Advanced Search (OLGA)

Gene: Dap (death-associated protein) Rattus norvegicus

Analyze

Symbol:

Dap

Name:

death-associated protein

RGD ID:

620641

Description:

Predicted to enable ribosome binding activity. Predicted to be involved in apoptotic signaling pathway; negative regulation of autophagy; and ribosome hibernation. Predicted to act upstream of or within apoptotic process. Orthologous to human DAP (death associated protein); INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 1,2,4-trimethylbenzene; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DAP-1; death-associated protein 1; MGC72827; Rap7a

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DAP (death associated protein)	HGNC	EggNOG, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Dap (death-associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Dap (death associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DAP (death associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DAP (death associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DAP (death associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DAP (death associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Dap (death associated protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	DAP (death associated protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DAP (death associated protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Dap (death-associated protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	dap (death-associated protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG12384	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG12384	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	T28F4.5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	T28F4.5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	F54B8.4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	dap	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	dap	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	83,910,113 - 83,962,673 (+)	NCBI		GRCr8
GRCr8 Ensembl	2	83,910,060 - 83,962,673 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	2	82,199,206 - 82,251,771 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	82,199,280 - 82,251,752 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	89,245,301 - 89,297,890 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	87,366,891 - 87,419,478 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	82,423,146 - 82,475,737 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	84,275,884 - 84,328,998 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	84,275,884 - 84,328,998 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	103,949,821 - 104,003,059 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	83,281,937 - 83,335,284 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	77,725,582 - 77,777,938 (+)	NCBI		Celera
RGSC_v3.1	2	83,226,898 - 83,280,246 (+)	NCBI
Cytogenetic Map	2	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

ulcerative colitis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2-acetamidofluorene (EXP)

3',5'-cyclic AMP (EXP)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-amino-2,6-dinitrotoluene (EXP)

4-hydroxynon-2-enal (ISO)

6-propyl-2-thiouracil (EXP)

acetylsalicylic acid (ISO)

aconitine (EXP)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

capsaicin (ISO)

carbon nanotube (ISO)

chlormequat chloride (EXP)

cis-caffeic acid (ISO)

cisplatin (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

Cuprizon (EXP)

DDE (ISO)

dexamethasone (ISO)

diazinon (EXP)

diclofenac (ISO)

dieldrin (EXP)

diuron (EXP)

doxorubicin (ISO)

fipronil (EXP)

fluoxetine (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

gentamycin (EXP)

glafenine (EXP)

hydroquinone (ISO)

indometacin (ISO)

isoprenaline (EXP)

ivermectin (ISO)

methylmercury(1+) (EXP)

N-nitrosodiethylamine (EXP)

nickel dichloride (EXP)

nitrates (ISO)

okadaic acid (ISO)

oxybenzone (EXP)

p-menthan-3-ol (ISO)

p-toluidine (EXP)

paracetamol (EXP,ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

potassium chromate (ISO)

quercetin (EXP)

rotenone (EXP)

sodium arsenite (ISO)

sodium dichromate (EXP)

Soman (EXP)

tamoxifen (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

tolcapone (EXP)

trans-caffeic acid (ISO)

triphenyl phosphate (EXP,ISO)

tunicamycin (ISO)

valproic acid (ISO)

vancomycin (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA,ISO)

apoptotic signaling pathway (IBA,IEA,ISO)

autophagy (IEA)

negative regulation of autophagy (IBA,IEA,ISO)

regulation of translation (IEA)

ribosome hibernation (IBA)

Molecular Function

ribosome binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification of a novel serine/threonine kinase and a novel 15-kD protein as potential mediators of the gamma interferon-induced cell death.	Deiss LP, etal., Genes Dev 1995 Jan 1;9(1):15-30.
2.	Assignment of DAP1 and DAPK--genes that positively mediate programmed cell death triggered by IFN-gamma--to chromosome regions 5p12.2 and 9q34.1, respectively.	Feinstein E, etal., Genomics 1995 Sep 1;29(1):305-7.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	GOA pipeline	RGD automated data pipeline
8.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1087798	PMID:1302217	PMID:12477932	PMID:15489334	PMID:20537536

Genomics

Comparative Map Data

Dap
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	83,910,113 - 83,962,673 (+)	NCBI		GRCr8
GRCr8 Ensembl	2	83,910,060 - 83,962,673 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	2	82,199,206 - 82,251,771 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	82,199,280 - 82,251,752 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	89,245,301 - 89,297,890 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	87,366,891 - 87,419,478 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	82,423,146 - 82,475,737 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	84,275,884 - 84,328,998 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	84,275,884 - 84,328,998 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	103,949,821 - 104,003,059 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	83,281,937 - 83,335,284 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	77,725,582 - 77,777,938 (+)	NCBI		Celera
RGSC_v3.1	2	83,226,898 - 83,280,246 (+)	NCBI
Cytogenetic Map	2	q23	NCBI

DAP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	10,679,230 - 10,761,234 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	10,679,230 - 10,761,234 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	10,679,342 - 10,761,346 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	10,732,342 - 10,814,387 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	10,732,405 - 10,814,339	NCBI
Celera	5	10,716,485 - 10,798,530 (-)	NCBI		Celera
Cytogenetic Map	5	p15.2	NCBI
HuRef	5	10,662,694 - 10,744,776 (-)	NCBI		HuRef
CHM1_1	5	10,679,208 - 10,761,280 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	10,617,243 - 10,698,870 (-)	NCBI		T2T-CHM13v2.0

Dap
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	15	31,224,531 - 31,274,484 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	15	31,224,460 - 31,274,487 (+)	Ensembl		GRCm39 Ensembl
GRCm38	15	31,224,385 - 31,274,338 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	15	31,224,314 - 31,274,341 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	15	31,154,140 - 31,204,093 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	15	31,169,014 - 31,218,924 (+)	NCBI		MGSCv36	mm8
Celera	15	31,908,297 - 31,959,719 (+)	NCBI		Celera
Cytogenetic Map	15	B2	NCBI
cM Map	15	12.67	NCBI

Dap
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955426	398,593 - 452,004 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955426	398,593 - 452,004 (-)	NCBI	ChiLan1.0	ChiLan1.0

DAP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	10,920,514 - 11,012,047 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	9,074,121 - 9,169,141 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	10,991,599 - 11,078,154 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	10,846,394 - 10,927,869 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	10,846,394 - 10,927,869 (-)	Ensembl	panpan1.1		panPan2

DAP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	3,616,960 - 3,682,424 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	3,617,000 - 3,680,793 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	8,120,870 - 8,186,391 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	3,522,670 - 3,588,073 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	3,522,663 - 3,588,070 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	3,572,954 - 3,638,312 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	3,550,022 - 3,615,630 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	3,781,767 - 3,847,273 (+)	NCBI		UU_Cfam_GSD_1.0

DAP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	250,217 - 321,929 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	250,212 - 322,075 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	86,667,759 - 86,739,575 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DAP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	4	10,205,447 - 10,280,004 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666064	18,264,891 - 18,341,096 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dap
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624751	7,897,572 - 7,954,689 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624751	7,898,775 - 7,954,381 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dap
466 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	80
Count of miRNA genes:	70
Interacting mature miRNAs:	72
Transcripts:	ENSRNOT00000014439
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1578777	Stresp15	Stress response QTL 15	2	0.05	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	2	61556902	106556902	Rat
631500	Bp99	Blood pressure QTL 99	2.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	61051883	104684275	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	82947902	127947902	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	82214549	127214549	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
5684996	Bmd85	Bone mineral density QTL 85	4.7	0.024	tibia mineral mass (VT:1000283)	bone mineral density (CMO:0001226)	2	61051541	105724065	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
61465	Bp13	Blood pressure QTL 13	3.3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	78269809	104744824	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
70174	BpQTLCluster2	Blood pressure QTL cluster 2	4.24		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	41801363	104744824	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
631208	Bw1	Body weight QTL1	5.09		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	2	44904355	85286097	Rat
2317058	Aia13	Adjuvant induced arthritis QTL 13	2.9		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	2	78269809	123269809	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1300155	Bp174	Blood pressure QTL 174	4.09		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	2	44537979	112567334	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
5684990	Bmd82	Bone mineral density QTL 82	2.8		tibia mineral mass (VT:1000283)	bone mineral content (CMO:0001554)	2	61051541	105724065	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
61355	Bp36	Blood pressure QTL 36	2.9		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	2	7605533	104774005	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1359034	Bp274	Blood pressure QTL 274			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	51266859	96266859	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	60861391	105861391	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
2306903	Bp336	Blood pressure QTL 336		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	38426449	111295694	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	44904355	89904355	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	61051541	143746880	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat

Markers in Region

RH135371

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	82,222,989 - 82,223,195 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	84,300,046 - 84,300,251	NCBI	Rnor6.0
Rnor_5.0	2	103,973,983 - 103,974,188	UniSTS	Rnor5.0
RGSC_v3.4	2	83,305,721 - 83,305,926	UniSTS	RGSC3.4
Celera	2	77,749,372 - 77,749,577	UniSTS
RH 3.4 Map	2	517.6	UniSTS
Cytogenetic Map	2	q22	UniSTS

RH127526

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	82,251,505 - 82,251,697 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	84,328,733 - 84,328,924	NCBI	Rnor6.0
Rnor_5.0	2	104,002,794 - 104,002,985	UniSTS	Rnor5.0
RGSC_v3.4	2	83,335,184 - 83,335,375	UniSTS	RGSC3.4
Celera	2	77,777,673 - 77,777,864	UniSTS
RH 3.4 Map	2	516.7	UniSTS
Cytogenetic Map	2	q22	UniSTS

RH137625

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	82,201,681 - 82,201,901 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	84,278,738 - 84,278,957	NCBI	Rnor6.0
Rnor_5.0	2	103,952,675 - 103,952,894	UniSTS	Rnor5.0
RGSC_v3.4	2	83,284,413 - 83,284,632	UniSTS	RGSC3.4
Celera	2	77,728,064 - 77,728,283	UniSTS
Cytogenetic Map	2	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022526	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC060569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473992	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM053394	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214163	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228698	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228865	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U05334	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000014439 ⟹ ENSRNOP00000014439

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	83,910,060 - 83,962,659 (+)	Ensembl
mRatBN7.2 Ensembl	2	82,199,280 - 82,251,752 (+)	Ensembl
Rnor_6.0 Ensembl	2	84,275,884 - 84,328,998 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095607 ⟹ ENSRNOP00000081065

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	2	83,955,304 - 83,962,673 (+)	Ensembl
mRatBN7.2 Ensembl	2	82,244,402 - 82,251,752 (+)	Ensembl

RefSeq Acc Id:

NM_022526 ⟹ NP_071971

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	83,910,113 - 83,962,673 (+)	NCBI
mRatBN7.2	2	82,199,206 - 82,251,771 (+)	NCBI
Rnor_6.0	2	84,275,884 - 84,328,998 (+)	NCBI
Rnor_5.0	2	103,949,821 - 104,003,059 (+)	NCBI
RGSC_v3.4	2	83,281,937 - 83,335,284 (+)	RGD
Celera	2	77,725,582 - 77,777,938 (+)	NCBI

Sequence:

show sequence

CAAGGCGAGGCGGCCGGCAAAGCTCAGGTGGGCGGGGCCGTGCCACGCAGCGCTCCGGAGCCAC
GCCCCCGTCCCTGGGCGGCAGTGCGCGTTCCCGAGCGGCGCGCGCCTCCCGTCTTTCCTCCCGA
GGCCTTGCGCGCGCACTGCTGCCCACCCGCGGCTGCCATCGCCCCTCAGAAAACCAGCGGCGCC
ATGTCTTCGCCTCCAGAAGGAAAGCTAGAGACCAAAGCTGGACATCCGCCCGCCGTGAAAGTCG
CTGGGATTCGGATTGTGCAGAAACACCCACACACTGGAGATGGGAAGGAAAAGAAAGACAAGGA
TGACCAAGAATGGGAAAGCACCAGCCCTCCTAAACCAACAGTGTACATCTCTGGTGTTATTGCC
CGGGGTGACAAAGACTTCCCCCCAGCAGCTGCACAAGTGGCCCACCAGAAGCCACATGCCTCCA
TGGACAAACATGTTTCTCCAAGAACGCAGCATATCCAACAGCCTCGCAAGTGACCAACGCCCAG
ACCCCTGCCACCTCAGCAGCAGCAGCAGCAGCAGCACCTGTGCCCCCTCCAGGATGCTTCCCCG
ACAAAATCAACTCAAACACCTTCTACAGAGTTTACTAAATTTAGAAATCTAAGACAAAGCAAAG
TGGGCCTCGGTTGTGTCAGATCCCCATGTTTAAAACTAGAAGAGGCTCAAACACCAAATTTTGT
TTCTAAGAGTCCTAGTCGAGTGTCAGTAAAGGGTCATTGAACCCCTAGAAGTGCCATTAGCAGA
ACATGGCAAGTCCTGAGTAAAAGGAAGTCCTTCGCACTATAGCAGTAGTTTAAAGTCCTTACTC
GTGGTCCTAAGAGGAAGAGGCCACTTTGGAGAGGTTTGATAAGGTTAGGAGAAGAAAAAACAAA
ACACTATGGTATGGTCCGAACAGCTGTGCTCCCTTCTGCCCCCAGTCCATGGCTGCAAATCCCT
GTTTTTCAGAAAAGTCAAAGAGCTAGATGTAGAGCCTTCTGGAGTGCTGCTCTTGGAGGGTCCT
CCTGGCTGTCCCAGTGGCCTACAGTGGCTCCAGCTCAGTTCACGGTTGCTCTATGAGCACCATG
TACGCCACCAGCCTTTCCAGGACTACTACATGGCCTGTACCATGTCGCTAAAGGAGGGATGGGC
TCCTCGGATTTTATGAGCAATCCAGTATCCCAACAGTGGCCTTCACATGGAGCAGAACACAGCC
CCCAAGACTGTGTTGTCAGTCTCTTCTTTGTAATTACTAAAATGGTGGGAACCCAGGGTCGCTT
TGGAGACCCAGACTTGGCTGCAGCCTACAGCCTTGCTCAGTCATATGGAACCAAATCTAGGAAG
GGACCTTAGAGACAGCAACGCCAGTTCCCTGTGCAGACCTTCCCACGTGTTGCCTGCATCCGCA
ATCCCTTTTAGTTCAGCCACCTGAGGGGCTACCCCGTGTTCCGTGTACTCTGAGCTAGCTCCGG
TGTGTGTCTGTGGACTCTGGGTCACTAAAGGTTTGCCCGAATGAATTTCTGAATCTTTGGCGTT
GAGAAGATGTTGATTCTAATAAAGCTCCTGCATTTCTGCCTCAGTGTCTCTCTTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_071971	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF21441	(Get FASTA)	NCBI Sequence Viewer
	AAH60569	(Get FASTA)	NCBI Sequence Viewer
	EDL82636	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014439
GenBank Protein	Q9QX67	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_071971 ⟸ NM_022526
- UniProtKB:	Q9QX67 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MSSPPEGKLETKAGHPPAVKVAGIRIVQKHPHTGDGKEKKDKDDQEWESTSPPKPTVYISGVIA RGDKDFPPAAAQVAHQKPHASMDKHVSPRTQHIQQPRK hide sequence

Ensembl Acc Id:

ENSRNOP00000014439 ⟸ ENSRNOT00000014439

Ensembl Acc Id:

ENSRNOP00000081065 ⟸ ENSRNOT00000095607

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QX67-F1-model_v2	AlphaFold	Q9QX67	1-102	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691207

Promoter ID:

EPDNEW_R1732

Type:

initiation region

Name:

Dap_1

Description:

death-associated protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	84,276,005 - 84,276,065	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:620641	AgrOrtholog
BioCyc Gene	G2FUF-53870	BioCyc
Ensembl Genes	ENSRNOG00000010747	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000014439	ENTREZGENE
IMAGE_CLONE	IMAGE:6890457	IMAGE-MGC_LOAD
InterPro	DAP1/DAPL1	UniProtKB/Swiss-Prot
KEGG Report	rno:64322	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72827	IMAGE-MGC_LOAD
NCBI Gene	64322	ENTREZGENE
PANTHER	DEATH-ASSOCIATED PROTEIN 1	UniProtKB/Swiss-Prot
	PTHR13177	UniProtKB/Swiss-Prot
Pfam	DAP	UniProtKB/Swiss-Prot
PhenoGen	Dap	PhenoGen
RatGTEx	ENSRNOG00000010747	RatGTEx
UniProt	A0A8I5ZRM7_RAT	UniProtKB/TrEMBL
	A0A8L2Q727_RAT	UniProtKB/TrEMBL
	A6JMY7_RAT	UniProtKB/TrEMBL
	DAP1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Dap	death-associated protein	Rap7a	rap7a	Symbol and Name updated	1299863	APPROVED
2002-08-07	Rap7a	rap7a			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD