIM5 protein CTD PMID:31675489 Pdlim5 Rat diarsenic trioxide decreases expression ISO RGD:1344700 6480464 Arsenic Trioxide results in decreased expression of PDLIM5 mRNA CTD PMID:20458559 Pdlim5 Rat dibutyl phthalate increases expression ISO RGD:1553828 6480464 Dibutyl Phthalate results in increased expression of PDLIM5 mRNA CTD PMID:17361019|PMID:21266533 Pdlim5 Rat dibutyl phthalate multiple interactions ISO RGD:1553828 6480464 [Dibutyl Phthalate co-treated with Nanotubes, Carbon] results in increased expression of PDLIM5 protein CTD PMID:34864091 Pdlim5 Rat diethylstilbestrol increases expression ISO RGD:1344700 6480464 Diethylstilbestrol results in increased expression of PDLIM5 mRNA CTD PMID:36621641 Pdlim5 Rat disulfiram multiple interactions ISO RGD:1344700 6480464 [Disulfiram binds to Copper] which results in increased expression of PDLIM5 mRNA CTD PMID:24690739 Pdlim5 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PDLIM5 mRNA CTD PMID:25152437 Pdlim5 Rat dorsomorphin multiple interactions ISO RGD:1344700 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Pdlim5 Rat doxorubicin multiple interactions ISO RGD:1553828 6480464 [[MT1 protein co-treated with MT2 protein] affects the susceptibility to Doxorubicin] which affects the expression more ... CTD PMID:21040762 Pdlim5 Rat doxorubicin decreases expression ISO RGD:1344700 6480464 Doxorubicin results in decreased expression of PDLIM5 mRNA CTD PMID:29803840 Pdlim5 Rat enzyme inhibitor multiple interactions ISO RGD:1344700 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation more ... CTD PMID:23301498 Pdlim5 Rat ethanol increases expression ISO RGD:1553828 6480464 Ethanol results in increased expression of PDLIM5 mRNA CTD PMID:30319688 Pdlim5 Rat fenamidone increases expression ISO RGD:1553828 6480464 fenamidone results in increased expression of PDLIM5 mRNA CTD PMID:27029645 Pdlim5 Rat flavonoids increases expression EXP 6480464 Flavonoids results in increased expression of PDLIM5 mRNA CTD PMID:18035473 Pdlim5 Rat folic acid multiple interactions ISO RGD:1553828 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PDLIM5 mRNA CTD PMID:22206623 Pdlim5 Rat folic acid decreases expression ISO RGD:1344700 6480464 Folic Acid results in decreased expression of PDLIM5 mRNA CTD PMID:21867686 Pdlim5 Rat FR900359 affects phosphorylation ISO RGD:1344700 6480464 FR900359 affects the phosphorylation of PDLIM5 protein CTD PMID:37730182 Pdlim5 Rat gallic acid decreases expression ISO RGD:1344700 6480464 Gallic Acid results in decreased expression of PDLIM5 mRNA CTD PMID:34408198 Pdlim5 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of PDLIM5 mRNA CTD PMID:33387578 Pdlim5 Rat haloperidol decreases expression ISO RGD:1344700 6480464 Haloperidol results in decreased expression of PDLIM5 protein CTD PMID:34122009 Pdlim5 Rat hydrogen cyanide increases expression ISO RGD:1553828 6480464 Hydrogen Cyanide results in increased expression of PDLIM5 mRNA CTD PMID:33914522 Pdlim5 Rat hydrogen peroxide increases expression ISO RGD:1344700 6480464 Hydrogen Peroxide results in increased expression of PDLIM5 mRNA CTD PMID:18951874 Pdlim5 Rat irinotecan decreases expression ISO RGD:1344700 6480464 Irinotecan analog results in decreased expression of PDLIM5 mRNA CTD PMID:18927307 Pdlim5 Rat ivermectin decreases expression ISO RGD:1344700 6480464 Ivermectin results in decreased expression of PDLIM5 protein CTD PMID:32959892 Pdlim5 Rat ketoconazole increases expression ISO RGD:1344700 6480464 Ketoconazole results in increased expression of PDLIM5 mRNA CTD PMID:36621641 Pdlim5 Rat lead(0) affects expression ISO RGD:1344700 6480464 Lead affects the expression of PDLIM5 mRNA CTD PMID:28903495 Pdlim5 Rat leflunomide increases expression ISO RGD:1344700 6480464 leflunomide results in increased expression of PDLIM5 mRNA CTD PMID:28988120 Pdlim5 Rat lithium chloride increases expression ISO RGD:1344700 6480464 Lithium Chloride results in increased expression of PDLIM5 mRNA CTD PMID:15711924 Pdlim5 Rat melphalan decreases expression ISO RGD:1344700 6480464 Melphalan results in decreased expression of PDLIM5 mRNA CTD PMID:22363485 Pdlim5 Rat methylmercury chloride decreases expression ISO RGD:1344700 6480464 methylmercuric chloride results in decreased expression of PDLIM5 mRNA CTD PMID:28001369 Pdlim5 Rat N-acetyl-L-cysteine decreases expression ISO RGD:1344700 6480464 Acetylcysteine results in decreased expression of PDLIM5 