Ifit1 (interferon-induced protein with tetratricopeptide repeats 1) - Rat Genome Database

Ifit1 (interferon-induced protein with tetratricopeptide repeats 1) - Rat Genome Database

Submit Data | Help | Video Tutorials | News | Publications | Download | REST API | Citing RGD | Contact

Advanced Search (OLGA)

Gene: Ifit1 (interferon-induced protein with tetratricopeptide repeats 1) Rattus norvegicus

Subscribe to Updates

Symbol:

Ifit1

Name:

interferon-induced protein with tetratricopeptide repeats 1

RGD ID:

620599

Description:

Predicted to enable RNA binding activity. Predicted to be involved in defense response to virus. Predicted to act upstream of or within cellular response to interferon-alpha; cellular response to interferon-beta; and response to bacterium. Predicted to be located in cytoplasm. Predicted to be active in cytosol. Orthologous to several human genes including IFIT1B (interferon induced protein with tetratricopeptide repeats 1B); PARTICIPATES IN hepatitis C pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,7-dihydropurine-6-thione; acetamide.

Type:

protein-coding

RefSeq Status:

Previously known as:

Garg16; glucocorticoid-attenuated response gene 16 product; interferon-induced protein with tetratricopeptide repeats 1-like protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Is Marker For:

Strains: WAG.OXYS-(D1Rat219-D1Rat81)/Nov

Latest Assembly:

GRCr8 - GRCr8 Assembly

NCBI Annotation Information:

Annotation category: partial on reference assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	241,565,197 - 241,567,262 (+)	NCBI		GRCr8
mRatBN7.2	1	232,152,038 - 232,154,103 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	232,127,170 - 232,154,435 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	240,538,339 - 240,547,748 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	247,464,818 - 247,466,883 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	240,303,024 - 240,305,089 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	252,944,105 - 252,946,170 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	252,944,103 - 252,946,170 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	260,165,590 - 260,167,655 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	238,609,171 - 238,611,236 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	238,773,058 - 238,775,125 (+)	NCBI
Celera	1	229,265,082 - 229,267,147 (+)	NCBI		Celera
Cytogenetic Map	1	q53	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ifit1	Rat	COVID-19		ISO	RGD:1344579	9068941	mRNA:increased expression:bronchoalveolar lavage (human)	RGD	PMID:32407669\|REF_RGD_ID:30296672

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ifit1	Rat	autoimmune lymphoproliferative syndrome		ISO	RGD:1344579	8554872	ClinVar Annotator: match by term: AUTOIMMUNE LYMPHOPROLIFERATIVE SYNDROME, TYPE I, AUTOSOMAL DOMINANT	ClinVar	PMID:28492532
Ifit1	Rat	High Myopia		ISO	RGD:1344579	8554872	ClinVar Annotator: match by term: High myopia	ClinVar
Ifit1	Rat	Wolman disease		ISO	RGD:1344579	8554872	ClinVar Annotator: match by term: Wolman disease	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ifit1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of IFIT1 mRNA	CTD	PMID:15644576
Ifit1	Rat	3,7-dihydropurine-6-thione	increases expression	EXP		6480464	Mercaptopurine results in increased expression of IFIT1 mRNA	CTD	PMID:23358152
Ifit1	Rat	acetamide	affects expression	EXP		6480464	acetamide affects the expression of IFIT1 mRNA	CTD	PMID:31881176
Ifit1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of IFIT1 mRNA	CTD	PMID:16483693
Ifit1	Rat	aristolochic acid A	increases expression	ISO	RGD:1344579	6480464	aristolochic acid I results in increased expression of IFIT1B protein	CTD	PMID:33212167
Ifit1	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1344579	6480464	Benzo(a)pyrene results in increased methylation of IFIT1B promoter	CTD	PMID:27901495
Ifit1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of IFIT1B mRNA	CTD	PMID:25181051
Ifit1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of IFIT1 mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32528016
Ifit1	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of IFIT1 gene	CTD	PMID:28505145
Ifit1	Rat	CGP 52608	multiple interactions	ISO	RGD:1344579	6480464	CGP 52608 promotes the reaction [RORA protein binds to IFIT1B gene]	CTD	PMID:28238834
Ifit1	Rat	dioxygen	multiple interactions	EXP		6480464	[dan-shen root extract co-treated with Andrographis paniculata extract] inhibits the reaction [[Oxygen deficiency co-treated with more ...	CTD	PMID:33729688
Ifit1	Rat	doxorubicin	increases expression	EXP		6480464	Doxorubicin results in increased expression of IFIT1 mRNA	CTD	PMID:32289291
Ifit1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of IFIT1 mRNA	CTD	PMID:33387578
Ifit1	Rat	lead diacetate	increases expression	EXP		6480464	lead acetate results in increased expression of IFIT1 mRNA	CTD	PMID:22641619
Ifit1	Rat	mercaptopurine	increases expression	EXP		6480464	Mercaptopurine results in increased expression of IFIT1 mRNA	CTD	PMID:23358152
Ifit1	Rat	oxaliplatin	multiple interactions	EXP		6480464	[Oxaliplatin co-treated with Topotecan] results in increased expression of IFIT1 mRNA	CTD	PMID:25729387
Ifit1	Rat	permethrin	decreases expression	ISO	RGD:1344579	6480464	Permethrin results in decreased expression of IFIT1B mRNA	CTD	PMID:37047231
Ifit1	Rat	purine-6-thiol	increases expression	EXP		6480464	Mercaptopurine results in increased expression of IFIT1 mRNA	CTD	PMID:23358152
Ifit1	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of IFIT1 mRNA	CTD	PMID:31150632
Ifit1	Rat	topotecan	increases expression	EXP		6480464	Topotecan results in increased expression of IFIT1 mRNA	CTD	PMID:25729387
Ifit1	Rat	topotecan	multiple interactions	EXP		6480464	[Oxaliplatin co-treated with Topotecan] results in increased expression of IFIT1 mRNA	CTD	PMID:25729387
Ifit1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of IFIT1 mRNA	CTD	PMID:33387578
Ifit1	Rat	Triptolide	increases expression	EXP		6480464	triptolide results in increased expression of IFIT1 protein	CTD	PMID:32519852

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ifit1	Rat	cellular response to interferon-alpha	acts_upstream_of_or_within	ISO	RGD:733854	1624291	PMID:7896268	RGD	PMID:7896268
Ifit1	Rat	cellular response to interferon-alpha	acts_upstream_of_or_within	IEA	UniProtKB:Q64282\|ensembl:ENSMUSP00000099888	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ifit1	Rat	cellular response to interferon-beta	acts_upstream_of_or_within	ISO	RGD:733854	1624291	PMID:19158679	RGD	PMID:19158679
Ifit1	Rat	cellular response to interferon-beta	acts_upstream_of_or_within	IEA	UniProtKB:Q64282\|ensembl:ENSMUSP00000099888	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ifit1	Rat	defense response to virus	involved_in	IBA	MGI:99449\|PANTHER:PTN000814563\|UniProtKB:O14879\|UniProtKB:P09913\|UniProtKB:P09914\|UniProtKB:Q13325\|ZFIN:ZDB-GENE-121214-248\|ZFIN:ZDB-GENE-131120-20	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ifit1	Rat	response to bacterium	acts_upstream_of_or_within	ISO	RGD:733854	1624291	PMID:23012479	RGD	PMID:23012479
Ifit1	Rat	response to bacterium	acts_upstream_of_or_within	IEA	UniProtKB:Q64282\|ensembl:ENSMUSP00000099888	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ifit1	Rat	response to other organism	involved_in	IEA	ARBA:ARBA00029118	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Ifit1	Rat	response to virus	involved_in	ISO	RGD:733854	1624291	PMID:21085181, PMID:21642987	RGD	PMID:21085181\|PMID:21642987
Ifit1	Rat	response to virus	involved_in	IEA	UniProtKB:Q64282\|ensembl:ENSMUSP00000099888	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ifit1	Rat	cytoplasm	located_in	ISO	RGD:733854	1624291	PMID:19856081	RGD	PMID:19856081
Ifit1	Rat	cytoplasm	located_in	IEA	UniProtKB:Q64282\|ensembl:ENSMUSP00000099888	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ifit1	Rat	cytosol	is_active_in	IBA	PANTHER:PTN000814563\|UniProtKB:O14879\|UniProtKB:P09914\|UniProtKB:Q13325	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ifit1	Rat	protein binding	enables	ISO	RGD:1344579	1624291	UniProtKB:O14879 PMID:21642987, PMID:32296183	RGD	PMID:21642987\|PMID:32296183
Ifit1	Rat	protein binding	enables	ISO	RGD:733854	1624291	UniProtKB:P10126 PMID:19856081	RGD	PMID:19856081
Ifit1	Rat	RNA binding	enables	IBA	PANTHER:PTN002469621\|UniProtKB:P09914\|UniProtKB:Q13325	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ifit1	Rat	hepatitis C pathway		IEA		6907045		KEGG	rno:05160

