Nt5e (5' nucleotidase, ecto) - Rat Genome Database

Name: Nt5e
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Nt5e (5' nucleotidase, ecto) Rattus norvegicus

Analyze

Symbol:

Nt5e

Name:

5' nucleotidase, ecto

RGD ID:

61956

Description:

Enables 5'-nucleotidase activity and ferrous iron binding activity. Involved in nucleobase-containing small molecule metabolic process; positive regulation of lipid biosynthetic process; and response to aluminum ion. Located in cell surface and synaptic membrane. Biomarker of status epilepticus. Human ortholog(s) of this gene implicated in hereditary arterial and articular multiple calcification syndrome. Orthologous to human NT5E (5'-nucleotidase ecto); PARTICIPATES IN hypoxia inducible factor pathway; monoterpenoid biosynthetic pathway; niacin metabolic pathway; INTERACTS WITH (+)-schisandrin B; 1,2-dimethylhydrazine; 17alpha-ethynylestradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

5 nucleotidase; 5 nucleotidase ecto; 5' nucleotidase ecto; 5'-deoxynucleotidase; 5'-NT; 5'-nucleotidase; CD73; ecto-5'-nucleotidase; IMP-specific 5'-nucleotidase; MGC112615; Nt5; thymidylate 5'-phosphatase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NT5E (5'-nucleotidase ecto)	HGNC	EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Nt5e (5' nucleotidase, ecto)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nt5e (5'-nucleotidase ecto)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NT5E (5'-nucleotidase ecto)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NT5E (5'-nucleotidase ecto)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nt5e (5'-nucleotidase ecto)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NT5E (5'-nucleotidase ecto)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NT5E (5'-nucleotidase ecto)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nt5e (5'-nucleotidase ecto)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Nt5e (5' nucleotidase, ecto)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NT5E (5'-nucleotidase ecto)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nt5e (5'-nucleotidase, ecto (CD73))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG30103	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG42249	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	NT5E-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	veil	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nt5e	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	89,271,046 - 89,314,918 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	89,270,696 - 89,314,881 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	94,940,630 - 94,984,431 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	93,139,844 - 93,183,642 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	90,998,970 - 91,042,930 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	95,969,002 - 96,012,733 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	95,968,652 - 96,012,696 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	95,464,591 - 95,508,322 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	93,591,630 - 93,635,481 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	93,610,734 - 93,654,911 (+)	NCBI
Celera	8	88,841,425 - 88,885,302 (+)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain Injuries (IEP)

Disease Progression (ISO)

Experimental Diabetes Mellitus (IEP)

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

hereditary arterial and articular multiple calcification syndrome (ISO)

Neoplastic Cell Transformation (ISO)

neuroblastoma (ISO)

status epilepticus (IEP)

Stomach Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (EXP,ISO)

1-nitropyrene (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrobenzenesulfonic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,3',5-triiodo-L-thyronine (EXP)

3,4-dichloroaniline (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-azacytidine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

adenosine (ISO)

ADP (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antimycin A (ISO)

aripiprazole (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

beta-naphthoflavone (ISO)

betalain (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bortezomib (ISO)

bucladesine (ISO)

buspirone (EXP)

cadmium dichloride (ISO)

caffeine (EXP)

cannabidiol (ISO)

carbon nanotube (ISO)

cerium trichloride (ISO)

chloropicrin (ISO)

choline (ISO)

ciguatoxin CTX1B (ISO)

cis-caffeic acid (EXP)

cobalt dichloride (EXP,ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

coumestrol (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

deguelin (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP,ISO)

diclofenac (ISO)

dicrotophos (ISO)

dimethylarsinic acid (ISO)

dioxygen (ISO)

disulfiram (ISO)

diuron (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

Enterolactone (ISO)

ethanol (EXP,ISO)

ethyl methanesulfonate (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

glafenine (EXP)

homocysteine (ISO)

hydrogen cyanide (ISO)

indometacin (EXP,ISO)

ivermectin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

medroxyprogesterone acetate (ISO)

mercury dibromide (ISO)

mercury dichloride (EXP)

methapyrilene (EXP)

methylarsonic acid (ISO)

methylisothiazolinone (ISO)

N-nitrosodiethylamine (ISO)

nefazodone (EXP)

nickel atom (ISO)

nimesulide (EXP,ISO)

nitrites (ISO)

oxaliplatin (EXP)

ozone (EXP,ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (EXP,ISO)

potassium chromate (ISO)

potassium cyanide (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

progesterone (EXP,ISO)

quercetin (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (EXP,ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP,ISO)

sotorasib (ISO)

streptozocin (ISO)

temozolomide (ISO)

tenofovir disoproxil fumarate (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thalidomide (ISO)

thioacetamide (EXP,ISO)

trametinib (ISO)

trans-caffeic acid (EXP)

trichostatin A (ISO)

triptonide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

troglitazone (ISO)

uranium atom (ISO)

valproic acid (ISO)

vincristine (ISO)

withaferin A (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenosine biosynthetic process (IEA,IMP,ISO)

adenosine metabolic process (IDA)

ADP catabolic process (IEA,ISO)

AMP catabolic process (IBA,IDA,IEA,IMP,ISO)

ATP metabolic process (IEA,ISO)

calcium ion homeostasis (IEA,ISO)

inhibition of non-skeletal tissue mineralization (IEA,ISO)

leukocyte cell-cell adhesion (IEA,ISO)

negative regulation of inflammatory response (IEA,ISO)

nucleotide catabolic process (IEA)

positive regulation of lipid biosynthetic process (IEP)

response to aluminum ion (IEP)

response to ATP (IEA,ISO)

response to inorganic substance (IEA,ISO)

Cellular Component

cell surface (IDA)

cytosol (IEA,ISO)

external side of plasma membrane (IEA,ISO)

membrane (ISO)

nucleoplasm (IEA,ISO)

plasma membrane (IBA,IDA,ISO)

side of membrane (IEA)

synaptic membrane (IDA)

Molecular Function

5'-deoxynucleotidase activity (IEA,ISO)

5'-nucleotidase activity (IBA,IDA,ISO)

ferrous iron binding (IDA)

GMP 5'-nucleotidase activity (IEA,ISO)

identical protein binding (IEA,ISO)

IMP 5'-nucleotidase activity (IEA,ISO)

metal ion binding (IEA)

nucleotidase activity (IEA)

nucleotide binding (IEA)

protein binding (ISO)

thymidylate 5'-phosphatase activity (IEA,ISO)

XMP 5'-nucleosidase activity (IEA)

zinc ion binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

hypoxia inducible factor pathway (ISO)

monoterpenoid biosynthetic pathway (IEA)

niacin metabolic pathway (IEA)

purine metabolic pathway (IEA)

pyrimidine metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Evidence for the involvement of cytosolic 5'-nucleotidase (cN-II) in the synthesis of guanine nucleotides from xanthosine.	Barsotti C, etal., J Biol Chem. 2005 Apr 8;280(14):13465-9. Epub 2005 Feb 6.
2.	The ecto-enzymes CD73 and adenosine deaminase modulate 5'-AMP-derived adenosine in myofibroblasts of the rat small intestine.	Bin A, etal., Purinergic Signal. 2018 Dec;14(4):409-421. doi: 10.1007/s11302-018-9623-6. Epub 2018 Sep 29.
3.	Dynamic changes in the expression pattern of ecto-5'-nucleotidase in the rat model of cortical stab injury.	Bjelobaba I, etal., J Neurosci Res. 2011 Jun;89(6):862-73. doi: 10.1002/jnr.22599. Epub 2011 Feb 17.
4.	Ontogenetic profile of ectonucleotidase activities from brain synaptosomes of pilocarpine-treated rats.	de Paula Cognato G, etal., Int J Dev Neurosci. 2005 Dec;23(8):703-9. Epub 2005 Nov 4.
5.	5'-Nucleotidase activity increases in aging rat brain.	Fuchs JL, Neurobiol Aging. 1991 Sep-Oct;12(5):523-30. doi: 10.1016/0197-4580(91)90083-v.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	The effect of aluminium on NTPDase and 5'-nucleotidase activities from rat synaptosomes and platelets.	Kaizer RR, etal., Int J Dev Neurosci. 2007 Oct;25(6):381-6. Epub 2007 Jul 10.
9.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
10.	Oxidative modification of rat liver 5'-nucleotidase: the mechanisms for protection and re-activation.	Kocic G, etal., Arch Physiol Biochem 2001 Oct;109(4):323-30.
11.	Enzymes of adenosine metabolism in the brain: diurnal rhythm and the effect of sleep deprivation.	Mackiewicz M, etal., J Neurochem. 2003 Apr;85(2):348-57.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Primary structure of rat liver 5'-nucleotidase deduced from the cDNA. Presence of the COOH-terminal hydrophobic domain for possible post-translational modification by glycophospholipid.	Misumi Y, etal., J Biol Chem 1990 Feb 5;265(4):2178-83.
14.	Upregulation of Lipid Synthesis in Small Rat Adipocytes by Microvesicle-Associated CD73 From Large Adipocytes.	Muller G, etal., Obesity (Silver Spring). 2011 Mar 3.
15.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
17.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
18.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
19.	GOA pipeline	RGD automated data pipeline
20.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
21.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
22.	Ectonucleotidase and acetylcholinesterase activities in synaptosomes from the cerebral cortex of streptozotocin-induced diabetic rats and treated with resveratrol.	Schmatz R, etal., Brain Res Bull. 2009 Dec 16;80(6):371-6. Epub 2009 Aug 31.
23.	Subcellular localization and properties of 5'-nucleotidase in the rat liver.	Song CS and Bodansky O, J Biol Chem. 1967 Feb 25;242(4):694-9.
24.	Ontogenetic profile of ecto-5'-nucleotidase in rat brain synaptic plasma membranes.	Stanojevic I, etal., Int J Dev Neurosci. 2011 Jun;29(4):397-403. Epub 2011 Mar 23.
25.	Effect of In-Vitro Passaging on the Stem Cell-related Properties of Tendon-Derived Stem Cells (TDSCs) - Implication in Tissue Engineering.	Tan Q, etal., Stem Cells Dev. 2011 Jun 1.
26.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:2129526	PMID:2148114	PMID:7595232	PMID:11375348	PMID:12477932	PMID:15149841	PMID:15202768	PMID:15307889	PMID:15543949	PMID:15763893	PMID:16480902	PMID:16547283
PMID:16672190	PMID:16705150	PMID:16718378	PMID:17119848	PMID:17574764	PMID:17619122	PMID:17619139	PMID:18201730	PMID:18223197	PMID:18256932	PMID:18636315	PMID:19056867
PMID:19169047	PMID:19463911	PMID:19524108	PMID:19581412	PMID:19893081	PMID:20359849	PMID:20458337	PMID:21362503	PMID:22045065	PMID:22899823	PMID:23300031	PMID:23533145
PMID:24894822	PMID:25833166	PMID:25907806	PMID:26080748	PMID:26303492	PMID:26499073	PMID:26987957	PMID:27102210	PMID:27694000	PMID:28363952	PMID:28560821	PMID:28684854
PMID:30117104	PMID:30507864	PMID:30913879	PMID:31220343

Genomics

Comparative Map Data

Nt5e
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	8	89,271,046 - 89,314,918 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	89,270,696 - 89,314,881 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	94,940,630 - 94,984,431 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	93,139,844 - 93,183,642 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	90,998,970 - 91,042,930 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	95,969,002 - 96,012,733 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	95,968,652 - 96,012,696 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	95,464,591 - 95,508,322 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	93,591,630 - 93,635,481 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	93,610,734 - 93,654,911 (+)	NCBI
Celera	8	88,841,425 - 88,885,302 (+)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

NT5E
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	85,450,083 - 85,495,784 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	85,449,584 - 85,495,791 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	86,159,801 - 86,205,502 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	86,216,528 - 86,262,215 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	86,216,527 - 86,262,215	NCBI
Celera	6	86,586,482 - 86,632,679 (+)	NCBI		Celera
Cytogenetic Map	6	q14.3	NCBI
HuRef	6	83,383,590 - 83,429,793 (+)	NCBI		HuRef
CHM1_1	6	86,257,244 - 86,303,451 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	86,666,882 - 86,712,587 (+)	NCBI		T2T-CHM13v2.0

Nt5e
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	88,209,662 - 88,254,142 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	88,209,250 - 88,254,145 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	88,327,609 - 88,372,089 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	88,327,197 - 88,372,092 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	88,222,447 - 88,266,927 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	88,125,533 - 88,169,982 (+)	NCBI		MGSCv36	mm8
Celera	9	85,354,734 - 85,399,137 (+)	NCBI		Celera
Cytogenetic Map	9	E3.1	NCBI
cM Map	9	47.24	NCBI

Nt5e
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955411	12,891,236 - 12,948,406 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955411	12,891,236 - 12,946,324 (+)	NCBI	ChiLan1.0	ChiLan1.0

NT5E
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	103,429,147 - 103,478,675 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	83,333,428 - 83,379,585 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	86,615,409 - 86,661,594 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	86,615,409 - 86,661,601 (+)	Ensembl	panpan1.1		panPan2

NT5E
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	45,491,028 - 45,520,019 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	45,491,733 - 45,518,405 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	45,289,507 - 45,334,783 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	46,244,000 - 46,289,219 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	46,243,992 - 46,289,217 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	45,577,415 - 45,622,655 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	45,506,318 - 45,551,536 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	45,693,314 - 45,738,560 (+)	NCBI		UU_Cfam_GSD_1.0

Nt5e
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	80,624,771 - 80,673,677 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936510	5,797,212 - 5,846,124 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936510	5,797,218 - 5,846,118 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NT5E
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	54,400,810 - 54,448,742 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	54,400,786 - 54,450,743 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	60,831,831 - 60,881,527 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NT5E
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	10,115,591 - 10,162,178 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	10,116,161 - 10,160,414 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	186,303,608 - 186,348,855 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nt5e
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624799	8,765,711 - 8,845,778 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624799	8,766,608 - 8,845,296 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nt5e
241 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	318
Count of miRNA genes:	216
Interacting mature miRNAs:	252
Transcripts:	ENSRNOT00000015057
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	69349194	112783834	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	70513503	118219066	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	71888757	116888757	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	71888757	116888757	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	71888757	116888757	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	71888757	116888757	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	73473045	118473045	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	76468691	121468691	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	82460758	122812818	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	89265192	114019816	Rat

Markers in Region

RH133920

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	89,314,499 - 89,314,714 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	96,012,315 - 96,012,529	NCBI	Rnor6.0
Rnor_5.0	8	95,507,904 - 95,508,118	UniSTS	Rnor5.0
RGSC_v3.4	8	93,635,063 - 93,635,277	UniSTS	RGSC3.4
Celera	8	88,884,884 - 88,885,098	UniSTS
RH 3.4 Map	8	1012.2	UniSTS
Cytogenetic Map	8	q31	UniSTS

RH144635

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	89,276,206 - 89,276,376 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	95,974,163 - 95,974,332	NCBI	Rnor6.0
Rnor_5.0	8	95,469,752 - 95,469,921	UniSTS	Rnor5.0
RGSC_v3.4	8	93,596,791 - 93,596,960	UniSTS	RGSC3.4
Celera	8	88,846,586 - 88,846,755	UniSTS
RH 3.4 Map	8	1020.8	UniSTS
Cytogenetic Map	8	q31	UniSTS

BF410734

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	89,272,455 - 89,272,557 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	95,970,412 - 95,970,513	NCBI	Rnor6.0
Rnor_5.0	8	95,466,001 - 95,466,102	UniSTS	Rnor5.0
RGSC_v3.4	8	93,593,040 - 93,593,141	UniSTS	RGSC3.4
Celera	8	88,842,835 - 88,842,936	UniSTS
RH 3.4 Map	8	1014.7	UniSTS
Cytogenetic Map	8	q31	UniSTS

BF399571

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	89,308,091 - 89,308,252 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	96,005,859 - 96,006,019	NCBI	Rnor6.0
Rnor_5.0	8	95,501,448 - 95,501,608	UniSTS	Rnor5.0
RGSC_v3.4	8	93,628,656 - 93,628,816	UniSTS	RGSC3.4
Celera	8	88,878,476 - 88,878,636	UniSTS
RH 3.4 Map	8	1014.0	UniSTS
Cytogenetic Map	8	q31	UniSTS

Nt5

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	89,312,610 - 89,312,737 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	96,010,426 - 96,010,552	NCBI	Rnor6.0
Rnor_5.0	8	95,506,015 - 95,506,141	UniSTS	Rnor5.0
RGSC_v3.4	8	93,633,174 - 93,633,300	UniSTS	RGSC3.4
Celera	8	88,882,995 - 88,883,121	UniSTS
Cytogenetic Map	8	q31	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	26	40	25	19	25			11	21	23	11
Low	1	17	17	16		16	8	11	41	14	18		8
Below cutoff									22

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_021576	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC081806	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098665	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J05214	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JN792133	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000015057 ⟹ ENSRNOP00000015057

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	89,270,696 - 89,314,881 (+)	Ensembl
Rnor_6.0 Ensembl	8	95,968,652 - 96,012,696 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000107471 ⟹ ENSRNOP00000091985

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	89,270,696 - 89,314,881 (+)	Ensembl

RefSeq Acc Id:

NM_021576 ⟹ NP_067587

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	8	89,271,046 - 89,314,918 (+)	NCBI
Rnor_6.0	8	95,969,002 - 96,012,733 (+)	NCBI
Rnor_5.0	8	95,464,591 - 95,508,322 (+)	NCBI
RGSC_v3.4	8	93,591,630 - 93,635,481 (+)	RGD
Celera	8	88,841,425 - 88,885,302 (+)	RGD

Sequence:

show sequence

GGCCAGTTCACCCGCTCAACGCGCTCCTGCCAGCCATGCGTCCCGCGGCTGCTACGGCACCCAA
GTGGCTGCTTCTCGCGCTAAGCGCTCTACTACCACTGTGGCCCACAGCCAAATCCTGGGAGCTC
ACGATCCTGCACACAAACGACGTGCACAGCCGGCTAGAGCAAACCAGCGATGACTCCACCAAGT
GCCTCAACGCAAGCCTGTGTGTGGGCGGCGTGGCCCGGCTCTTCACCAAGGTGCAGCAGATCCG
CAAGGAAGAACCCAACGTACTGCTTTTGGATGCTGGCGATCAGTACCAGGGCACCATCTGGTTC
ACTGTTTACAAAGGCCTGGAAGTGGCACACTTCATGAACCTCCTGGGCTACGATGCCATGGCAC
TGGGAAATCATGAATTTGATAACGGTGTGGAAGGACTGATTGATCCCCTCCTCAGAAATGTCAA
ATTTCCAATTCTGAGTGCAAATATTAAGGCCCGGGGGCCACTAGCACCTCAGATATCCGGACTT
TATTTGCCATATAAAGTTCTCTCTGTCGGTGGTGAGGTTGTGGGGATTGTTGGATATACTTCAA
AGGAAACCCCCTTCCTCTCAAATCCAGGGACAAATTTAGTCTTCGAAGATGAAGTCACTGCGTT
GCAGCCTGAAGTGGATAAACTAAAAACTCTAAACGTGAACAAGATCATTGCCCTGGGACACTCT
GGTTTCGAGATGGATAAACTCATTGCCCAGAAGGTGAGAGGCGTGGACGTCGTGGTGGGAGGAC
ACACCAACACCTTTCTCTACACAGGAAATCCACCTTCCAAAGAAGTGCCTGCTGGGAAGTACCC
ATTCATAGTCACCTCTGACGATGGGCGAAAGGTTCCCGTGGTCCAGGCCTATGCCTTTGGCAAA
TACCTGGGCTATCTGAAGGTTGAGTTTGATGATAAAGGAAATGTTGTCACTTCCTATGGAAATC
CCATTCTTCTGAACAGCACCATTCGTGAAGATGCAGCCATCAAAGCAGACATTAACCAGTGGAG
GATAAAATTAGATAATTATTCTACACAGGAACTCGGGAGAACCATCGTCTACCTGAATGGCTCC
GCTCAGGAGTGCCGCTTCAGAGAGTGCAACATGGGAAACCTGATCTGTGATGCCATGATTAACA
ACAACCTCAGACACCCAGATGAAATGTTTTGGAACCACGTGTCCATGTGCATTGTAAATGGAGG
TGGCATCCGGTCCCCCATTGATGAGAGGAACAATGGTACCATCACCTGGGAGAACCTGGCTGCT
GTGCTGCCCTTTGGAGGGACATTTGACCTTGTCCAATTGAAAGGGTCCACCCTGAAGAAGGCTT
TTGAGCACAGTGTGCATCGATATGGCCAGTCCACAGGGGAGTTCCTGCAAGTGGGTGGAATCCA
TGTGGTGTATGATATTTCCCGAAAGCCCTGGGACAGAGTGGTCCAATTAAAAGTTCTCTGCACC
AAGTGTCGAGTGCCCATCTATGAGCCTCTCGAAATGGATAAAGTGTATAAAGTGGTCCTCCCAA
GCTATCTGGTCAACGGTGGGGATGGATTCCAAATGATAAAAGATGAATTATTAAAACATGACTC
TGGTGACCAAGATATCAGTGTGGTTTCTGAATACATCTCAAAAATGAAAGTAATTTACCCAGCA
GTTGAAGGACGGATCAAGTTCTCTGCAGCAAGTCATTACCAAGGAAGCTTTCCTTTAATAATTC
TTTCCTTTTGGGCAGTGATCCTTGTTTTGTACCAATAACAGGAAGTCTTGTCCTTGGTGTCAAA
CTGCATTTTTCTTCCAGTGATATTCAAATCTGCCTCTGGAAAGCTGGCTTTGTGATGGTGCTCA
TCATCCTCAAGGCTCCAGGCAGATGCTCTTCACAAGGAAGAGACTGTAATATCATTTGTTGGGA
CCAGCAACTCAATGAGCAGAGAGTCAAAGTGAACCAACAGGGTCCTTCTGGAAGGTAGTGGGTA
GGGGAAACATCTGGGTGTAGTTTGCACATCCACATAACACATCTGGCTACCACTGAGCCTCAAA
AATAATTTTTCCCTTTCTATTCATTTCTAATCCATCAAACAACTGATGTTTACATAGAACTTTA
TCATTGCCAGTTCTGGTGGCACATGCCCGTGGTCACAGAACTTGGGAGGGAGGAGAGGATGGCT
GCAAGTTCTAGGCCAGCCTGACCTATGTAGAGTTTCAAGCCAGTTAGCTAGACATCAAGACTCA
CACAAACAAACAAAACCATTATAATTTACAAGTAGATTTCTGTAGACAAGTATTGTGATGTTAA
TCAGAAAGGGTTGACTTGTTCAAGGCCATAAATCTCTAAACAATACATCTAGGACCTGAACCCA
AGTCTTTTTACCTCAAGTCCAATACTCTCTCCTACAGTCAAGTCTCCTCTCTTCCTGCCAATGG
CCCCAGATGACAAATCTCTGTTTCAGCCCTCCATACTATCCTTTCTTTTGGGCTCCTATTGTCT
CTCAAGTTTGAGAGAGTAACTACTGGACAGGACATGTGCCTTTGATGAGTCACAGACAAACTGT
ATAAAGCAGATAATGGGTTAGTCCAGGGAATGCAAAAGGCAGTCAGGGACAGTGGAGAAAGGGA
AAGGAGAATGTGACCAGGACTGATACATTATAGAAGAGAGAATGGGTATTTAGATGTGTTACAC
AAACACTAGTTAAGAAGCAGGGCATAGGGGCTGGGGATTTAGCTCAGTGGTAGAGCGCTTACCT
AGGAAGCGCAAGGCCCTGGGTTCGGTCCCCAGCTCCGAAAAAAAGAACCAAAAAAAAAAAAAAA
AAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_067587	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40621	(Get FASTA)	NCBI Sequence Viewer
	AAH81806	(Get FASTA)	NCBI Sequence Viewer
	AAH98665	(Get FASTA)	NCBI Sequence Viewer
	EDL77598	(Get FASTA)	NCBI Sequence Viewer
	EDL77599	(Get FASTA)	NCBI Sequence Viewer
	P21588	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_067587 ⟸ NM_021576
- Peptide Label:	precursor
- UniProtKB:	P21588 (UniProtKB/Swiss-Prot), Q66HL0 (UniProtKB/TrEMBL), Q4G083 (UniProtKB/TrEMBL), F7EWJ6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MRPAAATAPKWLLLALSALLPLWPTAKSWELTILHTNDVHSRLEQTSDDSTKCLNASLCVGGVA RLFTKVQQIRKEEPNVLLLDAGDQYQGTIWFTVYKGLEVAHFMNLLGYDAMALGNHEFDNGVEG LIDPLLRNVKFPILSANIKARGPLAPQISGLYLPYKVLSVGGEVVGIVGYTSKETPFLSNPGTN LVFEDEVTALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDVVVGGHTNTFLYTGNPP SKEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKVEFDDKGNVVTSYGNPILLNSTIREDA AIKADINQWRIKLDNYSTQELGRTIVYLNGSAQECRFRECNMGNLICDAMINNNLRHPDEMFWN HVSMCIVNGGGIRSPIDERNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKAFEHSVHRYGQST GEFLQVGGIHVVYDISRKPWDRVVQLKVLCTKCRVPIYEPLEMDKVYKVVLPSYLVNGGDGFQM IKDELLKHDSGDQDISVVSEYISKMKVIYPAVEGRIKFSAASHYQGSFPLIILSFWAVILVLYQ hide sequence

