Symbol:
Ifit1
Name:
interferon-induced protein with tetratricopeptide repeats 1
RGD ID:
620599
Description:
Predicted to enable RNA binding activity. Predicted to be involved in defense response to virus. Predicted to act upstream of or within cellular response to interferon-alpha; cellular response to interferon-beta; and response to bacterium. Predicted to be located in cytoplasm. Predicted to be active in cytosol. Orthologous to several human genes including IFIT1B (interferon induced protein with tetratricopeptide repeats 1B); PARTICIPATES IN hepatitis C pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,7-dihydropurine-6-thione; acetamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
Garg16; glucocorticoid-attenuated response gene 16 product; interferon-induced protein with tetratricopeptide repeats 1-like protein
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Is Marker For:
Strains:
WAG.OXYS-(D1Rat219-D1Rat81 )/Nov
Latest Assembly:
GRCr8 - GRCr8 Assembly
NCBI Annotation Information:
Annotation category: partial on reference assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 241,565,197 - 241,567,262 (+) NCBI GRCr8 mRatBN7.2 1 232,152,038 - 232,154,103 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 232,127,170 - 232,154,435 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 240,538,339 - 240,547,748 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 247,464,818 - 247,466,883 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 240,303,024 - 240,305,089 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 252,944,105 - 252,946,170 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 252,944,103 - 252,946,170 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 260,165,590 - 260,167,655 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 238,609,171 - 238,611,236 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 238,773,058 - 238,775,125 (+) NCBI Celera 1 229,265,082 - 229,267,147 (+) NCBI Celera Cytogenetic Map 1 q53 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - KEGG (archival)
Ifit1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 241,565,197 - 241,567,262 (+) NCBI GRCr8 mRatBN7.2 1 232,152,038 - 232,154,103 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 232,127,170 - 232,154,435 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 240,538,339 - 240,547,748 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 247,464,818 - 247,466,883 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 240,303,024 - 240,305,089 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 252,944,105 - 252,946,170 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 252,944,103 - 252,946,170 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 260,165,590 - 260,167,655 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 238,609,171 - 238,611,236 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 238,773,058 - 238,775,125 (+) NCBI Celera 1 229,265,082 - 229,267,147 (+) NCBI Celera Cytogenetic Map 1 q53 NCBI
IFIT1B (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 89,378,056 - 89,385,205 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 89,378,056 - 89,385,205 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 91,137,813 - 91,144,962 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 91,127,793 - 91,134,942 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 91,127,792 - 91,134,941 NCBI Celera 10 84,884,634 - 84,891,783 (+) NCBI Celera Cytogenetic Map 10 q23.31 NCBI HuRef 10 84,771,999 - 84,779,148 (+) NCBI HuRef CHM1_1 10 91,419,874 - 91,427,023 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 90,261,914 - 90,269,063 (+) NCBI T2T-CHM13v2.0
Ifit1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 34,618,289 - 34,627,409 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 34,618,271 - 34,627,409 (+) Ensembl GRCm39 Ensembl GRCm38 19 34,640,889 - 34,650,009 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 34,640,871 - 34,650,009 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 34,715,379 - 34,724,499 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 34,706,911 - 34,715,477 (+) NCBI MGSCv36 mm8 Celera 19 35,415,203 - 35,424,323 (+) NCBI Celera Cytogenetic Map 19 C1 NCBI cM Map 19 29.78 NCBI
LOC100977291 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 101,393,967 - 101,403,509 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 101,399,281 - 101,408,823 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 86,094,636 - 86,109,924 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 89,634,232 - 89,649,517 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 89,648,070 - 89,649,517 (+) Ensembl panpan1.1 panPan2
IFIT1B (Chlorocebus sabaeus - green monkey)
.
Predicted Target Of
Count of predictions: 16 Count of miRNA genes: 16 Interacting mature miRNAs: 16 Transcripts: ENSRNOT00000025770 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
8693637 Alc29 Alcohol consumption QTL 29 2.7 0.258 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 1 207987464 234238494 Rat 1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 61455 Niddm7 Non-insulin dependent diabetes mellitus QTL 7 5.5 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 214537555 238757011 Rat 61327 Eae7 Experimental allergic encephalomyelitis QTL 7 5.6 body mass (VT:0001259) change in body weight (CMO:0002045) 1 216255568 260522016 Rat 1600392 Bw123 Body weight QTL 123 0.001 body mass (VT:0001259) body weight (CMO:0000012) 1 223201027 260522016 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 1300108 Rf8 Renal function QTL 8 3.75 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 1 228581588 259647894 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 734767 Niddm57 Non-insulin dependent diabetes mellitus QTL 57 body mass (VT:0001259) body weight (CMO:0000012) 1 224054293 260122809 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631215 Stl8 Serum triglyceride level QTL 8 9.27 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 1 225126575 260522016 Rat 631843 Bw116 Body weight QTL 116 4.1 0.016 abdominal adipose amount (VT:1000220) abdominal fat pad weight (CMO:0000088) 1 224054293 260122809 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 731175 Uae20 Urinary albumin excretion QTL 20 3.5 0.0018 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 221264111 259647894 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 724538 Kidm1 Kidney mass QTL 1 3.2 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 213707201 252085212 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 734769 Niddm58 Non-insulin dependent diabetes mellitus QTL 58 body mass (VT:0001259) body weight (CMO:0000012) 1 224569538 260122809 Rat 734768 Niddm59 Non-insulin dependent diabetes mellitus QTL 59 body mass (VT:0001259) body weight (CMO:0000012) 1 213843987 258843987 Rat 1358890 Bp259 Blood pressure QTL 259 3.06 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 210702053 260522016 Rat 724533 Rf51 Renal function QTL 51 5.3 0.0002 kidney plasma flow trait (VT:0005524) renal plasma flow (CMO:0001914) 1 218753816 256448513 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 1549910 Bw54 Body weight QTL 54 0.05 body mass (VT:0001259) body weight (CMO:0000012) 1 214647894 259647894 Rat 70211 Niddm24 Non-insulin dependent diabetes mellitus QTL 24 3.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 214647894 259647894 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724552 Glom2 Glomerulus QTL 2 3.3 0.0001 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli directly contacting the kidney surface (CMO:0001001) 1 222363780 260522016 Rat 2316896 Gluco57 Glucose level QTL 57 7.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 228985440 245907899 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10053715 Scort24 Serum corticosterone level QTL 24 2.13 0.0088 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 1 221414816 260522016 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 1358916 Kidm22 Kidney mass QTL 22 3.32 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 210702053 240947965 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 61400 Niddm1 Non-insulin dependent diabetes mellitus QTL 1 11 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 218753689 245907899 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 2292216 Bw80 Body weight QTL 80 3.23 0.0019 body mass (VT:0001259) body weight (CMO:0000012) 1 213533809 243914901 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 2293700 Bmd27 Bone mineral density QTL 27 6.6 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 1 224054293 243747962 Rat 2293701 Bmd34 Bone mineral density QTL 34 8.3 0.0001 femur strength trait (VT:0010010) femoral neck ultimate force (CMO:0001703) 1 224054293 243747962 Rat 7387289 Uae45 Urinary albumin excretion QTL 45 2.86 0.0021 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 223262787 260522016 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 2302040 Pia35 Pristane induced arthritis QTL 35 3.8 0.001 blood immunoglobulin amount (VT:0002460) serum immunoglobulin G1 level (CMO:0002115) 1 216255568 260522016 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat 1598821 Rf55 Renal function QTL 55 6.3 renal blood flow trait (VT:2000006) ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239) 1 218748008 257976495 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
8
47
71
83
84
54
25
54
4
191
90
53
31
40
30
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000025770 ⟹ ENSRNOP00000025770
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 232,127,170 - 232,154,435 (+) Ensembl Rnor_6.0 Ensembl 1 252,944,103 - 252,946,170 (+) Ensembl
RefSeq Acc Id:
NM_020096 ⟹ NP_064481
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 241,565,197 - 241,567,262 (+) NCBI mRatBN7.2 1 232,152,038 - 232,154,103 (+) NCBI Rnor_6.0 1 252,944,105 - 252,946,170 (+) NCBI Rnor_5.0 1 260,165,590 - 260,167,655 (+) NCBI RGSC_v3.4 1 238,609,171 - 238,611,236 (+) RGD Celera 1 229,265,082 - 229,267,147 (+) RGD
Sequence:
TACGGGGGGGGGGGGGCCAGAGAGCAGAGTCAAGGCCAGTCTCTGAAGAGTCCTCCTCCGCTCTTGAACAGCTACCACCTTCACAGCAACCATGGGAGAGAATGCTGGTGGTGACCAGGTCATGGAGA ATCTGCTTCAGCTGAGATGTCACTTCACATGGGGCCTGCTCTTCGAAAAAAATGACATACCTGATTTGGAAGTGAGGATCTCAGAGCAGGTCCAGTTCCTTGACATCAAGAACTCACTGGGGATGCAC AACCTCCAGGCCTACGTGAGACACCTGAAAGGTGAGCAGGAGGAAGCCCTGCAGAGCTTGAAAGAGGCTGAAGCCTTGATCGAGGGAGAGCAGTTGGGCAAGAGAAGCCTGGTGACCTGGGGCAACTG TGCCTGGGTGCATTACCACAGGGGCAGCTTGGCAGAAGCCCAGATCTACCTGGACAAGGTGGAGAATGTTTGCAGGGAATTCTCAAGTCCCTTCCGCTACAGGATGGAGTGTGCTGAGATAGACTGTG AGGAAGGCTGGGCCTTGCTGAAGTGTGGAGGAAGTAACTATATGCGAGCCATGGCCTGCTTTGCAAAGGCTCTGCAGGTGGACCCAGAAAACCCTGAGTACAATGCTGGCTATGCAGTTGTGGCCTAT CGCCAAGATTTCGATGACAACCATGTTTCTCTAGAACCTCTAAGGAAGGCTGTCAGGTTAAATCCAGAAGATCCACACCTTAAAGTTCTCCTTGCTCTAAAGCTTCAGGATTTAGGGGAACAAGATGA AGCAGAAACACACATTGAAGAAGCCCTCAGCAGCACATCTTGCCAAAGCTATGTCTTTCGCTACGCAGCCAAATATTTCCGCCGGAAAGGTGACATAAACGAAGCTCTTCATCTTCTACACAGGGCCT TGCAGACGTCACCTTCCTCTGGCTACCTACATTACCAAAAAGGGCTCTGTTACAAGCAACAGATGATCCAACTGAAGACATCTGGAAACAGGCAGGCCAGAAGGCAGGAGAATATACAGGAATTGGCA CATCAGGCCATTTGTGAATTTCAAGAGACTTTGAATCTGAGGCCCACATTTGAGATGGCTTACGTTTGCATGGCTGAAATGCAGGCAGAAATTGGCCAATATGAAGAAGCAGAGGGAAATTTCCAGGA GGCCCTGAACCTCAACAACCTTGTAGCCCACATAGAGCAGGATATTCATTTCCGCTACGGCCGTTCCCAACAATTTCATAAGAAGTCAGAAGACAAGGCAATCACTCACTACTTAAAAGGTCTAAAAC TAGAAGAGAAGTCCTTTGCCTGGAGGAAACTACTCACAGCTTTGGAGAAAGTGGCTGAAAGACGTGTTCGCCAGAATGTCCGGCTTGTGGAGAGCACCAGCCTTCTTGGACTGGTCTTCAAACTGAAA GGGCAGGAGATGAAGGCCCTGCTTTACTATGAGAAGGCCCTGAGGCTCTCTGGGGAAATGAACCCTGCATTTTGAATGCAGCTTACCTTTGTGAAGTTAATATACTCACAACTAAGTGTTCTAATGCT CCCTCCTGACTTCTTTTCCCAGATCTGCTTTGCTGAAATGCCACGTAGCTAAGTACATTTTCTCCTGCGACTTCTTTATGGCTCTCGTGATCCTGTCTAAAGGCACTTTCCCTTCCCTTAAGACACCT GCTCACTTTAAAGAATCATTGACCCGATTCCTTGGTGTTCCCAACTTCCTTGGTGAGTAACAAAAATCAAGAACCTTTTTCCCCTATGTCTGGGCCTTTGGAACAAATATTTTTTCCCACTGCCAAAT GTCTTGGACCAAAAAACCTTCGCTGAAAAAGGTTTCGGGTTTTCTTGGTTGTTGTTTTTTCTTTTTTATGTCACAAGAAACACTCATTACCATACAATTTCAGGCAAAACAAATAAGCAAAGAGGAAA GTTTGAAAGCAAAAGAGGTCACCCTTACTGGAAAAATATTAACAACCAAGAAGACGTTTGGCTTACTGGAGAATTAAAATGAAAACTCTTCTTAGGTAGTAAAGCCTGAAAATTGCATAAGTAACTTC TTTTAATATTTGAATGCTAAAAATATTCCTTGAAAGTGACCCAGTAACAAATTTGGTAGAGTCTGCTGGTGCCATTGTAAAGGACGCACCTCTATGTTTGCATGGTTTCTTGGTTATCTTTCATCC
hide sequence
RefSeq Acc Id:
NP_064481 ⟸ NM_020096
- UniProtKB:
Q9JJT1 (UniProtKB/TrEMBL), A6I137 (UniProtKB/TrEMBL)
- Sequence:
MGENAGGDQVMENLLQLRCHFTWGLLFEKNDIPDLEVRISEQVQFLDIKNSLGMHNLQAYVRHLKGEQEEALQSLKEAEALIEGEQLGKRSLVTWGNCAWVHYHRGSLAEAQIYLDKVENVCREFSSP FRYRMECAEIDCEEGWALLKCGGSNYMRAMACFAKALQVDPENPEYNAGYAVVAYRQDFDDNHVSLEPLRKAVRLNPEDPHLKVLLALKLQDLGEQDEAETHIEEALSSTSCQSYVFRYAAKYFRRKG DINEALHLLHRALQTSPSSGYLHYQKGLCYKQQMIQLKTSGNRQARRQENIQELAHQAICEFQETLNLRPTFEMAYVCMAEMQAEIGQYEEAEGNFQEALNLNNLVAHIEQDIHFRYGRSQQFHKKSE DKAITHYLKGLKLEEKSFAWRKLLTALEKVAERRVRQNVRLVESTSLLGLVFKLKGQEMKALLYYEKALRLSGEMNPAF
hide sequence
Ensembl Acc Id:
ENSRNOP00000025770 ⟸ ENSRNOT00000025770
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Ifit1
interferon-induced protein with tetratricopeptide repeats 1
Garg16
glucocorticoid-attenuated response gene 16 product
Symbol and Name updated
1299863
APPROVED
2002-08-07
Garg16
glucocorticoid-attenuated response gene 16 product
Symbol and Name status set to provisional
70820
PROVISIONAL
Note Type
Note
Reference
gene_expression
cloned from the rat microglia and the expression increases by LPS
632685