Rab13 (RAB13, member RAS oncogene family)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rab13 (RAB13, member RAS oncogene family) Rattus norvegicus

Analyze

Symbol:

Rab13

Name:

RAB13, member RAS oncogene family

RGD ID:

620880

Description:

Enables protein kinase A catalytic subunit binding activity. Involved in several processes, including cellular response to insulin stimulus; establishment of Sertoli cell barrier; and protein kinase A signaling. Located in insulin-responsive compartment. Orthologous to human RAB13 (RAB13, member RAS oncogene family); PARTICIPATES IN insulin responsive facilitative sugar transporter mediated glucose transport pathway; Rab family mediated signaling pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ras-related protein Rab-13

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RAB13 (RAB13, member RAS oncogene family)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rab13 (RAB13, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rab13 (RAB13, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RAB13 (RAB13, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RAB13 (RAB13, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rab13 (RAB13, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RAB13 (RAB13, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RAB13 (RAB13, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rab13 (RAB13, member RAS oncogene family)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RAB13 (RAB13, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rab13 (RAB13, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rab13 (RAB13, member RAS oncogene family)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SEC4	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	175,674,894 - 175,680,043 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	175,675,005 - 175,680,036 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	182,815,256 - 182,819,665 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	180,837,642 - 180,842,053 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	175,437,832 - 175,442,251 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	189,581,209 - 189,586,358 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	189,581,644 - 189,586,338 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	209,014,390 - 209,019,155 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	182,460,998 - 182,465,393 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	182,411,103 - 182,415,499 (+)	NCBI
Celera	2	169,611,392 - 169,615,789 (+)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

dyschromatosis symmetrica hereditaria (ISO)

GAND syndrome (ISO)

gastrointestinal stromal tumor (ISO)

immunodeficiency 42 (ISO)

MHC class II deficiency (ISO)

parathyroid carcinoma (ISO)

severe congenital neutropenia 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17beta-estradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

5-aza-2'-deoxycytidine (ISO)

5-azacytidine (ISO)

acetamide (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

arsenous acid (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

carbon nanotube (ISO)

cobalt dichloride (EXP)

Cuprizon (EXP)

diarsenic trioxide (ISO)

dibenzo[a,l]pyrene (ISO)

dibutyl phthalate (EXP,ISO)

dicrotophos (ISO)

diuron (EXP)

dorsomorphin (ISO)

endosulfan (EXP)

gentamycin (EXP)

hydralazine (ISO)

hydrazine (ISO)

indole-3-methanol (EXP)

ivermectin (ISO)

methylmercury chloride (ISO)

mono(2-ethylhexyl) phthalate (EXP)

N-nitrosodimethylamine (EXP)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

potassium dichromate (ISO)

SB 431542 (ISO)

Soman (EXP)

sunitinib (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

topotecan (EXP,ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

valproic acid (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bicellular tight junction assembly (IEA,ISO,ISS)

cellular response to insulin stimulus (IMP)

cortical actin cytoskeleton organization (IMP)

endocytic recycling (IBA,IEA,ISO,ISS)

endosomal transport (ISO,ISS)

endothelial cell chemotaxis (IEA,ISO,ISS)

establishment of Sertoli cell barrier (IMP)

glucose homeostasis (IC)

Golgi vesicle fusion to target membrane (IBA)

neuron projection development (IEA,IMP,ISO)

positive regulation of glucose import (IC)

protein kinase A signaling (IBA,IEA,IMP,ISO)

protein localization to cell leading edge (IEA,ISO,ISS)

protein localization to plasma membrane (IBA,IDA,IEA,ISO,ISS)

protein secretion (IBA)

regulation of exocytosis (IBA)

trans-Golgi network to recycling endosome transport (ISO,ISS)

vesicle docking involved in exocytosis (IBA)

Cellular Component

bicellular tight junction (IEA,ISO,ISS)

cell-cell junction (ISO)

cytoplasmic vesicle (ISO)

cytoplasmic vesicle membrane (TAS)

cytosol (IEA,ISO)

endocytic vesicle (IEA,ISO,ISS)

endosome (IBA)