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Lipopolysaccharide-induced switch between retinoid receptor (RXR) alpha and glucocorticoid attenuated response gene (GARG)-16 messenger RNAs in cultured rat microglia.	Kitamura Y, etal., J Neurosci Res 2001 Jun 15;64(6):553-63.
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:7896268	PMID:19158679	PMID:19856081	PMID:21085181	PMID:21642987	PMID:23012479	PMID:25428874

Ifit1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	241,565,197 - 241,567,262 (+)	NCBI		GRCr8
mRatBN7.2	1	232,152,038 - 232,154,103 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	232,127,170 - 232,154,435 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	240,538,339 - 240,547,748 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	247,464,818 - 247,466,883 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	240,303,024 - 240,305,089 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	252,944,105 - 252,946,170 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	252,944,103 - 252,946,170 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	260,165,590 - 260,167,655 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	238,609,171 - 238,611,236 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	238,773,058 - 238,775,125 (+)	NCBI
Celera	1	229,265,082 - 229,267,147 (+)	NCBI		Celera
Cytogenetic Map	1	q53	NCBI

IFIT1B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	89,378,056 - 89,385,205 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	89,378,056 - 89,385,205 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	10	91,137,813 - 91,144,962 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	91,127,793 - 91,134,942 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	10	91,127,792 - 91,134,941	NCBI
Celera	10	84,884,634 - 84,891,783 (+)	NCBI		Celera
Cytogenetic Map	10	q23.31	NCBI
HuRef	10	84,771,999 - 84,779,148 (+)	NCBI		HuRef
CHM1_1	10	91,419,874 - 91,427,023 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	10	90,261,914 - 90,269,063 (+)	NCBI		T2T-CHM13v2.0

Ifit1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	34,618,289 - 34,627,409 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	34,618,271 - 34,627,409 (+)	Ensembl		GRCm39 Ensembl
GRCm38	19	34,640,889 - 34,650,009 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	34,640,871 - 34,650,009 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	19	34,715,379 - 34,724,499 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	19	34,706,911 - 34,715,477 (+)	NCBI		MGSCv36	mm8
Celera	19	35,415,203 - 35,424,323 (+)	NCBI		Celera
Cytogenetic Map	19	C1	NCBI
cM Map	19	29.78	NCBI

LOC100977291
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	101,393,967 - 101,403,509 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	101,399,281 - 101,408,823 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	86,094,636 - 86,109,924 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	89,634,232 - 89,649,517 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	89,648,070 - 89,649,517 (+)	Ensembl	panpan1.1		panPan2

IFIT1B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	82,771,077 - 82,778,696 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	43,445,035 - 43,453,357 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

.

Variants in Ifit1
9 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	16
Count of miRNA genes:	16
Interacting mature miRNAs:	16
Transcripts:	ENSRNOT00000025770
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8693637	Alc29	Alcohol consumption QTL 29	2.7	0.258	drinking behavior trait (VT:0001422)	calculated ethanol drink intake rate (CMO:0001615)	1	207987464	234238494	Rat
1578778	Pur4	Proteinuria QTL 4	3.3	0.003	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	1	150700247	252085048	Rat
1354646	Kidm18	Kidney mass QTL 18	5.7		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	151162512	256448636	Rat
1357335	Bw39	Body weight QTL 39	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	1	197814409	242814409	Rat
2302375	Bw83	Body weight QTL 83	4.87	0.0002	body mass (VT:0001259)	body weight (CMO:0000012)	1	197697768	242697768	Rat
1354652	Kidm20	Kidney mass QTL 20	4.3		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	177227632	256448636	Rat
2293674	Bss39	Bone structure and strength QTL 39	7.1	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	1	201554356	246554356	Rat
2302378	Insul11	Insulin level QTL 11	3.25		blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	144267353	251128347	Rat
61455	Niddm7	Non-insulin dependent diabetes mellitus QTL 7	5.5		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	214537555	238757011	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	216255568	260522016	Rat
1600392	Bw123	Body weight QTL 123		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	223201027	260522016	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
1578763	Kidm29	Kidney mass QTL 29	3.3	0.0001	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	1	179567751	260522016	Rat
1600395	Niddm69	Non-insulin dependent diabetes mellitus QTL 69	4.14	0.0002	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	1	195804352	257091168	Rat
1354624	Cm35	Cardiac mass QTL35	5.7		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	177227632	256448636	Rat
1600396	Niddm68	Non-insulin dependent diabetes mellitus QTL 68	4.97	0.0003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	206081677	251081677	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	153136852	260522016	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
1600388	Niddm67	Non-insulin dependent diabetes mellitus QTL 67	5.84	0.000004	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	195804352	257091168	Rat
2293694	Bss38	Bone structure and strength QTL 38	7.05	0.0001	femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	1	201554356	246554356	Rat
1578759	Uae30	Urinary albumin excretion QTL 30	3.3	0.003	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	150700247	252085048	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	228581588	259647894	Rat
8655655	Arrd2	Age-related retinal degeneration QTL 2	7.79		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	183970203	243914901	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	224054293	260122809	Rat
1358898	Bp255	Blood pressure QTL 255	3.6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	191019702	246062233	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	225126575	260522016	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	224054293	260122809	Rat
2300175	Bmd40	Bone mineral density QTL 40	15.4	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	1	201554356	246554356	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	221264111	259647894	Rat
1354661	Bw33	Body weight QTL 33	5.2		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
724538	Kidm1	Kidney mass QTL 1	3.2		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	1	213707201	252085212	Rat
2293655	Bss36	Bone structure and strength QTL 36	10.66	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	1	201554356	246554356	Rat
1298084	Thym4	Thymus enlargement QTL 4	10.68		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	1	197814409	242814409	Rat
724531	Uae5	Urinary albumin excretion QTL 5	4		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	1	150700142	252085212	Rat
8552891	Epfw5	Epididymal fat weight QTL 5	4.4		epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	1	193113876	238113876	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	224569538	260122809	Rat
734768	Niddm59	Non-insulin dependent diabetes mellitus QTL 59			body mass (VT:0001259)	body weight (CMO:0000012)	1	213843987	258843987	Rat
1358890	Bp259	Blood pressure QTL 259	3.06		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	210702053	260522016	Rat
724533	Rf51	Renal function QTL 51	5.3	0.0002	kidney plasma flow trait (VT:0005524)	renal plasma flow (CMO:0001914)	1	218753816	256448513	Rat
1354580	Scort1	Serum corticosterone level QTL 1	3.4		blood corticosterone amount (VT:0005345)	blood corticosterone level (CMO:0001172)	1	156677124	256448636	Rat
1358292	Cm37	Cardiac mass QTL 37	6.2	8e-07	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	1	196248093	241248093	Rat
61376	Bp42	Blood pressure QTL 42	23.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	197814409	242814409	Rat
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	199050459	259647894	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	214647894	259647894	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	214647894	259647894	Rat
1357399	Bw45	Body weight QTL 45	3.05		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	1	206329708	251329708	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	222363780	260522016	Rat
2316896	Gluco57	Glucose level QTL 57	7.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	228985440	245907899	Rat
1357404	Bw42	Body weight QTL 42	4.49	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	1	206329708	251329708	Rat
10053715	Scort24	Serum corticosterone level QTL 24	2.13	0.0088	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	221414816	260522016	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
1358916	Kidm22	Kidney mass QTL 22	3.32		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	210702053	240947965	Rat
634321	Hc1	Hypercalciuria QTL 1	2.91		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	178810256	240830002	Rat
61400	Niddm1	Non-insulin dependent diabetes mellitus QTL 1	11		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	218753689	245907899	Rat
10059587	Bw173	Body weight QTL 173	3.23	0.025	body mass (VT:0001259)	body weight (CMO:0000012)	1	202069611	247069611	Rat
2292216	Bw80	Body weight QTL 80	3.23	0.0019	body mass (VT:0001259)	body weight (CMO:0000012)	1	213533809	243914901	Rat
2292220	Bp306	Blood pressure QTL 306	3.47	0.00087	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	164310393	243914901	Rat
10059590	Kidm44	Kidney mass QTL 44	3.42	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	1	191033875	236033875	Rat
1641926	Teswt2	Testicular weight QTL 2	2.82		testis mass (VT:1000644)	both testes wet weight (CMO:0000175)	1	197697768	238755659	Rat
631658	Cm7	Cardiac mass QTL 7	5.32	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	1	196248093	241248093	Rat
1354610	Bw34	Body weight QTL 34	4.1		body mass (VT:0001259)	body weight (CMO:0000012)	1	151162512	256448636	Rat
2293700	Bmd27	Bone mineral density QTL 27	6.6	0.0001	femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	224054293	243747962	Rat
2293701	Bmd34	Bone mineral density QTL 34	8.3	0.0001	femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	1	224054293	243747962	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	223262787	260522016	Rat
8655855	Arrd3	Age-related retinal degeneration QTL 3	3.07		lens clarity trait (VT:0001304)	cataract incidence/prevalence measurement (CMO:0001585)	1	183970203	243914901	Rat
1600374	Mcs17	Mammary carcinoma susceptibility QTL 17	3		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	197670404	242670404	Rat
1600363	Hc6	Hypercalciuria QTL 6	2.7		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	1	203995416	244113296	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	176426412	257976495	Rat
1358191	Ept10	Estrogen-induced pituitary tumorigenesis QTL 10	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	192825253	243914732	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	216255568	260522016	Rat
7394701	Uae46	Urinary albumin excretion QTL 46	3.6	0.0056	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	201554356	246554356	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	218748008	257976495	Rat

The following Strains have been annotated to Ifit1

WAG.OXYS-(D1Rat219-D1Rat81)/Nov

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	8	47	71	83	84	54	25	54	4	191	90	53	31	40	30


RefSeq Transcripts	NM_020096	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC098155	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC128768	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ276893	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000025770 ⟹ ENSRNOP00000025770

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	232,127,170 - 232,154,435 (+)	Ensembl
Rnor_6.0 Ensembl	1	252,944,103 - 252,946,170 (+)	Ensembl

RefSeq Acc Id:

NM_020096 ⟹ NP_064481

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	241,565,197 - 241,567,262 (+)	NCBI
mRatBN7.2	1	232,152,038 - 232,154,103 (+)	NCBI
Rnor_6.0	1	252,944,105 - 252,946,170 (+)	NCBI
Rnor_5.0	1	260,165,590 - 260,167,655 (+)	NCBI
RGSC_v3.4	1	238,609,171 - 238,611,236 (+)	RGD
Celera	1	229,265,082 - 229,267,147 (+)	RGD

Sequence:

show sequence

TACGGGGGGGGGGGGGCCAGAGAGCAGAGTCAAGGCCAGTCTCTGAAGAGTCCTCCTCCGCTCTTGAACAGCTACCACCTTCACAGCAACCATGGGAGAGAATGCTGGTGGTGACCAGGTCATGGAGA
ATCTGCTTCAGCTGAGATGTCACTTCACATGGGGCCTGCTCTTCGAAAAAAATGACATACCTGATTTGGAAGTGAGGATCTCAGAGCAGGTCCAGTTCCTTGACATCAAGAACTCACTGGGGATGCAC
AACCTCCAGGCCTACGTGAGACACCTGAAAGGTGAGCAGGAGGAAGCCCTGCAGAGCTTGAAAGAGGCTGAAGCCTTGATCGAGGGAGAGCAGTTGGGCAAGAGAAGCCTGGTGACCTGGGGCAACTG
TGCCTGGGTGCATTACCACAGGGGCAGCTTGGCAGAAGCCCAGATCTACCTGGACAAGGTGGAGAATGTTTGCAGGGAATTCTCAAGTCCCTTCCGCTACAGGATGGAGTGTGCTGAGATAGACTGTG
AGGAAGGCTGGGCCTTGCTGAAGTGTGGAGGAAGTAACTATATGCGAGCCATGGCCTGCTTTGCAAAGGCTCTGCAGGTGGACCCAGAAAACCCTGAGTACAATGCTGGCTATGCAGTTGTGGCCTAT
CGCCAAGATTTCGATGACAACCATGTTTCTCTAGAACCTCTAAGGAAGGCTGTCAGGTTAAATCCAGAAGATCCACACCTTAAAGTTCTCCTTGCTCTAAAGCTTCAGGATTTAGGGGAACAAGATGA
AGCAGAAACACACATTGAAGAAGCCCTCAGCAGCACATCTTGCCAAAGCTATGTCTTTCGCTACGCAGCCAAATATTTCCGCCGGAAAGGTGACATAAACGAAGCTCTTCATCTTCTACACAGGGCCT
TGCAGACGTCACCTTCCTCTGGCTACCTACATTACCAAAAAGGGCTCTGTTACAAGCAACAGATGATCCAACTGAAGACATCTGGAAACAGGCAGGCCAGAAGGCAGGAGAATATACAGGAATTGGCA
CATCAGGCCATTTGTGAATTTCAAGAGACTTTGAATCTGAGGCCCACATTTGAGATGGCTTACGTTTGCATGGCTGAAATGCAGGCAGAAATTGGCCAATATGAAGAAGCAGAGGGAAATTTCCAGGA
GGCCCTGAACCTCAACAACCTTGTAGCCCACATAGAGCAGGATATTCATTTCCGCTACGGCCGTTCCCAACAATTTCATAAGAAGTCAGAAGACAAGGCAATCACTCACTACTTAAAAGGTCTAAAAC
TAGAAGAGAAGTCCTTTGCCTGGAGGAAACTACTCACAGCTTTGGAGAAAGTGGCTGAAAGACGTGTTCGCCAGAATGTCCGGCTTGTGGAGAGCACCAGCCTTCTTGGACTGGTCTTCAAACTGAAA
GGGCAGGAGATGAAGGCCCTGCTTTACTATGAGAAGGCCCTGAGGCTCTCTGGGGAAATGAACCCTGCATTTTGAATGCAGCTTACCTTTGTGAAGTTAATATACTCACAACTAAGTGTTCTAATGCT
CCCTCCTGACTTCTTTTCCCAGATCTGCTTTGCTGAAATGCCACGTAGCTAAGTACATTTTCTCCTGCGACTTCTTTATGGCTCTCGTGATCCTGTCTAAAGGCACTTTCCCTTCCCTTAAGACACCT
GCTCACTTTAAAGAATCATTGACCCGATTCCTTGGTGTTCCCAACTTCCTTGGTGAGTAACAAAAATCAAGAACCTTTTTCCCCTATGTCTGGGCCTTTGGAACAAATATTTTTTCCCACTGCCAAAT
GTCTTGGACCAAAAAACCTTCGCTGAAAAAGGTTTCGGGTTTTCTTGGTTGTTGTTTTTTCTTTTTTATGTCACAAGAAACACTCATTACCATACAATTTCAGGCAAAACAAATAAGCAAAGAGGAAA
GTTTGAAAGCAAAAGAGGTCACCCTTACTGGAAAAATATTAACAACCAAGAAGACGTTTGGCTTACTGGAGAATTAAAATGAAAACTCTTCTTAGGTAGTAAAGCCTGAAAATTGCATAAGTAACTTC
TTTTAATATTTGAATGCTAAAAATATTCCTTGAAAGTGACCCAGTAACAAATTTGGTAGAGTCTGCTGGTGCCATTGTAAAGGACGCACCTCTATGTTTGCATGGTTTCTTGGTTATCTTTCATCC

hide sequence


Protein RefSeqs	NP_064481	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAB82773	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000025770.3
	ENSRNOP00000099636

RefSeq Acc Id:

NP_064481 ⟸ NM_020096

- UniProtKB:

Q9JJT1 (UniProtKB/TrEMBL), A6I137 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGENAGGDQVMENLLQLRCHFTWGLLFEKNDIPDLEVRISEQVQFLDIKNSLGMHNLQAYVRHLKGEQEEALQSLKEAEALIEGEQLGKRSLVTWGNCAWVHYHRGSLAEAQIYLDKVENVCREFSSP
FRYRMECAEIDCEEGWALLKCGGSNYMRAMACFAKALQVDPENPEYNAGYAVVAYRQDFDDNHVSLEPLRKAVRLNPEDPHLKVLLALKLQDLGEQDEAETHIEEALSSTSCQSYVFRYAAKYFRRKG
DINEALHLLHRALQTSPSSGYLHYQKGLCYKQQMIQLKTSGNRQARRQENIQELAHQAICEFQETLNLRPTFEMAYVCMAEMQAEIGQYEEAEGNFQEALNLNNLVAHIEQDIHFRYGRSQQFHKKSE
DKAITHYLKGLKLEEKSFAWRKLLTALEKVAERRVRQNVRLVESTSLLGLVFKLKGQEMKALLYYEKALRLSGEMNPAF

hide sequence

Ensembl Acc Id:

ENSRNOP00000025770 ⟸ ENSRNOT00000025770

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LPS6-F1-model_v2	AlphaFold	F1LPS6	1-462	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-55867	BioCyc
Ensembl Genes	ENSRNOG00000019050	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000025770.5	UniProtKB/TrEMBL
	ENSRNOT00000132040	ENTREZGENE
Gene3D-CATH	1.25.40.10	UniProtKB/TrEMBL
InterPro	TPR-like_helical	UniProtKB/TrEMBL
	TPR_repeat	UniProtKB/TrEMBL
KEGG Report	rno:56824	UniProtKB/TrEMBL
NCBI Gene	56824	ENTREZGENE
PANTHER	INTERFERON-INDUCED PROTEIN WITH TETRATRICOPEPTIDE REPEATS	UniProtKB/TrEMBL
	INTERFERON-INDUCED PROTEIN WITH TETRATRICOPEPTIDE REPEATS 1	UniProtKB/TrEMBL
PhenoGen	Ifit1	PhenoGen
PROSITE	TPR	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000019050	RatGTEx
SMART	TPR	UniProtKB/TrEMBL
Superfamily-SCOP	SSF48452	UniProtKB/TrEMBL
UniProt	A6I137	ENTREZGENE, UniProtKB/TrEMBL
	F1LPS6_RAT	UniProtKB/TrEMBL
	Q9JJT1	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Ifit1	interferon-induced protein with tetratricopeptide repeats 1	Garg16	glucocorticoid-attenuated response gene 16 product	Symbol and Name updated	1299863	APPROVED
2002-08-07	Garg16	glucocorticoid-attenuated response gene 16 product			Symbol and Name status set to provisional	70820	PROVISIONAL

Note Type	Note	Reference
gene_expression	cloned from the rat microglia and the expression increases by LPS	632685