mRNA CTD PMID:16084531 Pdlim5 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO RGD:1553828 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of PDLIM5 mRNA CTD PMID:25566086 Pdlim5 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO RGD:1553828 6480464 MYBPC3 protein affects the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of PDLIM5 mRNA] CTD PMID:25566086 Pdlim5 Rat nickel atom increases expression ISO RGD:1344700 6480464 Nickel results in increased expression of PDLIM5 mRNA CTD PMID:24768652 Pdlim5 Rat nickel subsulfide increases expression EXP 6480464 nickel subsulfide results in increased expression of PDLIM5 mRNA CTD PMID:21086188 Pdlim5 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of PDLIM5 mRNA CTD PMID:33484710 Pdlim5 Rat NS-398 increases expression ISO RGD:1344700 6480464 N-(2-cyclohexyloxy-4-nitrophenyl)methanesulfonamide results in increased expression of PDLIM5 mRNA CTD PMID:11494140 Pdlim5 Rat ozone multiple interactions ISO RGD:1344700 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of more ... CTD PMID:32699268 Pdlim5 Rat paracetamol affects expression ISO RGD:1553828 6480464 Acetaminophen affects the expression of PDLIM5 mRNA CTD PMID:17562736 Pdlim5 Rat paracetamol affects expression ISO RGD:1344700 6480464 Acetaminophen affects the expression of PDLIM5 mRNA CTD PMID:25458485 Pdlim5 Rat paracetamol decreases expression ISO RGD:1344700 6480464 Acetaminophen results in decreased expression of PDLIM5 mRNA CTD PMID:21420995 Pdlim5 Rat paraquat increases expression ISO RGD:1344700 6480464 Paraquat results in increased expression of PDLIM5 protein CTD PMID:34064677 Pdlim5 Rat pirinixic acid decreases expression ISO RGD:1553828 6480464 pirinixic acid results in decreased expression of PDLIM5 mRNA CTD PMID:18445702 Pdlim5 Rat pirinixic acid increases expression ISO RGD:1553828 6480464 pirinixic acid results in increased expression of PDLIM5 mRNA CTD PMID:18301758 Pdlim5 Rat potassium chromate multiple interactions ISO RGD:1344700 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of PDLIM5 mRNA CTD PMID:22079256 Pdlim5 Rat potassium chromate decreases expression ISO RGD:1344700 6480464 potassium chromate(VI) results in decreased expression of PDLIM5 mRNA CTD PMID:22079256|PMID:22714537 Pdlim5 Rat potassium cyanide increases expression ISO RGD:1553828 6480464 Potassium Cyanide results in increased expression of PDLIM5 mRNA CTD PMID:33914522 Pdlim5 Rat propanal increases expression ISO RGD:1344700 6480464 propionaldehyde results in increased expression of PDLIM5 mRNA CTD PMID:26079696 Pdlim5 Rat SB 431542 multiple interactions ISO RGD:1344700 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Pdlim5 Rat silicon dioxide decreases expression ISO RGD:1344700 6480464 Silicon Dioxide analog results in decreased expression of PDLIM5 mRNA CTD PMID:25895662 Pdlim5 Rat sodium arsenite affects methylation ISO RGD:1344700 6480464 sodium arsenite affects the methylation of PDLIM5 gene CTD PMID:28589171 Pdlim5 Rat sodium arsenite multiple interactions ISO RGD:1344700 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of PDLIM5 more ... CTD PMID:39836092 Pdlim5 Rat sodium arsenite decreases expression ISO RGD:1344700 6480464 sodium arsenite results in decreased expression of PDLIM5 mRNA CTD PMID:34032870 Pdlim5 Rat sodium arsenite increases expression ISO RGD:1344700 6480464 sodium arsenite results in increased expression of PDLIM5 mRNA CTD PMID:38568856 Pdlim5 Rat sodium chloride multiple interactions ISO RGD:1344700 6480464 [Sodium Chloride co-treated with pyrogallol 1,3-dimethyl ether] results in decreased expression of and affects the more ... CTD PMID:38598786 Pdlim5 Rat succimer multiple interactions ISO RGD:1553828 6480464 [Succimer co-treated with Magnetite Nanoparticles] results in increased expression of PDLIM5 mRNA CTD PMID:26378955 Pdlim5 Rat testosterone decreases expression ISO RGD:1553828 6480464 Testosterone results in decreased expression of PDLIM5 mRNA CTD PMID:21669218 Pdlim5 Rat tetrachloromethane affects expression ISO RGD:1553828 6480464 Carbon Tetrachloride affects the expression of PDLIM5 mRNA CTD PMID:17484886 Pdlim5 Rat tetraphene decreases expression ISO RGD:1553828 6480464 benz(a)anthracene results in decreased expression of PDLIM5 mRNA CTD PMID:26377693 Pdlim5 Rat thiram increases expression ISO RGD:1344700 6480464 Thiram results in increased expression of PDLIM5 mRNA CTD PMID:38568856 Pdlim5 Rat titanium dioxide affects expression ISO RGD:1553828 6480464 titanium dioxide affects the expression of PDLIM5 mRNA CTD PMID:35295148 Pdlim5 Rat titanium dioxide decreases methylation ISO RGD:1553828 6480464 titanium dioxide results in decreased methylation of PDLIM5 promoter CTD PMID:35295148 Pdlim5 Rat torcetrapib increases expression ISO RGD:1344700 6480464 torcetrapib results in increased expression of PDLIM5 mRNA CTD PMID:23228038 Pdlim5 Rat trichostatin A decreases expression ISO RGD:1344700 6480464 trichostatin A results in decreased expression of PDLIM5 mRNA CTD PMID:24935251|PMID:26272509 Pdlim5 Rat trichostatin A multiple interactions ISO RGD:1344700 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Pdlim5 Rat triclosan decreases expression ISO RGD:1344700 6480464 Triclosan results in decreased expression of PDLIM5 mRNA CTD PMID:30510588 Pdlim5 Rat troglitazone decreases expression ISO RGD:1553828 6480464 troglitazone results in decreased expression of PDLIM5 mRNA CTD PMID:28973697 Pdlim5 Rat urethane increases expression ISO RGD:1344700 6480464 Urethane results in increased expression of PDLIM5 mRNA CTD PMID:28818685 Pdlim5 Rat valproic acid affects expression ISO RGD:1344700 6480464 Valproic Acid affects the expression of PDLIM5 mRNA CTD PMID:25979313 Pdlim5 Rat valproic acid increases expression ISO RGD:1344700 6480464 Valproic Acid results in increased expression of PDLIM5 mRNA CTD PMID:23179753|PMID:27188386 Pdlim5 Rat valproic acid multiple interactions ISO RGD:1344700 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ... CTD PMID:27188386 Pdlim5 Rat valproic acid decreases expression ISO RGD:1344700 6480464 Valproic Acid results in decreased expression of PDLIM5 mRNA CTD PMID:23179753|PMID:26272509 Pdlim5 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of PDLIM5 mRNA CTD PMID:23034163
(+)-catechin (ISO) (-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2,6-dimethoxyphenol (ISO) 2-bromohexadecanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acrolein (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) benzatropine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bleomycin A2 (EXP) Brodifacoum (EXP) butanal (ISO) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) cantharidin (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) chromium(6+) (ISO) cisplatin (ISO) clozapine (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) corticosterone (EXP) coumarin (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) diarsenic trioxide (ISO) dibutyl phthalate (ISO) diethylstilbestrol (ISO) disulfiram (ISO) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) enzyme inhibitor (ISO) ethanol (ISO) fenamidone (ISO) flavonoids (EXP) folic acid (ISO) FR900359 (ISO) gallic acid (ISO) gentamycin (EXP) haloperidol (ISO) hydrogen cyanide (ISO) hydrogen peroxide (ISO) irinotecan (ISO) ivermectin (ISO) ketoconazole (ISO) lead(0) (ISO) leflunomide (ISO) lithium chloride (ISO) melphalan (ISO) methylmercury chloride (ISO) N-acetyl-L-cysteine (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nickel atom (ISO) nickel subsulfide (EXP) nitrofen (EXP) NS-398 (ISO) ozone (ISO) paracetamol (ISO) paraquat (ISO) pirinixic acid (ISO) potassium chromate (ISO) potassium cyanide (ISO) propanal (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium chloride (ISO) succimer (ISO) testosterone (ISO) tetrachloromethane (ISO) tetraphene (ISO) thiram (ISO) titanium dioxide (ISO) torcetrapib (ISO) trichostatin A (ISO) triclosan (ISO) troglitazone (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
1.
Cardiac fibroblast-derived microRNA passenger strand-enriched exosomes mediate cardiomyocyte hypertrophy.
Bang C, etal., J Clin Invest. 2014 May;124(5):2136-46. doi: 10.1172/JCI70577. Epub 2014 Apr 17.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Postsynaptic PDLIM5/Enigma Homolog binds SPAR and causes dendritic spine shrinkage.
Herrick S, etal., Mol Cell Neurosci. 2010 Feb;43(2):188-200. doi: 10.1016/j.mcn.2009.10.009. Epub 2009 Nov 10.
4.
Protein-protein interaction of zinc finger LIM domains with protein kinase C.
Kuroda S, etal., J Biol Chem 1996 Dec 6;271(49):31029-32.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
ENH, containing PDZ and LIM domains, heart/skeletal muscle-specific protein, associates with cytoskeletal proteins through the PDZ domain.
Nakagawa N, etal., Biochem Biophys Res Commun. 2000 Jun 7;272(2):505-12.
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
GOA pipeline
RGD automated data pipeline
9.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Pdlim5 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 233,625,478 - 233,793,582 (-) NCBI GRCr8 mRatBN7.2 2 230,952,251 - 231,120,329 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 230,952,248 - 231,120,275 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 238,713,360 - 238,878,372 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 236,606,376 - 236,771,391 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 231,471,039 - 231,636,044 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 247,815,214 - 247,989,198 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 247,818,243 - 247,988,462 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 266,345,722 - 266,518,817 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 240,177,301 - 240,304,192 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 240,164,042 - 240,283,654 (-) NCBI Celera 2 223,009,335 - 223,173,420 (-) NCBI Celera Cytogenetic Map 2 q44 NCBI
PDLIM5 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 94,451,942 - 94,668,223 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 94,451,857 - 94,668,227 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 95,373,093 - 95,589,374 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 95,592,061 - 95,808,400 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 4 95,730,215 - 95,946,554 NCBI Celera 4 92,670,285 - 92,886,273 (+) NCBI Celera Cytogenetic Map 4 q22.3 NCBI HuRef 4 91,110,743 - 91,326,816 (+) NCBI HuRef CHM1_1 4 95,350,391 - 95,566,419 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 97,767,448 - 97,983,384 (+) NCBI T2T-CHM13v2.0
Pdlim5 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 141,945,346 - 142,101,480 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 141,945,351 - 142,101,454 (-) Ensembl GRCm39 Ensembl GRCm38 3 142,239,585 - 142,395,719 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 142,239,590 - 142,395,696 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 141,903,568 - 142,058,630 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 142,180,044 - 142,333,004 (-) NCBI MGSCv36 mm8 Celera 3 148,660,401 - 148,819,753 (-) NCBI Celera Cytogenetic Map 3 H1 NCBI cM Map 3 66.69 NCBI
Pdlim5 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 5,109,778 - 5,315,092 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 5,109,778 - 5,312,192 (+) NCBI ChiLan1.0 ChiLan1.0
PDLIM5 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 92,478,961 - 92,695,404 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 92,758,171 - 92,974,628 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 86,814,136 - 87,030,605 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 97,486,566 - 97,702,060 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 97,486,566 - 97,702,060 (+) Ensembl panpan1.1 panPan2
PDLIM5 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 32 17,294,023 - 17,505,212 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 32 17,294,073 - 17,502,409 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 32 24,444,240 - 24,655,897 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 32 17,472,836 - 17,683,974 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 32 17,472,845 - 17,683,970 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 32 17,445,268 - 17,656,838 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 32 17,266,060 - 17,477,973 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 32 22,414,982 - 22,632,647 (-) NCBI UU_Cfam_GSD_1.0
Pdlim5 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405301 24,194,484 - 24,421,688 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936687 1,944,095 - 2,152,529 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936687 1,944,095 - 2,152,501 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PDLIM5 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 125,044,028 - 125,259,945 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 125,044,027 - 125,259,969 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 134,331,215 - 134,558,541 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PDLIM5 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 7 42,702,175 - 42,912,859 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 7 42,819,454 - 42,908,137 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 21,065,966 - 21,276,910 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pdlim5
.
Predicted Target Of
Count of predictions: 11 Count of miRNA genes: 11 Interacting mature miRNAs: 11 Transcripts: ENSRNOT00000022387 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
631563 Hcuc3 Hepatic copper content QTL 3 3.87 liver copper amount (VT:0003065) liver copper weight to liver dry weight ratio (CMO:0001512) 2 229059610 249053267 Rat 1331767 Hrtrt12 Heart rate QTL 12 3.373 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 2 218414747 240841241 Rat 1598813 Memor9 Memory QTL 9 2.7 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 2 199341726 234244620 Rat 8693697 Alc36 Alcohol consumption QTL 36 2 0.592 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 2 217139753 236660713 Rat 1298075 Scl17 Serum cholesterol level QTL 17 3.4 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 2 211744537 249053267 Rat 2293833 Kiddil8 Kidney dilation QTL 8 2.9 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 219753301 247136170 Rat 1598835 Anxrr18 Anxiety related response QTL 18 2.98 body movement coordination trait (VT:0005424) number of rearing movements in an experimental apparatus (CMO:0001752) 2 200990457 245990457 Rat 2298479 Eau5 Experimental allergic uveoretinitis QTL 5 0.0021 uvea integrity trait (VT:0010551) experimental autoimmune uveitis score (CMO:0001504) 2 202446871 237938339 Rat 1300126 Bp175 Blood pressure QTL 175 3.46 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 214226044 247136170 Rat 7207490 Bss111 Bone structure and strength QTL 111 6.4 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 2 211744537 249053267 Rat 7207484 Bss108 Bone structure and strength QTL 108 5.3 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 2 211744537 249053267 Rat 2313073 Bmd75 Bone mineral density QTL 75 4.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 2 215377404 237938339 Rat 8693622 Alc26 Alcohol consumption QTL 26 2.4 0.667 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 2 221136523 241305619 Rat 7411555 Bw132 Body weight QTL 132 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 2 223389739 249053267 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 189599258 234599258 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189599258 234599258 Rat 9587428 Epfw6 Epididymal fat weight QTL 6 7.47 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 2 223389739 249053267 Rat 7207482 Bss107 Bone structure and strength QTL 107 7 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 2 211744537 249053267 Rat 2293844 Kiddil7 Kidney dilation QTL 7 3.5 kidney pelvis morphology trait (VT:0004194) hydronephrosis severity score (CMO:0001208) 2 219753301 247136170 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 2317752 Glom23 Glomerulus QTL 23 3.6 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 2 193452645 245889826 Rat 1549836 Bss2 Bone structure and strength QTL 2 7.5 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 2 211744537 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 2317885 Alcrsp28 Alcohol response QTL 28 2.1 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 212828222 249053267 Rat
D2Rat295
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 230,963,738 - 230,963,986 (+) MAPPER mRatBN7.2 Rnor_6.0 2 247,826,701 - 247,826,948 NCBI Rnor6.0 Rnor_5.0 2 266,357,209 - 266,357,456 UniSTS Rnor5.0 RGSC_v3.4 2 240,185,760 - 240,186,008 RGD RGSC3.4 RGSC_v3.4 2 240,185,761 - 240,186,008 UniSTS RGSC3.4 RGSC_v3.1 2 240,172,500 - 240,172,748 RGD Celera 2 223,017,795 - 223,018,042 UniSTS SHRSP x BN Map 2 98.7698 RGD SHRSP x BN Map 2 98.7698 UniSTS Cytogenetic Map 2 q44 UniSTS
RH129037
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 231,019,248 - 231,019,438 (+) MAPPER mRatBN7.2 Rnor_6.0 2 247,881,581 - 247,881,770 NCBI Rnor6.0 Rnor_5.0 2 266,412,603 - 266,412,792 UniSTS Rnor5.0 RGSC_v3.4 2 240,242,672 - 240,242,861 UniSTS RGSC3.4 Celera 2 223,073,187 - 223,073,376 UniSTS Cytogenetic Map 2 q44 UniSTS
RH132279
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 230,965,526 - 230,965,723 (+) MAPPER mRatBN7.2 Rnor_6.0 2 247,828,489 - 247,828,685 NCBI Rnor6.0 Rnor_5.0 2 266,358,997 - 266,359,193 UniSTS Rnor5.0 RGSC_v3.4 2 240,187,549 - 240,187,745 UniSTS RGSC3.4 Celera 2 223,019,583 - 223,019,779 UniSTS RH 3.4 Map 2 1580.5 UniSTS Cytogenetic Map 2 q44 UniSTS
RH144581
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 230,965,009 - 230,965,164 (+) MAPPER mRatBN7.2 Rnor_6.0 2 247,827,972 - 247,828,126 NCBI Rnor6.0 Rnor_5.0 2 266,358,480 - 266,358,634 UniSTS Rnor5.0 RGSC_v3.4 2 240,187,032 - 240,187,186 UniSTS RGSC3.4 Celera 2 223,019,066 - 223,019,220 UniSTS RH 3.4 Map 2 1580.8 UniSTS Cytogenetic Map 2 q44 UniSTS
RH137910