Golgi apparatus (ISO)

insulin-responsive compartment (IDA)

intracellular membrane-bounded organelle (IBA)

lamellipodium (IEA,ISO,ISS)

lateral plasma membrane (IEA,ISO,ISS)

neuron projection (IEA,ISO,ISS)

plasma membrane (IBA,ISO,ISS)

recycling endosome (IEA,ISO,ISS)

recycling endosome membrane (IEA)

synaptic vesicle (IBA)

trans-Golgi network (IEA,ISO,ISS)

trans-Golgi network transport vesicle (IBA)

Molecular Function

GTP binding (IEA,ISO,ISS)

GTPase activity (IBA,IEA)

protein binding (IPI,ISO)

protein kinase A catalytic subunit binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

insulin responsive facilitative sugar transporter mediated glucose transport pathway (TAS)

Rab family mediated signaling pathway (TAS)

References

References - curated

#	Reference Title	Reference Citation
1.	rab15, a novel low molecular weight GTP-binding protein specifically expressed in rat brain.	Elferink LA, etal., J Biol Chem 1992 Mar 25;267(9):5768-75.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Novel interaction of Rab13 and Rab8 with endospanins.	Hirvonen MJ, etal., FEBS Open Bio. 2013 Jan 22;3:83-8. doi: 10.1016/j.fob.2013.01.004. Print 2013.
5.	Signal transduction meets vesicle traffic: the software and hardware of GLUT4 translocation.	Klip A, etal., Am J Physiol Cell Physiol. 2014 May 15;306(10):C879-86. doi: 10.1152/ajpcell.00069.2014. Epub 2014 Mar 5.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Rab13 regulates neurite outgrowth in PC12 cells through its effector protein, JRAB/MICAL-L2.	Sakane A, etal., Mol Cell Biol. 2010 Feb;30(4):1077-87. doi: 10.1128/MCB.01067-09. Epub 2009 Dec 14.
10.	RAB13 regulates Sertoli cell permeability barrier dynamics through protein kinase A.	Su W and Liu X, J Mol Endocrinol. 2013 Apr 12;50(3):305-18. doi: 10.1530/JME-13-0011. Print 2013 Jun.
11.	Rab8A and Rab13 are activated by insulin and regulate GLUT4 translocation in muscle cells.	Sun Y, etal., Proc Natl Acad Sci U S A. 2010 Nov 16;107(46):19909-14. doi: 10.1073/pnas.1009523107. Epub 2010 Nov 1.

Additional References at PubMed

PMID:8294494	PMID:11025210	PMID:11042173	PMID:12058051	PMID:15096524	PMID:15528189	PMID:18094055	PMID:18779367	PMID:19056867	PMID:19074001	PMID:20937701	PMID:21543326
PMID:26538022	PMID:29247648	PMID:33527312

Genomics

Comparative Map Data

Rab13
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	175,674,894 - 175,680,043 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	175,675,005 - 175,680,036 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	182,815,256 - 182,819,665 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	2	180,837,642 - 180,842,053 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	2	175,437,832 - 175,442,251 (+)	NCBI	Rnor_WKY
Rnor_6.0	2	189,581,209 - 189,586,358 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	189,581,644 - 189,586,338 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	209,014,390 - 209,019,155 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	182,460,998 - 182,465,393 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	182,411,103 - 182,415,499 (+)	NCBI
Celera	2	169,611,392 - 169,615,789 (+)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

RAB13
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	153,981,650 - 153,990,708 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	153,981,617 - 153,986,358 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	153,954,126 - 153,958,815 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	152,220,751 - 152,225,430 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	150,767,202 - 150,771,879	NCBI
Celera	1	127,025,879 - 127,030,558 (-)	NCBI		Celera
Cytogenetic Map	1	q21.3	NCBI
HuRef	1	125,316,456 - 125,321,216 (-)	NCBI		HuRef
CHM1_1	1	155,350,407 - 155,355,167 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	153,118,913 - 153,123,602 (-)	NCBI		T2T-CHM13v2.0

Rab13
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	90,121,022 - 90,133,694 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	90,121,002 - 90,133,692 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	90,213,715 - 90,226,387 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	90,213,695 - 90,226,385 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	90,024,739 - 90,029,885 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	90,306,744 - 90,311,890 (+)	NCBI		MGSCv36	mm8
Celera	3	90,257,755 - 90,263,055 (+)	NCBI		Celera
Cytogenetic Map	3	F1	NCBI
cM Map	3	39.21	NCBI

Rab13
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955545	589,239 - 594,835 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955545	590,021 - 594,191 (-)	NCBI	ChiLan1.0	ChiLan1.0

RAB13
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	1	132,967,363 - 132,972,068 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	132,967,363 - 132,972,067 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	1	129,338,524 - 129,343,234 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

RAB13
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	43,152,903 - 43,156,720 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	43,153,002 - 43,156,720 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	42,643,351 - 42,647,069 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	43,023,274 - 43,027,095 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	43,023,377 - 43,027,095 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	42,802,039 - 42,805,757 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	42,855,205 - 42,858,928 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	43,139,557 - 43,143,275 (+)	NCBI		UU_Cfam_GSD_1.0

Rab13
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	24,698,570 - 24,702,753 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936580	3,728,892 - 3,733,167 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936580	3,728,952 - 3,733,126 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RAB13
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	95,705,220 - 95,711,729 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	95,705,093 - 95,709,942 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	104,606,045 - 104,611,247 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RAB13
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	9,832,220 - 9,836,890 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666038	9,195,727 - 9,200,396 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rab13
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624885	3,239,595 - 3,243,539 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624885	3,239,581 - 3,243,539 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rab13
10 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	271
Count of miRNA genes:	173
Interacting mature miRNAs:	196
Transcripts:	ENSRNOT00000022627
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	114837527	185876470	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	143657411	190602963	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
12879845	Cm89	Cardiac mass QTL 89		0.008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	175950118	Rat
12879846	Cm90	Cardiac mass QTL 90		0.011	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	2	152413072	175950118	Rat
12879847	Am4	Aortic mass QTL 4		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	175950118	Rat
11565180	Kidm56	Kidney mass QTL 56		0.003	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	175950118	Rat
11565181	Bw176	Body weight QTL 176		0.002	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	175950118	Rat
2301415	Cm67	Cardiac mass QTL 67		0.003	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	175950118	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168354880	185122374	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
61473	Bp19	Blood pressure QTL 19	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	175950118	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	184114403	Rat
7488904	Bp363	Blood pressure QTL 363		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	172982062	175950118	Rat
61457	Niddm8	Non-insulin dependent diabetes mellitus QTL 8	4.1	0.01	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	2	174543008	175950118	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat

Markers in Region

Rab13

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	1	6,086,289 - 6,086,414	NCBI	Rnor5.0
RGSC_v3.4	1	4,977,645 - 4,977,769	UniSTS	RGSC3.4
Celera	1	3,263,843 - 3,263,967	UniSTS
Cytogenetic Map	2	q34	UniSTS

RH134804

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	175,679,708 - 175,679,897 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	189,586,024 - 189,586,212	NCBI	Rnor6.0
Rnor_5.0	2	209,018,821 - 209,019,009	UniSTS	Rnor5.0
RGSC_v3.4	2	182,465,378 - 182,465,566	UniSTS	RGSC3.4
Celera	2	169,615,774 - 169,615,962	UniSTS
RH 3.4 Map	2	1151.8	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	33	48	39	12	39			67	35	41	11
Low		10	9	2	7	2	8	11	7				8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031092	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039103237	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_351807	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC107098	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF525280	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M83678	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000022627 ⟹ ENSRNOP00000022626

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	175,675,005 - 175,680,036 (+)	Ensembl
Rnor_6.0 Ensembl	2	189,582,991 - 189,586,338 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000092112 ⟹ ENSRNOP00000071741

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	175,675,318 - 175,680,029 (+)	Ensembl
Rnor_6.0 Ensembl	2	189,581,644 - 189,586,039 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000111727 ⟹ ENSRNOP00000090651

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	175,676,405 - 175,680,036 (+)	Ensembl

RefSeq Acc Id:

NM_031092 ⟹ NP_112354

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	175,675,329 - 175,679,724 (+)	NCBI
Rnor_6.0	2	189,581,644 - 189,586,039 (+)	NCBI
Rnor_5.0	2	209,014,390 - 209,019,155 (+)	NCBI
RGSC_v3.4	2	182,460,998 - 182,465,393 (+)	RGD
Celera	2	169,611,392 - 169,615,789 (+)	RGD

Sequence:

show sequence

GGCGGTTTCTGCCTGCCAACCCTCCGATCCGCCTACCAGCGTTGGCTCTTCCCGACCCCTCCCC
CGGCGCCCCCAGTGTCCGCCATGGCCAAAGCCTACGACCACCTCTTCAAGTTGCTGCTGATCGG
GGACTCGGGGGTGGGCAAGACTTGTCTCATCATTCGCTTTGCAGAGGACAACTTCAACAGCACT
TACATCTCCACCATCGGAATTGATTTCAAGATCCGAACTGTGGAAATAGAGGGGAAGAGAATCA
AACTGCAAGTCTGGGACACAGCTGGCCAAGAACGATTCAAGACAATAACCACCGCCTATTACCG
TGGAGCCATGGGCATTATCCTAGTATATGACATCACAGATGAGAAATCCTTCGAGAATATTCAG
AACTGGATGAAAAGCATCAAAGAGAACGCGTCTGCTGGAGTGGAGCGCCTTCTGCTGGGGAACA
AATGTGACATGGAAGCCAAGCGGAAGGTGCAGAGAGAGCAGGCTGAGAGGTTGGCCCGAGAGCA
CAGAATCCGATTTTTTGAGACAAGTGCCAAATCCAGTGTGAATGTGGATGAGGCTTTCAGTTCC
CTGGCCCGTGACATCTTGCTCAAGACAGGAGGCCGGAGATCGGGAAACAGCAGCAAGCCCTCAA
GCACTGACCTGAAAGTATCTGACAAGAAGAACAGCAACAAGTGCTCCTTGGGCTGAGGAACATT
TCTTGCCTCCTATTCACCCTGAACCTGGAGGCTAGACCTGAGGGAGGTGGACTGA

hide sequence

RefSeq Acc Id:

XM_039103237 ⟹ XP_038959165

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	175,675,484 - 175,680,043 (+)	NCBI

RefSeq Acc Id:

XR_351807

RefSeq Status:

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	175,674,894 - 175,680,043 (+)	NCBI
Rnor_6.0	2	189,581,209 - 189,586,358 (+)	NCBI
Rnor_5.0	2	209,014,390 - 209,019,155 (+)	NCBI

Sequence:

show sequence

ATCCAGCATACTAACCTCCCAACCCGCTTCTTTTCAAAGGGAATTGGGATTTGTAAACTTAAGA
AGCGCAGTGCTGACAGAAAGTTCTTAGGACCTTTATCATAAACTCAAAAGCTTATGAATAGCGC
CTCAGCCCTTTATCAATTTCCAGTGCCACCCCTCTCTCCACCACTGGTAAATTTCTTTCCCTCT
TTCCCTAATCTTTTTAAAATTCCTCTTTCTACTTCGGTAGAAAGAGAGGAAAGACAGCTAGCCA
AAGGCAATGGGAAGGGCTAGGGAGACTGGCTCTTCGAGGCCGGGGAGGCAGCGCCCGGACTGCT
AGAGCTGGACAGGCCTCTCCACTAGCGAAGAGGGGTGGAGCCCGGAGCAGGGCCGCCTCTCTTC
TTTTCCCGGGGCCTGGGCGGAGAGGGAGGAAAACTTCCTGGCTGGGACTCTGGCGGTTTCTGCC
TGCCAACCCTCCGATCCCGCCTACCAGCGTTGGCTCTTCCCGACCCCTCCCCCGGCGCCCCCAG
TGTCCGCCATGGCCAAAGCCTACGACCACCTCTTCAAGTTGCTGCTGATCGGGGACTCGGGGGT
GGGCAAGACTTGTCTCATCATTCGCTTTGCAGAGGACAACTTCAACAGCACTTACATCTCCACC
ATCGGAATTGATTTCAAGATCCGAACTGTGGAAATAGAGGGGAAGAGAATCAAACTGCAAGTCT
GGGACACAGCTGGCCAAGAACGATTCAAGACAATAACCACCGCCTATTACCGTGGAGCCATGGG
CATTATCCTAGTATATGACATCACAGATGAGAAATCCTTCGAGAATATTCAGAACTGGATGAAA
AGCATCAAAGAGAACGCGTCTGCTGGAGTGGAGCGCCTTCTGCTGGGGAACAAATGTGACATGG
AAGCCAAGCGGAAGGTGCAGAGAGAGCAGGCTGAGAGGCTCTCTCCTTCCTACCTCATCCCCTA
CAGTTGGCCCGAGAGCACAGAATCCGATTTTTTGAGACAAGTGCCAAATCCAGTGTGAATGTGG
ATGAGGCTTTCAGTTCCCTGGCCCGTGACATCTTGCTCAAGACAGGAGGCCGGAGATCGGGAAA
CAGCAGCAAGCCCTCAAGCACTGACCTGAAAGTATCTGACAAGAAGAACAGCAACAAGTGCTCC
TTGGGCTGAGGAACATTTCTTGCCTCCTATTCACCCTGAACCTGGAGGCTAGACCTGAGGGAGG
TGGACTGAGGTAGACTGATGGAAAACAGAGGGGAGGAGCTGTGGTGGTGCCTGGAGGGGTGGAT
GACAGGGGAGGAAGGAAAGATGAAATGGGCAGGGAAAGGAGGGCGAGGAACCAAGGACGTGAAA
AGTGAAGAGAAGGGGTTTGAGAAGAGAAAAAGAAGAAGGTCTCAGGTCTCGGACCGTCCAACAT
TAATGTCAGTATGCTGATCTCTCCATTCCTGGTTCAGGGTTCGGGTCCCGAGAGGCTGGCTCGG
CCCTACTCTGAGGGTCTCTCACTCCACAGATCTTTGTTAGTATTAAAGGCCACTGTTTGGCACG
AATGTTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_112354	(Get FASTA)	NCBI Sequence Viewer
	XP_038959165	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41993	(Get FASTA)	NCBI Sequence Viewer
	AAM82588	(Get FASTA)	NCBI Sequence Viewer
	EDM00580	(Get FASTA)	NCBI Sequence Viewer
	EDM00581	(Get FASTA)	NCBI Sequence Viewer
	P35286	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_112354 ⟸ NM_031092

- UniProtKB:

Q8K3X5 (UniProtKB/Swiss-Prot), P35286 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVEIEGKRIKLQVWDT
AGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAK
RKVQREQAERLAREHRIRFFETSAKSSVNVDEAFSSLARDILLKTGGRRSGNSSKPSSTDLKVS
DKKNSNKCSLG

hide sequence

RefSeq Acc Id:

ENSRNOP00000071741 ⟸ ENSRNOT00000092112

RefSeq Acc Id:

ENSRNOP00000022626 ⟸ ENSRNOT00000022627

RefSeq Acc Id:	XP_038959165 ⟸ XM_039103237
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000090651 ⟸ ENSRNOT00000111727

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P35286-F1-model_v2	AlphaFold	P35286	1-203	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691494

Promoter ID:

EPDNEW_R2019

Type:

initiation region

Name:

Rab13_1

Description:

RAB13, member RAS oncogene family

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	189,581,719 - 189,581,779	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620880	AgrOrtholog
BioCyc Gene	G2FUF-52363	BioCyc
Ensembl Genes	ENSRNOG00000016733	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000022626	ENTREZGENE
	ENSRNOP00000022626.3	UniProtKB/TrEMBL
	ENSRNOP00000071741.2	UniProtKB/TrEMBL
	ENSRNOP00000090651.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000022627	ENTREZGENE
	ENSRNOT00000022627.5	UniProtKB/TrEMBL
	ENSRNOT00000092112	ENTREZGENE
	ENSRNOT00000092112.2	UniProtKB/TrEMBL
	ENSRNOT00000111727.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Small_GTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:81756	UniProtKB/Swiss-Prot
NCBI Gene	81756	ENTREZGENE
Pfam	Ras	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rab13	PhenoGen
PROSITE	RAB	UniProtKB/Swiss-Prot
	RAS	UniProtKB/TrEMBL
SMART	RHO	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGRFAMs	small_GTP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0H2UHN5_RAT	UniProtKB/TrEMBL
	A0A8I6GJ19_RAT	UniProtKB/TrEMBL
	A0A8L2UQH0_RAT	UniProtKB/TrEMBL
	P35286	ENTREZGENE
	Q8K3X5	ENTREZGENE
	RAB13_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q8K3X5	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Rab13	RAB13, member RAS oncogene family		RAB13	Name updated	1299863	APPROVED
2002-08-07	Rab13	RAB13			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_product	member of a family of low molecular weight GTP-binding proteins	633184

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations