Symbol:
Slc15a2
Name:
solute carrier family 15 member 2
RGD ID:
61972
Description:
Enables dipeptide transmembrane transporter activity; peptide:proton symporter activity; and tripeptide transmembrane transporter activity. Involved in dipeptide import across plasma membrane; metanephric proximal tubule development; and tripeptide import across plasma membrane. Located in apical plasma membrane. Orthologous to human SLC15A2 (solute carrier family 15 member 2); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
kidney H(+)/peptide cotransporter; MGC91625; oligopeptide transporter, kidney isoform; peptide transporter 2; solute carrier family 15 (H+/peptide transporter) member 2; solute carrier family 15 (H+/peptide transporter), member 2; solute carrier family 15 (oligopeptide transporter), member 2; solute carrier family 15, member 2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
SLC15A2 (solute carrier family 15 member 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Slc15a2 (solute carrier family 15 (H+/peptide transporter), member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Slc15a2 (solute carrier family 15 member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
SLC15A2 (solute carrier family 15 member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
SLC15A2 (solute carrier family 15 member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Slc15a2 (solute carrier family 15 member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
SLC15A2 (solute carrier family 15 member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
SLC15A2 (solute carrier family 15 member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Slc15a2 (solute carrier family 15 member 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Slc15a2 (solute carrier family 15 (H+/peptide transporter), member 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
SLC15A2 (solute carrier family 15 member 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
slc15a2 (solute carrier family 15 member 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG2930
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
PTR2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|SonicParanoid)
Caenorhabditis elegans (roundworm):
pept-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder)
Caenorhabditis elegans (roundworm):
pept-3
Alliance
DIOPT (OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG9444
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
yin
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
slc15a2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 77,519,565 - 77,548,609 (+) NCBI GRCr8 mRatBN7.2 11 64,014,182 - 64,043,228 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 64,014,182 - 64,043,225 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 72,826,580 - 72,855,620 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 65,488,810 - 65,517,850 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 64,519,800 - 64,548,903 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 66,932,664 - 66,961,708 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 66,932,614 - 66,961,713 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 70,022,984 - 70,052,075 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 65,819,551 - 65,849,924 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 65,877,139 - 65,907,513 (+) NCBI Celera 11 63,484,245 - 63,513,303 (+) NCBI Celera Cytogenetic Map 11 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Slc15a2 Rat (1->4)-beta-D-glucan multiple interactions ISO Slc15a2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SLC15A2 mRNA CTD PMID:36331819 Slc15a2 Rat 1,1-dichloroethene decreases expression ISO Slc15a2 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of SLC15A2 mRNA CTD PMID:26682919 Slc15a2 Rat 1,2-dichloroethane decreases expression ISO Slc15a2 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of SLC15A2 mRNA CTD PMID:28960355 Slc15a2 Rat 1,2-dimethylhydrazine decreases expression ISO Slc15a2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in decreased expression of SLC15A2 mRNA CTD PMID:22206623 Slc15a2 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of SLC15A2 mRNA CTD PMID:17351261 Slc15a2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of SLC15A2 mRNA CTD PMID:29097150 Slc15a2 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of SLC15A2 mRNA CTD PMID:26865667 Slc15a2 Rat 17beta-estradiol multiple interactions ISO SLC15A2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of SLC15A2 mRNA and [Progesterone co-treated with Estradiol] results in increased expression of SLC15A2 mRNA CTD PMID:17404688 and PMID:20660070 Slc15a2 Rat 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO SLC15A2 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of SLC15A2 mRNA CTD PMID:29581250 Slc15a2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Slc15a2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of SLC15A2 mRNA CTD PMID:15652763 Slc15a2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of SLC15A2 mRNA CTD PMID:32109520 Slc15a2 Rat 3-methylcholanthrene increases expression ISO Slc15a2 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of SLC15A2 mRNA CTD PMID:25926378 Slc15a2 Rat 4,4'-sulfonyldiphenol decreases methylation ISO SLC15A2 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of SLC15A2 gene CTD PMID:31601247 Slc15a2 Rat 4-hydroxyphenyl retinamide increases expression ISO Slc15a2 (Mus musculus) 6480464 Fenretinide results in increased expression of SLC15A2 mRNA CTD PMID:28973697 Slc15a2 Rat aflatoxin B1 increases expression ISO Slc15a2 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of SLC15A2 mRNA CTD PMID:19770486 Slc15a2 Rat aflatoxin B1 increases methylation ISO SLC15A2 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of SLC15A2 intron CTD PMID:30157460 Slc15a2 Rat all-trans-retinoic acid increases expression ISO SLC15A2 (Homo sapiens) 6480464 Tretinoin results in increased expression of SLC15A2 mRNA CTD PMID:33167477 Slc15a2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SLC15A2 mRNA CTD PMID:16483693 Slc15a2 Rat arsenous acid increases expression ISO Slc15a2 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of SLC15A2 mRNA CTD PMID:35676786 Slc15a2 Rat benazepril multiple interactions ISO SLC15A2 (Homo sapiens) 6480464 benazepril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat benazepril multiple interactions EXP 6480464 benazepril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat benzo[a]pyrene increases expression ISO Slc15a2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SLC15A2 mRNA CTD PMID:21964900 Slc15a2 Rat benzo[a]pyrene increases methylation ISO Slc15a2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of SLC15A2 promoter CTD PMID:27901495 Slc15a2 Rat benzo[a]pyrene affects methylation ISO SLC15A2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of SLC15A2 promoter CTD PMID:27901495 Slc15a2 Rat benzo[a]pyrene increases methylation ISO SLC15A2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SLC15A2 exon CTD PMID:27901495 Slc15a2 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of SLC15A2 mRNA CTD PMID:26496021 Slc15a2 Rat bisphenol A decreases expression ISO Slc15a2 (Mus musculus) 6480464 bisphenol A results in decreased expression of SLC15A2 mRNA CTD PMID:35479511 Slc15a2 Rat bisphenol A increases expression ISO Slc15a2 (Mus musculus) 6480464 bisphenol A results in increased expression of SLC15A2 mRNA CTD PMID:32156529 and PMID:34585602 Slc15a2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SLC15A2 mRNA CTD PMID:29097150 Slc15a2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of SLC15A2 mRNA CTD PMID:25181051 more ... Slc15a2 Rat bisphenol F decreases expression ISO Slc15a2 (Mus musculus) 6480464 bisphenol F results in decreased expression of SLC15A2 mRNA CTD PMID:38685157 Slc15a2 Rat calcitriol multiple interactions ISO SLC15A2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of SLC15A2 mRNA CTD PMID:21592394 Slc15a2 Rat calcitriol increases expression ISO SLC15A2 (Homo sapiens) 6480464 Calcitriol results in increased expression of SLC15A2 mRNA CTD PMID:21592394 Slc15a2 Rat carbon nanotube decreases expression ISO Slc15a2 (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of SLC15A2 mRNA CTD PMID:25554681 Slc15a2 Rat carbon nanotube increases expression ISO Slc15a2 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of SLC15A2 mRNA CTD PMID:25554681 Slc15a2 Rat carmustine affects response to substance ISO SLC15A2 (Homo sapiens) 6480464 SLC15A2 mRNA affects the susceptibility to Carmustine CTD PMID:16365179 Slc15a2 Rat carnosine increases expression ISO Slc15a2 (Mus musculus) 6480464 Carnosine results in increased expression of SLC15A2 mRNA and Carnosine results in increased expression of SLC15A2 protein CTD PMID:30485136 Slc15a2 Rat chlordecone increases expression ISO Slc15a2 (Mus musculus) 6480464 Chlordecone results in increased expression of SLC15A2 mRNA CTD PMID:33711761 Slc15a2 Rat cilazapril monohydrate multiple interactions EXP 6480464 Cilazapril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of SLC15A2 mRNA CTD PMID:24386269 Slc15a2 Rat copper(II) sulfate decreases expression ISO SLC15A2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of SLC15A2 mRNA CTD PMID:19549813 Slc15a2 Rat crocidolite asbestos decreases expression ISO SLC15A2 (Homo sapiens) 6480464 Asbestos and Crocidolite results in decreased expression of SLC15A2 mRNA CTD PMID:25351596 Slc15a2 Rat D-gluconic acid multiple interactions EXP 6480464 [gluconic acid co-treated with Deoxycholic Acid] results in increased expression of SLC15A2 mRNA CTD PMID:16556975 Slc15a2 Rat deoxycholic acid multiple interactions EXP 6480464 [gluconic acid co-treated with Deoxycholic Acid] results in increased expression of SLC15A2 mRNA CTD PMID:16556975 Slc15a2 Rat diarsenic trioxide increases expression ISO Slc15a2 (Mus musculus) 6480464 Arsenic Trioxide results in increased expression of SLC15A2 mRNA CTD PMID:35676786 Slc15a2 Rat Dibutyl phosphate affects expression ISO SLC15A2 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of SLC15A2 mRNA CTD PMID:37042841 Slc15a2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of SLC15A2 mRNA CTD PMID:21266533 Slc15a2 Rat diclofenac decreases expression ISO Slc15a2 (Mus musculus) 6480464 Diclofenac results in decreased expression of SLC15A2 mRNA CTD PMID:26934552 Slc15a2 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of SLC15A2 mRNA CTD PMID:21551480 Slc15a2 Rat enalapril multiple interactions ISO SLC15A2 (Homo sapiens) 6480464 Enalapril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat ethanol increases expression ISO Slc15a2 (Mus musculus) 6480464 Ethanol results in increased expression of SLC15A2 mRNA CTD PMID:30319688 Slc15a2 Rat folic acid decreases expression ISO Slc15a2 (Mus musculus) 6480464 Folic Acid results in decreased expression of SLC15A2 mRNA CTD PMID:25629700 Slc15a2 Rat fosinopril multiple interactions EXP 6480464 Fosinopril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat furan increases expression EXP 6480464 furan results in increased expression of SLC15A2 mRNA CTD PMID:26194646 Slc15a2 Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of SLC15A2 mRNA CTD PMID:21782745 Slc15a2 Rat genistein decreases expression ISO SLC15A2 (Homo sapiens) 6480464 Genistein results in decreased expression of SLC15A2 mRNA CTD PMID:26865667 Slc15a2 Rat glycylsarcosine increases uptake EXP 6480464 SLC15A2 protein results in increased uptake of glycylsarcosine CTD PMID:18713951 Slc15a2 Rat glycylsarcosine increases uptake ISO SLC15A2 (Homo sapiens) 6480464 SLC15A2 protein results in increased uptake of glycylsarcosine CTD PMID:33007874 Slc15a2 Rat glycylsarcosine multiple interactions EXP 6480464 benazepril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] more ... CTD PMID:18713951 Slc15a2 Rat glycylsarcosine multiple interactions ISO SLC15A2 (Homo sapiens) 6480464 benazepril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] more ... CTD PMID:18713951 Slc15a2 Rat methoxychlor multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in increased expression of SLC15A2 mRNA CTD PMID:21782745 Slc15a2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of SLC15A2 gene CTD PMID:35440735 Slc15a2 Rat methoxychlor increases expression EXP 6480464 Methoxychlor results in increased expression of SLC15A2 mRNA CTD PMID:21782745 Slc15a2 Rat methyl methanesulfonate increases expression ISO SLC15A2 (Homo sapiens) 6480464 Methyl Methanesulfonate results in increased expression of SLC15A2 mRNA CTD PMID:23649840 Slc15a2 Rat Moexipril multiple interactions EXP 6480464 moexipril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of SLC15A2 gene CTD PMID:33148267 Slc15a2 Rat ochratoxin A decreases expression EXP 6480464 ochratoxin A results in decreased expression of SLC15A2 mRNA CTD PMID:29126803 Slc15a2 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of SLC15A2 mRNA CTD PMID:25729387 Slc15a2 Rat ozone multiple interactions ISO SLC15A2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of SLC15A2 mRNA CTD PMID:35430440 Slc15a2 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of SLC15A2 mRNA CTD PMID:18198484 Slc15a2 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of SLC15A2 mRNA CTD PMID:32680482 Slc15a2 Rat pentane-2,3-dione decreases expression EXP 6480464 2 and 3-pentanedione results in decreased expression of SLC15A2 mRNA CTD PMID:25710175 Slc15a2 Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of SLC15A2 mRNA CTD PMID:18692542 Slc15a2 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Slc15a2 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SLC15A2 mRNA CTD PMID:36331819 Slc15a2 Rat perindopril multiple interactions EXP 6480464 Perindopril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of SLC15A2 gene CTD PMID:33148267 Slc15a2 Rat progesterone multiple interactions ISO SLC15A2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of SLC15A2 mRNA and [Progesterone co-treated with Estradiol] results in increased expression of SLC15A2 mRNA CTD PMID:17404688 and PMID:20660070 Slc15a2 Rat progesterone decreases expression ISO SLC15A2 (Homo sapiens) 6480464 Progesterone results in decreased expression of SLC15A2 mRNA CTD PMID:21540246 Slc15a2 Rat progesterone increases expression ISO SLC15A2 (Homo sapiens) 6480464 Progesterone results in increased expression of SLC15A2 mRNA CTD PMID:17404688 Slc15a2 Rat quinapril hydrochloride multiple interactions EXP 6480464 Quinapril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat quinapril hydrochloride multiple interactions ISO SLC15A2 (Homo sapiens) 6480464 Quinapril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat quinaprilat multiple interactions EXP 6480464 quinaprilat inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat quinaprilat multiple interactions ISO SLC15A2 (Homo sapiens) 6480464 quinaprilat inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat ramipril multiple interactions EXP 6480464 Ramipril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat silicon dioxide decreases expression ISO SLC15A2 (Homo sapiens) 6480464 Silicon Dioxide results in decreased expression of SLC15A2 mRNA CTD PMID:25351596 Slc15a2 Rat sodium arsenite increases expression ISO SLC15A2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SLC15A2 mRNA CTD PMID:17879257 Slc15a2 Rat spirapril multiple interactions EXP 6480464 spirapril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat spirapril multiple interactions ISO SLC15A2 (Homo sapiens) 6480464 spirapril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat sunitinib decreases expression ISO SLC15A2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of SLC15A2 mRNA CTD PMID:31533062 Slc15a2 Rat tamoxifen decreases expression ISO Slc15a2 (Mus musculus) 6480464 Tamoxifen results in decreased expression of SLC15A2 mRNA CTD PMID:17555576 Slc15a2 Rat temozolomide affects response to substance ISO SLC15A2 (Homo sapiens) 6480464 SLC15A2 mRNA affects the susceptibility to temozolomide CTD PMID:16365179 Slc15a2 Rat testosterone increases expression ISO SLC15A2 (Homo sapiens) 6480464 Testosterone results in increased expression of SLC15A2 mRNA CTD PMID:21592394 Slc15a2 Rat testosterone multiple interactions EXP 6480464 [bisphenol A co-treated with Testosterone] results in decreased expression of SLC15A2 mRNA CTD PMID:26496021 Slc15a2 Rat testosterone multiple interactions ISO SLC15A2 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of SLC15A2 mRNA CTD PMID:21592394 Slc15a2 Rat tetraphene affects expression ISO Slc15a2 (Mus musculus) 6480464 benz(a)anthracene affects the expression of SLC15A2 mRNA CTD PMID:26377693 Slc15a2 Rat titanium dioxide increases expression ISO Slc15a2 (Mus musculus) 6480464 titanium dioxide results in increased expression of SLC15A2 mRNA CTD PMID:27760801 Slc15a2 Rat titanium dioxide decreases expression ISO Slc15a2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of SLC15A2 mRNA CTD PMID:23557971 and PMID:29264374 Slc15a2 Rat trandolapril multiple interactions EXP 6480464 trandolapril inhibits the reaction [SLC15A2 protein results in increased uptake of glycylsarcosine] CTD PMID:18713951 Slc15a2 Rat triclosan decreases expression ISO SLC15A2 (Homo sapiens) 6480464 Triclosan results in decreased expression of SLC15A2 mRNA CTD PMID:30510588 Slc15a2 Rat triphenyl phosphate affects expression ISO SLC15A2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of SLC15A2 mRNA CTD PMID:37042841 Slc15a2 Rat triptonide increases expression ISO Slc15a2 (Mus musculus) 6480464 triptonide results in increased expression of SLC15A2 mRNA CTD PMID:33045310 Slc15a2 Rat tungsten decreases expression ISO Slc15a2 (Mus musculus) 6480464 Tungsten results in decreased expression of SLC15A2 mRNA CTD PMID:30912803 Slc15a2 Rat warfarin affects response to substance ISO SLC15A2 (Homo sapiens) 6480464 SLC15A2 gene SNP affects the susceptibility to Warfarin CTD PMID:29234073 Slc15a2 Rat zoledronic acid decreases expression ISO SLC15A2 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of SLC15A2 mRNA CTD PMID:24714768
(1->4)-beta-D-glucan (ISO) 1,1-dichloroethene (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-methylcholanthrene (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP) arsenous acid (ISO) benazepril (EXP,ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) calcitriol (ISO) carbon nanotube (ISO) carmustine (ISO) carnosine (ISO) chlordecone (ISO) cilazapril monohydrate (EXP) cobalt dichloride (EXP) copper(II) sulfate (ISO) crocidolite asbestos (ISO) D-gluconic acid (EXP) deoxycholic acid (EXP) diarsenic trioxide (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) diclofenac (ISO) diuron (EXP) enalapril (ISO) ethanol (ISO) folic acid (ISO) fosinopril (EXP) furan (EXP) genistein (EXP,ISO) glycylsarcosine (EXP,ISO) methoxychlor (EXP) methyl methanesulfonate (ISO) Moexipril (EXP) N,N-diethyl-m-toluamide (EXP) ochratoxin A (EXP) oxaliplatin (EXP) ozone (ISO) paraquat (EXP) pentane-2,3-dione (EXP) perfluorooctane-1-sulfonic acid (EXP,ISO) perindopril (EXP) permethrin (EXP) progesterone (ISO) quinapril hydrochloride (EXP,ISO) quinaprilat (EXP,ISO) ramipril (EXP) silicon dioxide (ISO) sodium arsenite (ISO) spirapril (EXP,ISO) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) testosterone (EXP,ISO) tetraphene (ISO) titanium dioxide (ISO) trandolapril (EXP) triclosan (ISO) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) warfarin (ISO) zoledronic acid (ISO)
1.
Crystal Structures of the Extracellular Domain from PepT1 and PepT2 Provide Novel Insights into Mammalian Peptide Transport.
Beale JH, etal., Structure. 2015 Oct 6;23(10):1889-99. doi: 10.1016/j.str.2015.07.016. Epub 2015 Aug 27.
2.
Stoichiometry and kinetics of the high-affinity H+-coupled peptide transporter PepT2.
Chen XZ, etal., J Biol Chem. 1999 Jan 29;274(5):2773-9. doi: 10.1074/jbc.274.5.2773.
3.
beta-lactam antibiotics as substrates for OCTN2, an organic cation/carnitine transporter.
Ganapathy ME, etal., J Biol Chem. 2000 Jan 21;275(3):1699-707.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Renogenic characterization and in vitro differentiation of rat amniotic fluid stem cells into renal proximal tubular- and juxtaglomerular-like cells.
Minocha E, etal., In Vitro Cell Dev Biol Anim. 2019 Feb;55(2):138-147. doi: 10.1007/s11626-018-00315-2. Epub 2019 Jan 15.
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
Cryo-EM structure of PepT2 reveals structural basis for proton-coupled peptide and prodrug transport in mammals.
Parker JL, etal., Sci Adv. 2021 Aug 25;7(35):eabh3355. doi: 10.1126/sciadv.abh3355. Print 2021 Aug.
10.
GOA pipeline
RGD automated data pipeline
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Molecular cloning and tissue distribution of rat peptide transporter PEPT2.
Saito H, etal., Biochim Biophys Acta 1996 Apr 26;1280(2):173-7.
14.
Role of PEPT2 in peptide/mimetic trafficking at the blood-cerebrospinal fluid barrier: studies in rat choroid plexus epithelial cells in primary culture.
Shu C, etal., J Pharmacol Exp Ther 2002 Jun;301(3):820-9.
15.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
16.
Carnosine uptake in rat choroid plexus primary cell cultures and choroid plexus whole tissue from PEPT2 null mice.
Teuscher NS, etal., J Neurochem. 2004 Apr;89(2):375-82. doi: 10.1111/j.1471-4159.2004.02333.x.
Slc15a2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 77,519,565 - 77,548,609 (+) NCBI GRCr8 mRatBN7.2 11 64,014,182 - 64,043,228 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 64,014,182 - 64,043,225 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 72,826,580 - 72,855,620 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 65,488,810 - 65,517,850 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 64,519,800 - 64,548,903 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 66,932,664 - 66,961,708 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 66,932,614 - 66,961,713 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 70,022,984 - 70,052,075 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 65,819,551 - 65,849,924 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 65,877,139 - 65,907,513 (+) NCBI Celera 11 63,484,245 - 63,513,303 (+) NCBI Celera Cytogenetic Map 11 q21 NCBI
SLC15A2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 121,894,401 - 121,944,188 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 121,894,401 - 121,944,188 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 121,613,248 - 121,663,035 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 123,095,977 - 123,143,148 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 3 123,095,976 - 123,143,147 NCBI Celera 3 120,023,021 - 120,072,858 (+) NCBI Celera Cytogenetic Map 3 q13.33 NCBI HuRef 3 118,987,216 - 119,037,039 (+) NCBI HuRef CHM1_1 3 121,577,211 - 121,627,066 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 124,614,370 - 124,664,153 (+) NCBI T2T-CHM13v2.0
Slc15a2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 36,570,523 - 36,605,506 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 36,570,539 - 36,605,324 (-) Ensembl GRCm39 Ensembl GRCm38 16 36,750,161 - 36,785,158 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 36,750,177 - 36,784,962 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 36,750,250 - 36,785,048 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 36,669,420 - 36,704,201 (-) NCBI MGSCv36 mm8 Celera 16 37,165,904 - 37,195,398 (-) NCBI Celera Cytogenetic Map 16 B3 NCBI cM Map 16 25.97 NCBI
Slc15a2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955427 21,221,750 - 21,255,725 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955427 21,221,778 - 21,255,725 (+) NCBI ChiLan1.0 ChiLan1.0
SLC15A2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 119,848,009 - 119,901,353 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 119,852,773 - 119,906,132 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 118,996,023 - 119,044,423 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 125,902,978 - 125,951,963 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 125,902,978 - 125,951,963 (+) Ensembl panpan1.1 panPan2
SLC15A2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 33 25,154,415 - 25,190,715 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 33 25,154,448 - 25,189,929 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 33 25,179,881 - 25,216,242 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 33 25,389,745 - 25,426,316 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 33 25,389,827 - 25,426,392 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 33 25,188,148 - 25,224,653 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 33 25,230,387 - 25,266,965 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 33 25,788,327 - 25,824,919 (+) NCBI UU_Cfam_GSD_1.0
Slc15a2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 129,205,990 - 129,241,546 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936536 8,280,448 - 8,316,064 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936536 8,280,537 - 8,316,011 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
SLC15A2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 138,595,973 - 138,632,675 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 138,595,942 - 138,634,473 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 148,224,099 - 148,259,030 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SLC15A2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 58,916,389 - 58,966,725 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 58,913,676 - 58,966,906 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 107,356,438 - 107,408,360 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Slc15a2
.
Predicted Target Of
Count of predictions: 526 Count of miRNA genes: 242 Interacting mature miRNAs: 289 Transcripts: ENSRNOT00000003189 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 70208 Niddm22 Non-insulin dependent diabetes mellitus QTL 22 3.61 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 11 59802794 82566553 Rat 70180 BpQTLcluster10 Blood pressure QTL cluster 10 3.19 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 11 34918041 79918041 Rat 1581565 Pur10 Proteinuria QTL 10 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 4889859 Pur28 Proteinuria QTL 28 19.5 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 11 45459323 75190161 Rat 8694376 Bw156 Body weight QTL 156 2.25 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 10755497 Bp388 Blood pressure QTL 388 2.76 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 19456205 76331918 Rat 10058952 Gmadr6 Adrenal mass QTL 6 2.29 0.0072 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 22959403 67959403 Rat 10058954 Gmadr7 Adrenal mass QTL 7 2.49 0.0049 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 60346590 86241447 Rat 1558659 Tescar1 Testicular tumor resistance QTL 1 3.9 testis integrity trait (VT:0010572) percentage of study population developing testis tumors during a period of time (CMO:0001261) 11 1041931 66113562 Rat 2298551 Neuinf10 Neuroinflammation QTL 10 3.7 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 11 31239134 78851519 Rat 1300135 Rf19 Renal function QTL 19 3.38 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 11 40946188 82566702 Rat 2312566 Glom20 Glomerulus QTL 20 3.6 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 44285759 82566702 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 9589032 Epfw10 Epididymal fat weight QTL 10 9.29 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 11 23280456 68280456 Rat 724561 Plsm4 Polydactyly-luxate syndrome (PLS) morphotypes QTL 4 0.0003 forelimb integrity trait (VT:0010562) front foot phalanges count (CMO:0001947) 11 54457534 86241447 Rat 9590313 Scort20 Serum corticosterone level QTL 20 6.51 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 11 23280456 68280456 Rat 4889521 Gluco62 Glucose level QTL 62 2.82 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 55136729 82993457 Rat 7411658 Foco27 Food consumption QTL 27 16.2 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 11 56351424 86241447 Rat 631506 Bp104 Blood pressure QTL 104 2.8 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 59802794 82566545 Rat 8694424 Bw162 Body weight QTL 162 3.8 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 1581572 Uae35 Urinary albumin excretion QTL 35 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat
RH127511
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 64,042,925 - 64,043,122 (+) MAPPER mRatBN7.2 Rnor_6.0 11 66,961,406 - 66,961,602 NCBI Rnor6.0 Rnor_5.0 11 70,051,773 - 70,051,969 UniSTS Rnor5.0 RGSC_v3.4 11 65,849,629 - 65,849,825 UniSTS RGSC3.4 Celera 11 63,513,001 - 63,513,197 UniSTS RH 3.4 Map 11 486.8 UniSTS Cytogenetic Map 11 q22 UniSTS
BF405220
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 64,040,540 - 64,040,688 (+) MAPPER mRatBN7.2 Rnor_6.0 11 66,959,021 - 66,959,168 NCBI Rnor6.0 Rnor_5.0 11 70,049,388 - 70,049,535 UniSTS Rnor5.0 RGSC_v3.4 11 65,847,244 - 65,847,391 UniSTS RGSC3.4 Celera 11 63,510,616 - 63,510,763 UniSTS RH 3.4 Map 11 467.3 UniSTS Cytogenetic Map 11 q22 UniSTS
RH139643
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 64,042,524 - 64,042,717 (+) MAPPER mRatBN7.2 Rnor_6.0 11 66,961,005 - 66,961,197 NCBI Rnor6.0 Rnor_5.0 11 70,051,372 - 70,051,564 UniSTS Rnor5.0 RGSC_v3.4 11 65,849,228 - 65,849,420 UniSTS RGSC3.4 Celera 11 63,512,600 - 63,512,792 UniSTS RH 3.4 Map 11 470.4 UniSTS Cytogenetic Map 11 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
47
113
87
86
55
25
55
6
212
95
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000003189 ⟹ ENSRNOP00000003189
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 64,014,182 - 64,043,225 (+) Ensembl Rnor_6.0 Ensembl 11 66,932,614 - 66,961,713 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000106100 ⟹ ENSRNOP00000094276
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 64,014,182 - 64,026,088 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111085 ⟹ ENSRNOP00000086877
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 64,014,182 - 64,043,225 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000120269 ⟹ ENSRNOP00000078734
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 64,014,182 - 64,043,225 (+) Ensembl
RefSeq Acc Id:
NM_031672 ⟹ NP_113860
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 77,519,565 - 77,548,609 (+) NCBI mRatBN7.2 11 64,014,182 - 64,043,228 (+) NCBI Rnor_6.0 11 66,932,664 - 66,961,708 (+) NCBI Rnor_5.0 11 70,022,984 - 70,052,075 (+) NCBI RGSC_v3.4 11 65,819,551 - 65,849,924 (+) RGD Celera 11 63,484,245 - 63,513,303 (+) NCBI
Sequence:
TCCAGTTCTGCTCTGAGGCTGGCAGCTACTGAAACTGACACACACAGGGTTAAACCTATTTGCTGTGGCCATCCCTCCTCCCCCTAGTCCCCCTTTTCACTGTAGGCTGGCAGCAGTCCTAACTGCCT
hide sequence
RefSeq Acc Id:
XM_063270759 ⟹ XP_063126829
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 77,522,622 - 77,548,609 (+) NCBI
RefSeq Acc Id:
NP_113860 ⟸ NM_031672
- UniProtKB:
A0A0H2UHA7 (UniProtKB/TrEMBL), A6IRB4 (UniProtKB/TrEMBL), A0A8I6A6Q4 (UniProtKB/TrEMBL)
- Sequence:
MLEERESKEPAMNPFQKNESKETLFSPVSTEEMLPRPPSPPKKSPPKIFGSSYPVSIAFIVVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIADSWLGKFKTIIYL
hide sequence
Ensembl Acc Id:
ENSRNOP00000003189 ⟸ ENSRNOT00000003189
Ensembl Acc Id:
ENSRNOP00000078734 ⟸ ENSRNOT00000120269
Ensembl Acc Id:
ENSRNOP00000094276 ⟸ ENSRNOT00000106100
Ensembl Acc Id:
ENSRNOP00000086877 ⟸ ENSRNOT00000111085
RefSeq Acc Id:
XP_063126829 ⟸ XM_063270759
- Peptide Label:
isoform X1
- UniProtKB:
Q63424 (UniProtKB/Swiss-Prot), Q5U401 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-25
Slc15a2
solute carrier family 15 member 2
Slc15a2
solute carrier family 15 (oligopeptide transporter), member 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-08-02
Slc15a2
solute carrier family 15 (oligopeptide transporter), member 2
Slc15a2
solute carrier family 15 (H+/peptide transporter), member 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2004-09-10
Slc15a2
solute carrier family 15 (H+/peptide transporter), member 2
solute carrier family 15, member 2
Name updated
1299863 APPROVED
2002-06-10
Slc15a2
solute carrier family 15, member 2
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_cellular_localization
localized to the apical and subapical regions of choroid plexus epithelial cells
729764