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 231,074,716 - 231,074,966 (+) MAPPER mRatBN7.2 Rnor_6.0 2 247,936,978 - 247,937,227 NCBI Rnor6.0 Rnor_5.0 2 266,468,001 - 266,468,250 UniSTS Rnor5.0 RGSC_v3.4 2 240,300,525 - 240,300,774 UniSTS RGSC3.4 Celera 2 223,128,724 - 223,128,973 UniSTS RH 3.4 Map 2 1537.0 UniSTS Cytogenetic Map 2 q44 UniSTS
AI014024
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 2 1590.0 UniSTS Cytogenetic Map 2 q44 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022387 ⟹ ENSRNOP00000022387
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 230,952,248 - 231,120,266 (-) Ensembl Rnor_6.0 Ensembl 2 247,818,243 - 247,988,462 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000095015 ⟹ ENSRNOP00000082394
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 230,952,248 - 231,120,266 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000097256 ⟹ ENSRNOP00000091194
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 230,952,248 - 231,120,266 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106810 ⟹ ENSRNOP00000094742
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 231,019,714 - 231,120,275 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000109323 ⟹ ENSRNOP00000091918
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 231,019,267 - 231,120,244 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000114385 ⟹ ENSRNOP00000093276
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 230,952,248 - 231,120,266 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115118 ⟹ ENSRNOP00000097787
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 230,952,248 - 231,120,266 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115772 ⟹ ENSRNOP00000091892
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 231,019,714 - 231,120,275 (-) Ensembl
RefSeq Acc Id:
NM_053326 ⟹ NP_445778
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,628,501 - 233,793,476 (-) NCBI mRatBN7.2 2 230,955,276 - 231,120,223 (-) NCBI Rnor_6.0 2 247,818,241 - 247,988,462 (-) NCBI Rnor_5.0 2 266,345,722 - 266,518,817 (-) NCBI RGSC_v3.4 2 240,177,301 - 240,304,192 (-) RGD Celera 2 223,009,335 - 223,173,420 (-) RGD
Sequence:
CTGAGGCGGAGGGTGCGCCGCGCGGGTCCGGAGAACTGCACATCGAATCCTTCGAACCATGAGCAACTACAATGTGTCATTGGTTGGCCCAGCTCCTTGGGGTTTCCGGCTCCAAGGTGGCAAGGATT
hide sequence
RefSeq Acc Id:
XM_006233412 ⟹ XP_006233474
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI mRatBN7.2 2 230,952,251 - 231,120,329 (-) NCBI Rnor_6.0 2 247,815,214 - 247,989,184 (-) NCBI Rnor_5.0 2 266,345,722 - 266,518,817 (-) NCBI
Sequence:
ACTAAACTTTACCAAAGTTTGCTTGTGAATAAAAATTCTTTGGGCAAAATCAAACAACTTTACAGAAGTAGGTAAACGTGCTGTTGATTTGGAATTAGAAAAGTAAGCCGAGGATCGGTGGCTGAATC
hide sequence
RefSeq Acc Id:
XM_006233416 ⟹ XP_006233478
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI mRatBN7.2 2 230,952,251 - 231,120,329 (-) NCBI Rnor_6.0 2 247,815,214 - 247,989,176 (-) NCBI Rnor_5.0 2 266,345,722 - 266,518,817 (-) NCBI
Sequence:
TTACCAAAGTTTGCTTGTGAATAAAAATTCTTTGGGCAAAATCAAACAACTTTACAGAAGTAGGTAAACGTGCTGTTGATTTGGAATTAGAAAAGTAAGCCGAGGATCGGTGGCTGAATCACTTTGCC
hide sequence
RefSeq Acc Id:
XM_006233418 ⟹ XP_006233480
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI mRatBN7.2 2 230,952,251 - 231,120,329 (-) NCBI Rnor_6.0 2 247,815,214 - 247,988,960 (-) NCBI Rnor_5.0 2 266,345,722 - 266,518,817 (-) NCBI
Sequence:
ACTTCAGAGTTTGCACTTCTCGAGAGTATACAGAGGTCTTTCACAAAAGCAGGCGGTAGTCGCT
hide sequence
RefSeq Acc Id:
XM_006233419 ⟹ XP_006233481
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI mRatBN7.2 2 230,952,251 - 231,120,329 (-) NCBI Rnor_6.0 2 247,815,214 - 247,988,946 (-) NCBI Rnor_5.0 2 266,345,722 - 266,518,817 (-) NCBI
Sequence:
ACTTCTCGAGAGTATACAGAGGTCTTTCACAAAAGCAGGCGGTAGTCGCTGAACTCGCTCCGAC
hide sequence
RefSeq Acc Id:
XM_006233420 ⟹ XP_006233482
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,692,487 - 233,793,582 (-) NCBI mRatBN7.2 2 231,019,247 - 231,120,329 (-) NCBI Rnor_6.0 2 247,881,579 - 247,988,836 (-) NCBI Rnor_5.0 2 266,345,722 - 266,518,817 (-) NCBI
Sequence:
CTGCGGGTCAATTCAAGTTTCTGCGGGAGTGAAAAGCGCCTAAATACAAAACAGAGAAGCGGAAGGCTAGATCTTTGCCGGGTACCACTCCAAGACTACACCCCGGAGACTACGCCCACCGAAACTCC
hide sequence
RefSeq Acc Id:
XM_006233421 ⟹ XP_006233483
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,692,487 - 233,793,582 (-) NCBI mRatBN7.2 2 231,019,247 - 231,120,329 (-) NCBI Rnor_6.0 2 247,881,579 - 247,988,836 (-) NCBI Rnor_5.0 2 266,345,722 - 266,518,817 (-) NCBI
Sequence:
CTGCGGGTCAATTCAAGTTTCTGCGGGAGTGAAAAGCGCCTAAATACAAAACAGAGAAGCGGAA
hide sequence
RefSeq Acc Id:
XM_006233422 ⟹ XP_006233484
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,692,487 - 233,793,582 (-) NCBI mRatBN7.2 2 231,019,247 - 231,120,329 (-) NCBI Rnor_6.0 2 247,881,579 - 247,988,836 (-) NCBI Rnor_5.0 2 266,345,722 - 266,518,817 (-) NCBI
Sequence:
CTGCGGGTCAATTCAAGTTTCTGCGGGAGTGAAAAGCGCCTAAATACAAAACAGAGAAGCGGAA
hide sequence
RefSeq Acc Id:
XM_006233423 ⟹ XP_006233485
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,692,487 - 233,793,582 (-) NCBI mRatBN7.2 2 231,019,247 - 231,120,329 (-) NCBI Rnor_6.0 2 247,881,579 - 247,988,836 (-) NCBI Rnor_5.0 2 266,345,722 - 266,518,817 (-) NCBI
Sequence:
CTGCGGGTCAATTCAAGTTTCTGCGGGAGTGAAAAGCGCCTAAATACAAAACAGAGAAGCGGAA
hide sequence
RefSeq Acc Id:
XM_039103049 ⟹ XP_038958977
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI mRatBN7.2 2 230,952,251 - 231,120,329 (-) NCBI
RefSeq Acc Id:
XM_039103050 ⟹ XP_038958978
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI mRatBN7.2 2 230,952,251 - 231,120,329 (-) NCBI
RefSeq Acc Id:
XM_039103051 ⟹ XP_038958979
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI mRatBN7.2 2 230,952,251 - 231,120,329 (-) NCBI
RefSeq Acc Id:
XM_039103052 ⟹ XP_038958980
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI mRatBN7.2 2 230,952,251 - 231,120,329 (-) NCBI
RefSeq Acc Id:
XM_039103053 ⟹ XP_038958981
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI mRatBN7.2 2 230,952,251 - 231,120,329 (-) NCBI
RefSeq Acc Id:
XM_039103054 ⟹ XP_038958982
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI mRatBN7.2 2 230,952,251 - 231,120,329 (-) NCBI
RefSeq Acc Id:
XM_039103055 ⟹ XP_038958983
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI mRatBN7.2 2 230,952,251 - 231,120,329 (-) NCBI
RefSeq Acc Id:
XM_039103056 ⟹ XP_038958984
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI mRatBN7.2 2 230,952,251 - 231,120,329 (-) NCBI
RefSeq Acc Id:
XM_039103057 ⟹ XP_038958985
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,692,487 - 233,793,582 (-) NCBI mRatBN7.2 2 231,019,247 - 231,120,329 (-) NCBI
RefSeq Acc Id:
XM_063282473 ⟹ XP_063138543
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI
RefSeq Acc Id:
XM_063282474 ⟹ XP_063138544
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI
RefSeq Acc Id:
XM_063282475 ⟹ XP_063138545
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI
RefSeq Acc Id:
XM_063282477 ⟹ XP_063138547
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI
RefSeq Acc Id:
XM_063282478 ⟹ XP_063138548
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI
RefSeq Acc Id:
XM_063282480 ⟹ XP_063138550
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 233,625,478 - 233,793,582 (-) NCBI
RefSeq Acc Id:
NP_445778 ⟸ NM_053326
- UniProtKB:
Q62920 (UniProtKB/Swiss-Prot), A6HW58 (UniProtKB/TrEMBL), A0A8I6ARU2 (UniProtKB/TrEMBL)
- Sequence:
MSNYNVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVAVQKGEPKEVVKPVPITSPAVSKVTSTTNMAYNKV
hide sequence
RefSeq Acc Id:
XP_006233481 ⟸ XM_006233419
- Peptide Label:
isoform X16
- UniProtKB:
A6HW57 (UniProtKB/TrEMBL), A0A8I6GKL2 (UniProtKB/TrEMBL)
- Sequence:
MSNYNVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVAVQKPTVTSVCSESAQELAEGQRRGSQGDIKQQNG
hide sequence
RefSeq Acc Id:
XP_006233480 ⟸ XM_006233418
- Peptide Label:
isoform X15
- UniProtKB:
A0A8I6GKL2 (UniProtKB/TrEMBL)
- Sequence:
MSNYNVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVAVQKPTVTSVCSESAQELAEGQRRGSQGDIKQQNG
hide sequence
RefSeq Acc Id:
XP_006233478 ⟸ XM_006233416
- Peptide Label:
isoform X4
- UniProtKB:
A0A8L2QCL7 (UniProtKB/TrEMBL)
- Sequence:
MSNYNVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVAVQKGEPKEVVKPVPITSPAVSKVTSTTNMAYNKV
hide sequence
RefSeq Acc Id:
XP_006233474 ⟸ XM_006233412
- Peptide Label:
isoform X1
- Sequence:
MSNYNVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVAVQKGEPKEVVKPVPITSPAVSKVTSTTNMAYNKV
hide sequence
RefSeq Acc Id:
XP_006233485 ⟸ XM_006233423
- Peptide Label:
isoform X22
- Sequence:
MSNYNVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVAVQKKAHVTNNPGTVKIPPKRPPRKHIVERNTEFY
hide sequence
RefSeq Acc Id:
XP_006233484 ⟸ XM_006233422
- Peptide Label:
isoform X21
- UniProtKB:
A0A8I6GJY3 (UniProtKB/TrEMBL)
- Sequence:
MSNYNVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVAVQKPTVTSVCSESAQELAEGQRRGSQGDIKQQNG
hide sequence
RefSeq Acc Id:
XP_006233483 ⟸ XM_006233421
- Peptide Label:
isoform X20
- UniProtKB:
A0A8I6B1G1 (UniProtKB/TrEMBL)
- Sequence:
MSNYNVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVAVQKPTVTSVCSESAQELAEGQRRGSQGDIKQQNG
hide sequence
RefSeq Acc Id:
XP_006233482 ⟸ XM_006233420
- Peptide Label:
isoform X19
- UniProtKB:
A0A8I6GJC1 (UniProtKB/TrEMBL), A6HW60 (UniProtKB/TrEMBL)
- Sequence:
MSNYNVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQAHVRIGDVVLSIDGISAQGMTHLEAQNKIKACTGSLNMTLQRASAAAKSEPVAVQKGEPKEVVKPVPITSPAVSKVTSTTNMAYNKV
