Symbol:
Sort1
Name:
sortilin 1
RGD ID:
619999
Description:
Predicted to enable several functions, including nerve growth factor binding activity; nerve growth factor receptor activity; and neurotensin receptor activity, non-G protein-coupled. Involved in positive regulation of epithelial cell apoptotic process. Located in dendrite and neuronal cell body. Human ortholog(s) of this gene implicated in abdominal aortic aneurysm. Orthologous to human SORT1 (sortilin 1); PARTICIPATES IN neurotrophic factor signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
glycoprotein 110; gp110; neurotensin receptor 3; Nt3; NTR3; Nts3; sortilin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SORT1 (sortilin 1) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):
Sort1 (sortilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Sort1 (sortilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SORT1 (sortilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SORT1 (sortilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Sort1 (sortilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SORT1 (sortilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SORT1 (sortilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Sort1 (sortilin 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
SORT1 (sortilin 1)
Alliance
DIOPT (HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Sort1 (sortilin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sort1a (sortilin 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
sort1b (sortilin 1b)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PEP1
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
VTH1
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
VTH2
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
YNR065C
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
YCR099C
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):
sort1
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 198,609,466 - 198,690,481 (+) NCBI GRCr8 mRatBN7.2 2 195,924,033 - 196,002,354 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 195,924,099 - 196,002,354 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 203,567,532 - 203,645,624 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 201,449,641 - 201,527,742 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 196,266,598 - 196,344,698 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 211,078,092 - 211,156,312 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 211,078,334 - 211,156,312 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 230,546,773 - 230,626,278 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 203,853,009 - 203,931,559 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 203,816,049 - 203,890,296 (+) NCBI Celera 2 188,569,202 - 188,647,900 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sort1 Rat (1->4)-beta-D-glucan multiple interactions ISO Sort1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SORT1 mRNA CTD PMID:36331819 Sort1 Rat 1,2-dimethylhydrazine decreases expression ISO Sort1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SORT1 mRNA CTD PMID:22206623 Sort1 Rat 17beta-estradiol decreases expression ISO Sort1 (Mus musculus) 6480464 Estradiol results in decreased expression of SORT1 mRNA CTD PMID:19484750 Sort1 Rat 17beta-estradiol increases expression ISO Sort1 (Mus musculus) 6480464 Estradiol results in increased expression of SORT1 mRNA and Estradiol results in increased expression of SORT1 protein CTD PMID:28476547 and PMID:39298647 Sort1 Rat 17beta-estradiol multiple interactions ISO Sort1 (Mus musculus) 6480464 bisphenol A inhibits the reaction [Estradiol results in increased expression of SORT1 mRNA] CTD PMID:28476547 Sort1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Sort1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SORT1 mRNA CTD PMID:21570461 more ... Sort1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of SORT1 mRNA CTD PMID:33387578 Sort1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SORT1 mRNA CTD PMID:34747641 Sort1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Sort1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of SORT1 mRNA CTD PMID:26290441 Sort1 Rat 2-hydroxypropanoic acid decreases expression ISO SORT1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SORT1 mRNA CTD PMID:30851411 Sort1 Rat 2-methylcholine affects expression ISO SORT1 (Homo sapiens) 6480464 beta-methylcholine affects the expression of SORT1 mRNA CTD PMID:21179406 Sort1 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Sort1 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of SORT1 mRNA CTD PMID:20188158 Sort1 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of SORT1 mRNA CTD PMID:28522335 Sort1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO SORT1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of SORT1 mRNA CTD PMID:28628672 Sort1 Rat 4,4'-diaminodiphenylmethane increases expression ISO Sort1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of SORT1 mRNA CTD PMID:18648102 Sort1 Rat 4,4'-sulfonyldiphenol affects expression ISO Sort1 (Mus musculus) 6480464 bisphenol S affects the expression of SORT1 mRNA CTD PMID:39298647 Sort1 Rat 4-hydroxyphenyl retinamide decreases expression ISO Sort1 (Mus musculus) 6480464 Fenretinide results in decreased expression of SORT1 mRNA CTD PMID:28973697 Sort1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of SORT1 mRNA CTD PMID:24780913 Sort1 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of SORT1 mRNA CTD PMID:28959563 Sort1 Rat aflatoxin B1 decreases expression ISO Sort1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of SORT1 mRNA CTD PMID:19770486 Sort1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of SORT1 mRNA CTD PMID:23630614 and PMID:25378103 Sort1 Rat all-trans-retinoic acid increases expression ISO SORT1 (Homo sapiens) 6480464 Tretinoin results in increased expression of SORT1 mRNA CTD PMID:33167477 Sort1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SORT1 mRNA CTD PMID:16483693 Sort1 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of SORT1 mRNA CTD PMID:30779732 Sort1 Rat aristolochic acid A decreases expression ISO SORT1 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of SORT1 mRNA CTD PMID:33212167 Sort1 Rat bafilomycin A1 decreases expression ISO Sort1 (Mus musculus) 6480464 bafilomycin A1 results in decreased expression of SORT1 protein CTD PMID:25805502 Sort1 Rat benzo[a]pyrene increases expression ISO Sort1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SORT1 mRNA CTD PMID:22228805 Sort1 Rat benzo[a]pyrene increases methylation ISO SORT1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SORT1 3' UTR CTD PMID:27901495 Sort1 Rat benzo[a]pyrene affects methylation ISO SORT1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SORT1 promoter CTD PMID:27901495 Sort1 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of SORT1 mRNA CTD PMID:18164116 Sort1 Rat bisphenol A multiple interactions ISO Sort1 (Mus musculus) 6480464 bisphenol A inhibits the reaction [Estradiol results in increased expression of SORT1 mRNA] CTD PMID:28476547 Sort1 Rat bisphenol A increases expression ISO SORT1 (Homo sapiens) 6480464 bisphenol A results in increased expression of SORT1 mRNA and bisphenol A results in increased expression of SORT1 protein CTD PMID:34186270 and PMID:36232920 Sort1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SORT1 mRNA CTD PMID:30816183 and PMID:32528016 Sort1 Rat bisphenol A affects expression ISO SORT1 (Homo sapiens) 6480464 bisphenol A affects the expression of SORT1 mRNA CTD PMID:30903817 Sort1 Rat bisphenol A increases expression ISO Sort1 (Mus musculus) 6480464 bisphenol A results in increased expression of SORT1 mRNA CTD PMID:28476547 and PMID:33221593 Sort1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SORT1 mRNA CTD PMID:25181051 Sort1 Rat bisphenol AF increases expression ISO SORT1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of SORT1 protein CTD PMID:34186270 Sort1 Rat Bisphenol B increases expression ISO SORT1 (Homo sapiens) 6480464 bisphenol B results in increased expression of SORT1 protein CTD PMID:34186270 Sort1 Rat bisphenol F increases expression ISO SORT1 (Homo sapiens) 6480464 bisphenol F results in increased expression of SORT1 protein CTD PMID:34186270 Sort1 Rat butan-1-ol multiple interactions ISO SORT1 (Homo sapiens) 6480464 [[Gasoline co-treated with 1-Butanol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of SORT1 mRNA CTD PMID:29432896 Sort1 Rat butanal decreases expression ISO SORT1 (Homo sapiens) 6480464 butyraldehyde results in decreased expression of SORT1 mRNA CTD PMID:26079696 Sort1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of SORT1 mRNA CTD PMID:33453195 Sort1 Rat cannabidiol increases expression ISO SORT1 (Homo sapiens) 6480464 Cannabidiol results in increased expression of SORT1 protein CTD PMID:34122009 Sort1 Rat carbon nanotube decreases expression ISO Sort1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Sort1 Rat chloroquine decreases expression ISO Sort1 (Mus musculus) 6480464 Chloroquine results in decreased expression of SORT1 protein CTD PMID:25805502 Sort1 Rat chloroquine multiple interactions ISO Sort1 (Mus musculus) 6480464 Chloroquine affects the reaction [SORT1 protein affects the reaction [LDLR protein affects the abundance of Cholesterol]] CTD PMID:30950489 Sort1 Rat chlorpyrifos decreases expression ISO Sort1 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of SORT1 mRNA CTD PMID:32715474 Sort1 Rat cholesterol multiple interactions ISO Sort1 (Mus musculus) 6480464 Chloroquine affects the reaction [SORT1 protein affects the reaction [LDLR protein affects the abundance of Cholesterol]] and SORT1 protein affects the reaction [LDLR protein affects the abundance of Cholesterol] CTD PMID:30950489 Sort1 Rat cholesterol decreases abundance ISO Sort1 (Mus musculus) 6480464 SORT1 protein results in decreased abundance of Cholesterol CTD PMID:25805502 Sort1 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of SORT1 mRNA CTD PMID:24386269 Sort1 Rat cobalt dichloride decreases expression ISO SORT1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of SORT1 mRNA CTD PMID:19320972 Sort1 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of SORT1 mRNA CTD PMID:30556269 Sort1 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of SORT1 mRNA CTD PMID:30556269 Sort1 Rat copper(II) chloride decreases expression ISO SORT1 (Homo sapiens) 6480464 cupric chloride results in decreased expression of SORT1 mRNA CTD PMID:38568856 Sort1 Rat cycloheximide multiple interactions ISO SORT1 (Homo sapiens) 6480464 Cycloheximide promotes the reaction [Palmitic Acid results in increased degradation of SORT1 protein] and Docosahexaenoic Acids inhibits the reaction [Cycloheximide promotes the reaction [Palmitic Acid results in increased degradation of SORT1 protein]] CTD PMID:24986865 Sort1 Rat cycloheximide increases degradation ISO Sort1 (Mus musculus) 6480464 Cycloheximide results in increased degradation of SORT1 protein mutant form CTD PMID:25805502 Sort1 Rat cycloheximide multiple interactions EXP 6480464 SORT1 mutant form inhibits the reaction [Pentanoic Acids results in decreased susceptibility to [TNF protein co-treated with Cycloheximide]] and SORT1 mutant form inhibits the reaction [sodium arsenite results in decreased susceptibility to [TNF protein co-treated with Cycloheximide]] CTD PMID:22555848 Sort1 Rat cyclosporin A decreases expression ISO SORT1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SORT1 mRNA CTD PMID:20106945 and PMID:25562108 Sort1 Rat DDE decreases expression ISO SORT1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of SORT1 mRNA CTD PMID:38568856 Sort1 Rat dexamethasone increases expression ISO SORT1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of SORT1 mRNA CTD PMID:25047013 Sort1 Rat dexamethasone multiple interactions ISO SORT1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of SORT1 mRNA CTD PMID:28628672 Sort1 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of SORT1 mRNA CTD PMID:21266533 Sort1 Rat dioxygen multiple interactions ISO Sort1 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of SORT1 mRNA CTD PMID:30529165 Sort1 Rat disodium selenite increases expression ISO SORT1 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of SORT1 mRNA CTD PMID:18514395 Sort1 Rat doxorubicin affects response to substance ISO SORT1 (Homo sapiens) 6480464 SORT1 protein affects the susceptibility to Doxorubicin CTD PMID:16217747 Sort1 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of SORT1 mRNA CTD PMID:29391264 Sort1 Rat ethanol multiple interactions ISO Sort1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of SORT1 mRNA CTD PMID:30517762 Sort1 Rat ethanol affects splicing ISO Sort1 (Mus musculus) 6480464 Ethanol affects the splicing of SORT1 mRNA CTD PMID:30319688 Sort1 Rat etoposide affects response to substance ISO SORT1 (Homo sapiens) 6480464 SORT1 protein affects the susceptibility to Etoposide CTD PMID:16217747 Sort1 Rat fenofibrate increases expression ISO Sort1 (Mus musculus) 6480464 Fenofibrate results in increased expression of SORT1 mRNA CTD PMID:24986865 Sort1 Rat fenthion decreases expression ISO Sort1 (Mus musculus) 6480464 Fenthion results in decreased expression of SORT1 mRNA CTD PMID:34813904 Sort1 Rat FR900359 affects phosphorylation ISO SORT1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of SORT1 protein CTD PMID:37730182 Sort1 Rat furan increases expression EXP 6480464 furan results in increased expression of SORT1 mRNA CTD PMID:25539665 more ... Sort1 Rat hexadecanoic acid increases phosphorylation ISO SORT1 (Homo sapiens) 6480464 Palmitic Acid results in increased phosphorylation of SORT1 protein CTD PMID:24986865 Sort1 Rat hexadecanoic acid multiple interactions ISO SORT1 (Homo sapiens) 6480464 Cycloheximide promotes the reaction [Palmitic Acid results in increased degradation of SORT1 protein] more ... CTD PMID:24986865 Sort1 Rat hexadecanoic acid increases degradation ISO SORT1 (Homo sapiens) 6480464 Palmitic Acid results in increased degradation of SORT1 protein CTD PMID:24986865 Sort1 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of SORT1 mRNA CTD PMID:21396975 Sort1 Rat indometacin multiple interactions ISO SORT1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of SORT1 mRNA CTD PMID:28628672 Sort1 Rat inulin multiple interactions ISO Sort1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of SORT1 mRNA CTD PMID:36331819 Sort1 Rat iron atom increases expression ISO SORT1 (Homo sapiens) 6480464 Iron deficiency results in increased expression of SORT1 mRNA CTD PMID:20368581 Sort1 Rat iron(0) increases expression ISO SORT1 (Homo sapiens) 6480464 Iron deficiency results in increased expression of SORT1 mRNA CTD PMID:20368581 Sort1 Rat isotretinoin decreases expression ISO SORT1 (Homo sapiens) 6480464 Isotretinoin results in decreased expression of SORT1 mRNA CTD PMID:20436886 Sort1 Rat ivermectin decreases expression ISO SORT1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of SORT1 protein CTD PMID:32959892 Sort1 Rat L-ascorbic acid increases expression ISO Sort1 (Mus musculus) 6480464 Ascorbic Acid results in increased expression of SORT1 mRNA CTD PMID:15305145 Sort1 Rat lead(0) multiple interactions ISO Sort1 (Mus musculus) 6480464 Lead inhibits the reaction [TARDBP protein affects the splicing of SORT1 mRNA] CTD PMID:30371865 Sort1 Rat lipopolysaccharide multiple interactions ISO SORT1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of SORT1 mRNA CTD PMID:35811015 Sort1 Rat manganese atom decreases expression ISO SORT1 (Homo sapiens) 6480464 Manganese results in decreased expression of SORT1 mRNA CTD PMID:17175027 Sort1 Rat manganese(0) decreases expression ISO SORT1 (Homo sapiens) 6480464 Manganese results in decreased expression of SORT1 mRNA CTD PMID:17175027 Sort1 Rat manganese(II) chloride decreases expression ISO SORT1 (Homo sapiens) 6480464 manganese chloride results in decreased expression of SORT1 mRNA CTD PMID:17175027 Sort1 Rat methotrexate affects expression ISO Sort1 (Mus musculus) 6480464 Methotrexate affects the expression of SORT1 mRNA CTD PMID:18502557 Sort1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of SORT1 gene CTD PMID:35440735 Sort1 Rat mitomycin C affects response to substance ISO SORT1 (Homo sapiens) 6480464 SORT1 protein affects the susceptibility to Mitomycin CTD PMID:16217747 Sort1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Sort1 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [tetrabromocinnamic acid results in increased degradation of SORT1 protein] and benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [wortmannin results in increased degradation of SORT1 protein] CTD PMID:25805502 Sort1 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases expression ISO Sort1 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased expression of SORT1 protein CTD PMID:25805502 Sort1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of SORT1 mRNA CTD PMID:18164116 Sort1 Rat nickel atom decreases expression ISO SORT1 (Homo sapiens) 6480464 Nickel results in decreased expression of SORT1 mRNA CTD PMID:25583101 Sort1 Rat orphenadrine affects expression EXP 6480464 Orphenadrine affects the expression of SORT1 mRNA CTD PMID:23665939 Sort1 Rat ozone multiple interactions ISO Sort1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of SORT1 mRNA CTD PMID:34911549 Sort1 Rat p-toluidine increases expression EXP 6480464 4-toluidine results in increased expression of SORT1 mRNA CTD PMID:27638505 Sort1 Rat paracetamol affects expression ISO Sort1 (Mus musculus) 6480464 Acetaminophen affects the expression of SORT1 mRNA CTD PMID:17562736 Sort1 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of SORT1 mRNA CTD PMID:33387578 Sort1 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of SORT1 mRNA CTD PMID:32680482 Sort1 Rat pentachlorophenol increases expression ISO Sort1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of SORT1 mRNA CTD PMID:23892564 Sort1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Sort1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of SORT1 mRNA more ... CTD PMID:36331819 Sort1 Rat perfluorooctanoic acid decreases expression ISO SORT1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of SORT1 protein CTD PMID:26879310 Sort1 Rat perfluorooctanoic acid decreases expression ISO Sort1 (Mus musculus) 6480464 perfluorooctanoic acid results in decreased expression of SORT1 mRNA CTD PMID:30657992 Sort1 Rat phosgene affects expression ISO Sort1 (Mus musculus) 6480464 Phosgene affects the expression of SORT1 mRNA CTD PMID:16300373 Sort1 Rat pirinixic acid decreases expression ISO Sort1 (Mus musculus) 6480464 pirinixic acid results in decreased expression of SORT1 mRNA CTD PMID:17426115 Sort1 Rat progesterone increases expression ISO SORT1 (Homo sapiens) 6480464 Progesterone results in increased expression of SORT1 mRNA CTD PMID:20864642 Sort1 Rat protein kinase inhibitor multiple interactions ISO SORT1 (Homo sapiens) 6480464 Protein Kinase Inhibitors inhibits the reaction [gardiquimod results in increased expression of SORT1 mRNA] CTD PMID:28003376 Sort1 Rat PX-866 decreases expression ISO Sort1 (Mus musculus) 6480464 PX-866 results in decreased expression of SORT1 protein CTD PMID:25805502 Sort1 Rat PX-866 multiple interactions ISO Sort1 (Mus musculus) 6480464 [PX-866 co-treated with SORT1 protein] results in decreased expression of CD36 mRNA more ... CTD PMID:25805502 Sort1 Rat rac-lactic acid decreases expression ISO SORT1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of SORT1 mRNA CTD PMID:30851411 Sort1 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO SORT1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of SORT1 mRNA CTD PMID:35811015 Sort1 Rat Se-methyl-L-selenocysteine increases expression ISO SORT1 (Homo sapiens) 6480464 selenomethylselenocysteine results in increased expression of SORT1 mRNA CTD PMID:18514395 Sort1 Rat Se-methylselenocysteine increases expression ISO SORT1 (Homo sapiens) 6480464 selenomethylselenocysteine results in increased expression of SORT1 mRNA CTD PMID:18514395 Sort1 Rat silicon dioxide decreases expression ISO SORT1 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of SORT1 mRNA CTD PMID:25895662 Sort1 Rat sodium arsenite multiple interactions EXP 6480464 SORT1 mutant form inhibits the reaction [sodium arsenite results in decreased susceptibility to [TNF protein co-treated with Cycloheximide]] CTD PMID:22555848 Sort1 Rat streptozocin decreases expression ISO Sort1 (Mus musculus) 6480464 Streptozocin results in decreased expression of SORT1 protein CTD PMID:25805502 Sort1 Rat taurocholic acid increases sulfation ISO Sort1 (Mus musculus) 6480464 SORT1 gene mutant form results in increased sulfation of Taurocholic Acid CTD PMID:28453831 Sort1 Rat temozolomide increases expression ISO SORT1 (Homo sapiens) 6480464 Temozolomide results in increased expression of SORT1 mRNA CTD PMID:31758290 Sort1 Rat testosterone increases expression ISO SORT1 (Homo sapiens) 6480464 Testosterone results in increased expression of SORT1 mRNA CTD PMID:21475673 Sort1 Rat tetrachloromethane multiple interactions ISO Sort1 (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in decreased expression of SORT1 mRNA CTD PMID:30517762 Sort1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of SORT1 mRNA CTD PMID:23411599 Sort1 Rat titanium dioxide increases expression ISO Sort1 (Mus musculus) 6480464 titanium dioxide results in increased expression of SORT1 mRNA CTD PMID:29264374 Sort1 Rat titanium dioxide increases methylation ISO Sort1 (Mus musculus) 6480464 titanium dioxide results in increased methylation of SORT1 promoter CTD PMID:35295148 Sort1 Rat titanium dioxide decreases expression ISO Sort1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of SORT1 mRNA CTD PMID:35295148 Sort1 Rat trichostatin A decreases expression ISO SORT1 (Homo sapiens) 6480464 trichostatin A results in decreased expression of SORT1 mRNA CTD PMID:24935251 Sort1 Rat trichostatin A affects expression ISO SORT1 (Homo sapiens) 6480464 trichostatin A affects the expression of SORT1 mRNA CTD PMID:28542535 Sort1 Rat triptonide increases expression ISO Sort1 (Mus musculus) 6480464 triptonide results in increased expression of SORT1 mRNA CTD PMID:33045310 Sort1 Rat troglitazone decreases expression ISO SORT1 (Homo sapiens) 6480464 troglitazone results in decreased expression of SORT1 mRNA CTD PMID:19140230 Sort1 Rat tungsten decreases expression ISO Sort1 (Mus musculus) 6480464 Tungsten results in decreased expression of SORT1 mRNA CTD PMID:30912803 Sort1 Rat valproic acid affects expression ISO Sort1 (Mus musculus) 6480464 Valproic Acid affects the expression of SORT1 mRNA CTD PMID:17292431 and PMID:17963808 Sort1 Rat valproic acid affects expression ISO SORT1 (Homo sapiens) 6480464 Valproic Acid affects the expression of SORT1 mRNA CTD PMID:25979313 Sort1 Rat valproic acid increases methylation ISO SORT1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SORT1 gene CTD PMID:29154799 Sort1 Rat valproic acid increases expression ISO SORT1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of SORT1 mRNA CTD PMID:23179753 Sort1 Rat vincaleukoblastine affects response to substance ISO SORT1 (Homo sapiens) 6480464 SORT1 protein affects the susceptibility to Vinblastine CTD PMID:16217747 Sort1 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of SORT1 mRNA CTD PMID:23034163 Sort1 Rat vitamin E decreases expression ISO SORT1 (Homo sapiens) 6480464 Vitamin E results in decreased expression of SORT1 mRNA CTD PMID:19244175 Sort1 Rat wortmannin multiple interactions ISO Sort1 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [wortmannin results in increased degradation of SORT1 protein] more ... CTD PMID:25805502 Sort1 Rat wortmannin increases ubiquitination ISO Sort1 (Mus musculus) 6480464 wortmannin results in increased ubiquitination of SORT1 protein CTD PMID:25805502 Sort1 Rat Yessotoxin increases expression ISO SORT1 (Homo sapiens) 6480464 yessotoxin analog results in increased expression of SORT1 mRNA CTD PMID:30679557 Sort1 Rat zinc atom increases expression ISO SORT1 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of SORT1 mRNA CTD PMID:22171008 Sort1 Rat zinc(0) increases expression ISO SORT1 (Homo sapiens) 6480464 Zinc deficiency results in increased expression of SORT1 mRNA CTD PMID:22171008
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aflatoxin B1 (EXP,ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) amphetamine (EXP) aristolochic acid A (ISO) bafilomycin A1 (ISO) benzo[a]pyrene (ISO) beta-naphthoflavone (EXP) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) butan-1-ol (ISO) butanal (ISO) cadmium dichloride (EXP) cannabidiol (ISO) carbon nanotube (ISO) chloroquine (ISO) chlorpyrifos (ISO) cholesterol (ISO) cobalt dichloride (EXP,ISO) copper atom (EXP) copper(0) (EXP) copper(II) chloride (ISO) cycloheximide (EXP,ISO) cyclosporin A (ISO) DDE (ISO) dexamethasone (ISO) dibutyl phthalate (EXP) dioxygen (ISO) disodium selenite (ISO) doxorubicin (ISO) endosulfan (EXP) ethanol (ISO) etoposide (ISO) fenofibrate (ISO) fenthion (ISO) FR900359 (ISO) furan (EXP) hexadecanoic acid (ISO) indole-3-methanol (EXP) indometacin (ISO) inulin (ISO) iron atom (ISO) iron(0) (ISO) isotretinoin (ISO) ivermectin (ISO) L-ascorbic acid (ISO) lead(0) (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methotrexate (ISO) methoxychlor (EXP) mitomycin C (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) orphenadrine (EXP) ozone (ISO) p-toluidine (EXP) paracetamol (EXP,ISO) paraquat (EXP) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phosgene (ISO) pirinixic acid (ISO) progesterone (ISO) protein kinase inhibitor (ISO) PX-866 (ISO) rac-lactic acid (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) Se-methyl-L-selenocysteine (ISO) Se-methylselenocysteine (ISO) silicon dioxide (ISO) sodium arsenite (EXP) streptozocin (ISO) taurocholic acid (ISO) temozolomide (ISO) testosterone (ISO) tetrachloromethane (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichostatin A (ISO) triptonide (ISO) troglitazone (ISO) tungsten (ISO) valproic acid (ISO) vincaleukoblastine (ISO) vinclozolin (EXP) vitamin E (ISO) wortmannin (ISO) Yessotoxin (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
cell differentiation (IEA) D-glucose import (IEA,ISO) endocytosis (IBA,IEA,ISO,ISS) endosome to lysosome transport (IEA,ISO) endosome transport via multivesicular body sorting pathway (IEA,ISO) extrinsic apoptotic signaling pathway via death domain receptors (IEA,ISO) G protein-coupled receptor signaling pathway (IEA,ISO) Golgi to endosome transport (IBA,IEA,ISO) Golgi to lysosome transport (IEA,ISO,ISS) intracellular protein transport (NAS) maintenance of synapse structure (IEA,ISO) myotube differentiation (IEA,ISO) negative regulation of fat cell differentiation (IEA,ISO) nerve growth factor signaling pathway (IEA) neuropeptide signaling pathway (IEA,ISO) neurotrophin TRK receptor signaling pathway (IEA,ISO) ossification (IEA) plasma membrane to endosome transport (IEA,ISO) positive regulation of epithelial cell apoptotic process (IMP) protein targeting to lysosome (IEA,ISO) regulation of gene expression (IEA,ISO) response to insulin (IEA,ISO) vesicle organization (IBA,IEA,ISO)
Cellular Component
cell surface (IEA,ISO) cerebellar climbing fiber to Purkinje cell synapse (IEA,ISO) clathrin-coated pit (IEA,ISO) clathrin-coated vesicle (IEA,ISO) cytoplasmic vesicle (IEA,ISO) cytoplasmic vesicle membrane (IEA,ISO) cytosol (IEA,ISO) dendrite (IDA) early endosome (IEA,ISO) endoplasmic reticulum (IEA) endoplasmic reticulum membrane (IEA) endosome (IEA) endosome membrane (IEA,ISO) Golgi apparatus (IBA,IEA,ISO,ISS) Golgi cisterna membrane (IEA) lysosomal membrane (IEA) lysosome (IEA,ISO,ISS) membrane (IBA,IEA,ISO) neuronal cell body (IDA) nuclear membrane (IEA) nucleus (IEA) perinuclear region of cytoplasm (IEA,ISO) plasma membrane (IEA,ISO) trans-Golgi network transport vesicle (IEA,ISO)
1.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
3.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
4.
Sortilin is the major 110-kDa protein in GLUT4 vesicles from adipocytes.
Morris NJ, etal., J Biol Chem 1998 Feb 6;273(6):3582-7.
5.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
7.
GOA pipeline
RGD automated data pipeline
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Distribution of NTS3 receptor/sortilin mRNA and protein in the rat central nervous system.
Sarret P, etal., J Comp Neurol 2003 Jul 7;461(4):483-505.
10.
A DAB2IP genotype: sex interaction is associated with abdominal aortic aneurysm expansion.
Ye Z, etal., J Investig Med. 2017 Oct;65(7):1077-1082. doi: 10.1136/jim-2016-000404. Epub 2017 Jul 11.
11.
Polyamines inhibit the assembly of stress granules in normal intestinal epithelial cells regulating apoptosis.
Zou T, etal., Am J Physiol Cell Physiol. 2012 Jul 1;303(1):C102-11. doi: 10.1152/ajpcell.00009.2012. Epub 2012 May 2.
Sort1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 2 198,609,466 - 198,690,481 (+) NCBI GRCr8 mRatBN7.2 2 195,924,033 - 196,002,354 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 2 195,924,099 - 196,002,354 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 2 203,567,532 - 203,645,624 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 2 201,449,641 - 201,527,742 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 2 196,266,598 - 196,344,698 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 2 211,078,092 - 211,156,312 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 2 211,078,334 - 211,156,312 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 2 230,546,773 - 230,626,278 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 2 203,853,009 - 203,931,559 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 2 203,816,049 - 203,890,296 (+) NCBI Celera 2 188,569,202 - 188,647,900 (+) NCBI Celera Cytogenetic Map 2 q34 NCBI
SORT1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 109,309,575 - 109,397,918 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 109,309,568 - 109,397,918 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 109,852,197 - 109,940,540 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 109,653,715 - 109,742,086 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 109,564,233 - 109,652,605 NCBI Celera 1 108,121,561 - 108,209,921 (-) NCBI Celera Cytogenetic Map 1 p13.3 NCBI HuRef 1 107,745,442 - 107,833,803 (-) NCBI HuRef CHM1_1 1 109,967,032 - 110,055,400 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 109,342,381 - 109,430,699 (-) NCBI T2T-CHM13v2.0
Sort1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 3 108,191,272 - 108,268,835 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 3 108,191,398 - 108,268,827 (+) Ensembl GRCm39 Ensembl GRCm38 3 108,283,974 - 108,361,519 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 3 108,284,082 - 108,361,511 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 3 108,087,050 - 108,164,429 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 3 108,412,188 - 108,489,567 (+) NCBI MGSCv36 mm8 Celera 3 110,641,971 - 110,695,148 (+) NCBI Celera Cytogenetic Map 3 F3 NCBI cM Map 3 46.9 NCBI
Sort1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955435 12,730,270 - 12,819,029 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955435 12,725,952 - 12,819,280 (-) NCBI ChiLan1.0 ChiLan1.0
SORT1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 117,906,698 - 117,994,934 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 117,066,633 - 117,154,840 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 111,687,119 - 111,775,339 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 110,850,311 - 110,888,690 (-) NCBI panpan1.1 PanPan1.1 panPan2
SORT1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 6 42,454,091 - 42,521,251 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 6 42,453,942 - 42,516,740 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 6 45,228,326 - 45,295,415 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 6 42,784,113 - 42,848,096 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 6 42,783,933 - 42,851,871 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 6 42,517,324 - 42,583,603 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 6 42,474,716 - 42,541,652 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 6 42,909,755 - 42,976,918 (+) NCBI UU_Cfam_GSD_1.0
Sort1
SORT1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 110,720,947 - 110,789,070 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 110,721,110 - 110,791,406 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 121,230,024 - 121,289,561 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SORT1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 24,150,210 - 24,235,518 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 24,150,300 - 24,239,503 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 34,220,514 - 34,309,885 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Sort1
.
Predicted Target Of
Count of predictions: 158 Count of miRNA genes: 133 Interacting mature miRNAs: 145 Transcripts: ENSRNOT00000049127 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
1578648 Bss11 Bone structure and strength QTL 11 4.7 femur morphology trait (VT:0000559) femoral neck cortical cross-sectional area (CMO:0001702) 2 114837527 211674221 Rat 1358356 Srcrt1 Stress Responsive Cort QTL1 3.66 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 2 161699179 222436696 Rat 1331734 Bp204 Blood pressure QTL 204 3.61192 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 168358098 223265385 Rat 1298074 Bp164 Blood pressure QTL 164 0.003 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 1354648 Bp239 Blood pressure QTL 239 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118463 226797303 Rat 1354649 Kidm17 Kidney mass QTL 17 2.9 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 2 81754530 227146641 Rat 10755499 Bp389 Blood pressure QTL 389 2.61 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 18960362 228801039 Rat 1298076 Bp166 Blood pressure QTL 166 0.0009 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 136445150 202447032 Rat 152025245 Scl81 Serum cholesterol level QTL 81 3.49 blood cholesterol amount (VT:0000180) 2 122609194 206936711 Rat 61458 Bp10 Blood pressure QTL 10 3.42 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 70162 Bp63 Blood pressure QTL 63 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 1554319 Bmd2 Bone mineral density QTL 2 13.4 0.0001 lumbar vertebra area (VT:0010570) lumbar vertebra cross-sectional area (CMO:0001689) 2 114837675 212549332 Rat 1581569 Uae32 Urinary albumin excretion QTL 32 0.0001 urine protein amount (VT:0005160) urine albumin excretion rate (CMO:0000757) 2 78665619 219826953 Rat 1302793 Bw16 Body weight QTL 16 5 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 2 157142209 202446871 Rat 61467 Bp14 Blood pressure QTL 14 2.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 43154682 202446871 Rat 2317752 Glom23 Glomerulus QTL 23 3.6 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 2 193452645 245889826 Rat 61469 Bp16 Blood pressure QTL 16 5.64 arterial blood pressure trait (VT:2000000) blood pressure measurement (CMO:0000003) 2 169745596 214745596 Rat 70175 BpQTLCluster3 Blood pressure QTL cluster 3 4.128 arterial blood pressure trait (VT:2000000) absolute change in systolic blood pressure (CMO:0000607) 2 135552573 202446871 Rat 1358900 Bw48 Body weight QTL 48 4.88 body mass (VT:0001259) body weight (CMO:0000012) 2 157142078 211086598 Rat 4889834 Pur24 Proteinuria QTL 24 5.8 0.014 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 2 184114274 202447032 Rat 1359031 Bp275 Blood pressure QTL 275 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 2 185876309 219753474 Rat 1581499 Esta2 Estrogen-induced thymic atrophy QTL 2 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 2 189599258 226936289 Rat 1331760 Bp206 Blood pressure QTL 206 3.62454 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 56043031 202447032 Rat 9589044 Scfw1 Subcutaneous fat weight QTL 1 5.8 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 2 182171407 227171407 Rat 8694435 Bw166 Body weight QTL 166 14.08 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 2 182171407 227171407 Rat 2301966 Bp322 Blood pressure QTL 322 3.58 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150540301 202447032 Rat 1298083 Bp158 Blood pressure QTL 158 2.62 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189020722 215287351 Rat 1298080 Bp163 Blood pressure QTL 163 0.02 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 66118275 202447032 Rat 8662832 Vetf7 Vascular elastic tissue fragility QTL 7 3.5 aorta elastin amount (VT:0003905) aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002) 2 81689826 221035911 Rat 1331745 Bp203 Blood pressure QTL 203 4.377 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 189599258 218414891 Rat 1298085 Bp165 Blood pressure QTL 165 0.0006 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 42804607 202447032 Rat 8694194 Abfw1 Abdominal fat weight QTL 1 11.7 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 2 182171407 227171407 Rat 61366 Iddm3 Insulin dependent diabetes mellitus QTL 3 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 189599258 234599258 Rat 1359022 Ppulsi1 Prepulse inhibition QTL 1 3.63 prepulse inhibition trait (VT:0003088) acoustic startle response measurement (CMO:0001519) 2 136916935 213594495 Rat 1641891 Alcrsp17 Alcohol response QTL 17 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 249053267 Rat 724534 Uae6 Urinary albumin excretion QTL 6 10 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 2 78665619 249053267 Rat 61374 Edpm2 Estrogen-dependent pituitary mass QTL 2 4.42 0.86 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 2 76539322 202447032 Rat 2300189 Bmd48 Bone mineral density QTL 48 5.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 2 179335906 224335906 Rat 8662843 Vetf9 Vascular elastic tissue fragility QTL 9 2.05 thoracic aorta molecular composition trait (VT:0010568) aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003) 2 157142078 226277316 Rat 2301408 Kidm36 Kidney mass QTL 36 0.002 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 2 190613715 226808892 Rat 631501 Bp101 Blood pressure QTL 101 2.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 150341684 202446871 Rat 2307174 Activ3 Activity QTL 3 4.83 0.000058 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 2 168594495 213594495 Rat 1331794 Bp202 Blood pressure QTL 202 3.66819 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 141194931 223265385 Rat 71113 Cari2 Carrageenan-induced inflammation QTL 2 2.7 0.009 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 2 141596551 202447032 Rat 1331805 Cm29 Cardiac mass QTL 29 3.50746 heart mass (VT:0007028) heart wet weight (CMO:0000069) 2 141194931 223265385 Rat 634308 Sach6 Saccharin preference QTL 6 4.9 taste sensitivity trait (VT:0001986) saccharin intake volume to total fluid intake volume ratio (CMO:0001601) 2 112456140 212696837 Rat 1358917 Cm42 Cardiac mass QTL 42 2.82 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 724568 Uae13 Urinary albumin excretion QTL 13 4.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 2 143157029 210020885 Rat 1358913 Cm41 Cardiac mass QTL 41 2.73 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 2 25413423 203928301 Rat 1300165 Rf9 Renal function QTL 9 3.28 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 2 133914684 202447032 Rat 738013 Alc15 Alcohol consumption QTL 15 4.1 0.00022 consumption behavior trait (VT:0002069) ethanol drink intake rate to body weight ratio (CMO:0001616) 2 184165752 229165752 Rat 61398 Bp50 Blood pressure QTL 50 4.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 189599258 234599258 Rat 631507 Bp105 Blood pressure QTL 105 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 112456140 212696837 Rat 1641925 Alcrsp2 Alcohol response QTL 2 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 2 149559561 221167075 Rat 1354609 Niddm62 Non-insulin dependent diabetes mellitus QTL 62 4.72 0.000006 insulin secretion trait (VT:0003564) plasma insulin level (CMO:0000342) 2 150540301 202447032 Rat 61417 Cia10 Collagen induced arthritis QTL 10 3.4 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 2 179946951 224946951 Rat 1354622 Kidm16 Kidney mass QTL 16 3 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 2 81754530 222436696 Rat 631266 Bp132 Blood pressure QTL 132 0.0005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 46123260 202447032 Rat 8694383 Bw158 Body weight QTL 158 7.69 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 2 182171407 227171407 Rat 7488927 Bp365 Blood pressure QTL 365 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 162765032 207765032 Rat 1598838 Bp290 Blood pressure QTL 290 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 166539266 211539266 Rat 7488925 Bp364 Blood pressure QTL 364 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 2 160564068 205564068 Rat 2306901 Bp337 Blood pressure QTL 337 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 2 164073756 227146641 Rat 1354605 Rf48 Renal function QTL 48 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 2 74786664 206665859 Rat 2293084 Iddm26 Insulin dependent diabetes mellitus QTL 26 2.9 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 2 174930955 213594495 Rat
D2Rat51
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 2 195,931,945 - 195,932,102 (+) MAPPER mRatBN7.2 Rnor_6.0 2 211,085,920 - 211,086,076 NCBI Rnor6.0 Rnor_5.0 2 230,555,257 - 230,555,413 UniSTS Rnor5.0 RGSC_v3.4 2 203,860,594 - 203,860,751 RGD RGSC3.4 RGSC_v3.4 2 203,860,595 - 203,860,751 UniSTS RGSC3.4 RGSC_v3.1 2 203,823,349 - 203,823,505 RGD Celera 2 188,576,788 - 188,576,944 UniSTS RH 3.4 Map 2 1395.3 UniSTS RH 3.4 Map 2 1395.3 RGD SHRSP x BN Map 2 74.0098 UniSTS SHRSP x BN Map 2 74.0098 RGD Cytogenetic Map 2 q34 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000049127 ⟹ ENSRNOP00000051102
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 195,924,362 - 196,002,354 (+) Ensembl Rnor_6.0 Ensembl 2 211,078,334 - 211,156,312 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000108279 ⟹ ENSRNOP00000082085
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 2 195,924,099 - 196,002,354 (+) Ensembl
RefSeq Acc Id:
NM_031767 ⟹ NP_113955
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 198,612,495 - 198,690,481 (+) NCBI mRatBN7.2 2 195,924,362 - 196,002,354 (+) NCBI Rnor_6.0 2 211,078,334 - 211,156,312 (+) NCBI Rnor_5.0 2 230,546,773 - 230,626,278 (+) NCBI RGSC_v3.4 2 203,853,009 - 203,931,559 (+) RGD Celera 2 188,569,202 - 188,647,900 (+) RGD
Sequence:
AGCGGCGTCTGCATTCGGCGGCGATGGAGCGGCCCCGGGGAGCTGCGGACGGCCTTTTGCGCTGGCCCCTTGGCCTCCTCCTGCTCCTGCAGCTGCTGCCGCCAGCCGCCGTCGGCCAGGACCGGCTG
hide sequence
RefSeq Acc Id:
XM_006233194 ⟹ XP_006233256
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 198,609,466 - 198,690,408 (+) NCBI mRatBN7.2 2 195,924,034 - 196,002,354 (+) NCBI Rnor_6.0 2 211,078,092 - 211,156,308 (+) NCBI Rnor_5.0 2 230,546,773 - 230,626,278 (+) NCBI
Sequence:
ATGACCTCAGCCGTCCCTGCCACGTTCCAGCCAATCAGTCCCGCATCTTGGCATCCGAATCCAG
hide sequence
RefSeq Acc Id:
XM_006233195 ⟹ XP_006233257
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 198,609,466 - 198,690,408 (+) NCBI mRatBN7.2 2 195,924,033 - 196,002,354 (+) NCBI Rnor_6.0 2 211,078,092 - 211,156,308 (+) NCBI Rnor_5.0 2 230,546,773 - 230,626,278 (+) NCBI
Sequence:
ATGACCTCAGCCGTCCCTGCCACGTTCCAGCCAATCAGTCCCGCATCTTGGCATCCGAATCCAG
hide sequence
RefSeq Acc Id:
XM_006233196 ⟹ XP_006233258
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 2 198,609,466 - 198,690,408 (+) NCBI mRatBN7.2 2 195,924,036 - 196,002,354 (+) NCBI Rnor_6.0 2 211,078,279 - 211,156,312 (+) NCBI Rnor_5.0 2 230,546,773 - 230,626,278 (+) NCBI
Sequence:
GGGGGTGTGGCGCAGCGCCGGCGGGGGTGGGCGGGCGCGCCGGGTGGCAGGTGTCAGCGGCGTC
hide sequence
RefSeq Acc Id:
NP_113955 ⟸ NM_031767
- Peptide Label:
precursor
- UniProtKB:
O35389 (UniProtKB/Swiss-Prot), O54861 (UniProtKB/Swiss-Prot), A0A8L2QPF6 (UniProtKB/TrEMBL)
- Sequence:
MERPRGAADGLLRWPLGLLLLLQLLPPAAVGQDRLDAPPPPAPPLLRWAGPVGVSWGLRAAAPGGPVPRAGRWRRGAPAEDQDCGRLPDFIAKLTNNTHQHVFDDLSGSVSLSWVGDSTGVILVLTTF
hide sequence
RefSeq Acc Id:
XP_006233257 ⟸ XM_006233195
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6G6Z1 (UniProtKB/TrEMBL)
- Sequence:
MRSGPGKKDRRPAYGGGEARLRVSKQRQAELGGVAQRRRGWAGAPGGRCQRRLHSAAMERPRGA
hide sequence
RefSeq Acc Id:
XP_006233256 ⟸ XM_006233194
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6G6Z1 (UniProtKB/TrEMBL)
- Sequence:
MRSGPGKKDRRPAYGGGEARLRVSKQRQAELGGVAQRRRGWAGAPGGRCQRRLHSAAMERPRGAADGLLRWPLGLLLLLQLLPPAAVGQDRLDAPPPPAPPLLRWAGPVGVSWGLRAAAPGGPVPRAG
hide sequence
RefSeq Acc Id:
XP_006233258 ⟸ XM_006233196
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6G6Z1 (UniProtKB/TrEMBL)
- Sequence:
MERPRGAADGLLRWPLGLLLLLQLLPPAAVGQDRLDAPPPPAPPLLRWAGPVGVSWGLRAAAPG
hide sequence
Ensembl Acc Id:
ENSRNOP00000051102 ⟸ ENSRNOT00000049127
Ensembl Acc Id:
ENSRNOP00000082085 ⟸ ENSRNOT00000108279
RGD ID: 13691678 Promoter ID: EPDNEW_R2203 Type: initiation region Name: Sort1_1 Description: sortilin 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 2 211,078,331 - 211,078,391 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-09-10
Sort1
sortilin 1
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Sort1
sortilin 1
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
localized to vesicles and plasma membrane
730041
gene_cellular_localization
predominantly localized to the membrane of intracellular membrane-bound organelles
1299257