hide sequence
Ensembl Acc Id:
ENSRNOP00000022387 ⟸ ENSRNOT00000022387
RefSeq Acc Id:
XP_038958984 ⟸ XM_039103056
- Peptide Label:
isoform X14
- UniProtKB:
A0A8I6GKL2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038958983 ⟸ XM_039103055
- Peptide Label:
isoform X12
- UniProtKB:
A0A8I6GKL2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038958982 ⟸ XM_039103054
- Peptide Label:
isoform X11
- UniProtKB:
A0A8I6GKL2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038958981 ⟸ XM_039103053
- Peptide Label:
isoform X10
- UniProtKB:
A0A8I6GKL2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038958980 ⟸ XM_039103052
- Peptide Label:
isoform X9
- UniProtKB:
A0A8I6ARU2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038958978 ⟸ XM_039103050
- Peptide Label:
isoform X3
RefSeq Acc Id:
XP_038958977 ⟸ XM_039103049
- Peptide Label:
isoform X2
RefSeq Acc Id:
XP_038958979 ⟸ XM_039103051
- Peptide Label:
isoform X6
- UniProtKB:
A0A8I6ARU2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038958985 ⟸ XM_039103057
- Peptide Label:
isoform X18
- UniProtKB:
A6HW60 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000093276 ⟸ ENSRNOT00000114385
Ensembl Acc Id:
ENSRNOP00000097787 ⟸ ENSRNOT00000115118
Ensembl Acc Id:
ENSRNOP00000091194 ⟸ ENSRNOT00000097256
Ensembl Acc Id:
ENSRNOP00000091892 ⟸ ENSRNOT00000115772
Ensembl Acc Id:
ENSRNOP00000082394 ⟸ ENSRNOT00000095015
Ensembl Acc Id:
ENSRNOP00000094742 ⟸ ENSRNOT00000106810
Ensembl Acc Id:
ENSRNOP00000091918 ⟸ ENSRNOT00000109323
RefSeq Acc Id:
XP_063138548 ⟸ XM_063282478
- Peptide Label:
isoform X17
- UniProtKB:
A0A8I6GKL2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063138547 ⟸ XM_063282477
- Peptide Label:
isoform X13
- UniProtKB:
A0A8I6GKL2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063138550 ⟸ XM_063282480
- Peptide Label:
isoform X23
- UniProtKB:
A0A8I6ADM7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063138543 ⟸ XM_063282473
- Peptide Label:
isoform X5
RefSeq Acc Id:
XP_063138545 ⟸ XM_063282475
- Peptide Label:
isoform X8
- UniProtKB:
A0A8I6ARU2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063138544 ⟸ XM_063282474
- Peptide Label:
isoform X7
- UniProtKB:
A0A8I6ARU2 (UniProtKB/TrEMBL)
RGD ID: 13691793 Promoter ID: EPDNEW_R2317 Type: initiation region Name: Pdlim5_1 Description: PDZ and LIM domain 5 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 247,988,478 - 247,988,538 EPDNEW
BioCyc Gene G2FUF-51001 BioCyc
Ensembl Genes ENSRNOG00000016419 Ensembl, ENTREZGENE
Ensembl Transcript ENSRNOT00000022387 ENTREZGENE
ENSRNOT00000106810 ENTREZGENE
ENSRNOT00000109323 ENTREZGENE
ENSRNOT00000114385 ENTREZGENE
ENSRNOT00000115118 ENTREZGENE
ENSRNOT00000115772 ENTREZGENE
Gene3D-CATH 2.30.42.10 UniProtKB/Swiss-Prot
Cysteine Rich Protein UniProtKB/Swiss-Prot
InterPro PDZ UniProtKB/Swiss-Prot
PDZ-LIM_domain UniProtKB/Swiss-Prot
PDZ_sf UniProtKB/Swiss-Prot
Znf_LIM UniProtKB/Swiss-Prot
KEGG Report rno:64353 UniProtKB/Swiss-Prot
NCBI Gene 64353 ENTREZGENE
PANTHER PDZ AND LIM DOMAIN PROTEIN 5 UniProtKB/Swiss-Prot
PDZ AND LIM DOMAIN PROTEIN ZASP UniProtKB/Swiss-Prot
Pfam LIM UniProtKB/Swiss-Prot
PDZ UniProtKB/Swiss-Prot
PhenoGen Pdlim5 PhenoGen
PROSITE LIM_DOMAIN_1 UniProtKB/Swiss-Prot
LIM_DOMAIN_2 UniProtKB/Swiss-Prot
PDZ UniProtKB/Swiss-Prot
RatGTEx ENSRNOG00000016419 RatGTEx
SMART LIM UniProtKB/Swiss-Prot
PDZ UniProtKB/Swiss-Prot
Superfamily-SCOP Glucocorticoid receptor-like (DNA-binding domain) UniProtKB/Swiss-Prot
SSF50156 UniProtKB/Swiss-Prot
UniProt A0A8I6ADM7 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6ARU2 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6B1G1 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6G7D0_RAT UniProtKB/TrEMBL
A0A8I6GJC1 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6GJY3 ENTREZGENE, UniProtKB/TrEMBL
A0A8I6GKL2 ENTREZGENE, UniProtKB/TrEMBL
A0A8L2QCL7 ENTREZGENE, UniProtKB/TrEMBL
A6HW57 ENTREZGENE, UniProtKB/TrEMBL
A6HW58 ENTREZGENE, UniProtKB/TrEMBL
A6HW60 ENTREZGENE, UniProtKB/TrEMBL
PDLI5_RAT UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Pdlim5
PDZ and LIM domain 5
Enh
enigma homolog
Symbol and Name updated
1299863 APPROVED
2005-01-20
Enh
enigma homolog
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Enh
enigma homolog
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_domains
contains three LIM domains with two zinc-finger motifs in each domain
632670
gene_drugs
protein translocated from membrane fraction to cytosol on phorbol ester treatment
632670
gene_function
phosphorylates protein kinase C by associating with the amino terminal region
632670