RefSeq Acc Id:

ENSRNOP00000015057 ⟸ ENSRNOT00000015057

RefSeq Acc Id:

ENSRNOP00000091985 ⟸ ENSRNOT00000107471

Protein Domains

5'-Nucleotidase C-terminal Calcineurin-like phosphoesterase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P21588-F1-model_v2	AlphaFold	P21588	1-576	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61956	AgrOrtholog
BioCyc Gene	G2FUF-29612	BioCyc
Ensembl Genes	ENSRNOG00000011071	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000015057	ENTREZGENE
	ENSRNOP00000015057.3	UniProtKB/TrEMBL
	ENSRNOP00000091985.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015057	ENTREZGENE
	ENSRNOT00000015057.7	UniProtKB/TrEMBL
	ENSRNOT00000107471.1	UniProtKB/TrEMBL
Gene3D-CATH	3.60.21.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.90.780.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7134340	IMAGE-MGC_LOAD
	IMAGE:7322840	IMAGE-MGC_LOAD
InterPro	5'-Nucleotdase_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	5'-Nucleotdase_C_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	5'-Nucleotdase_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	5_nucleotidase/apyrase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Calcineurin-like_PHP_ApaH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Metallo-depent_PP-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:58813	UniProtKB/TrEMBL
MGC_CLONE	MGC:112615	IMAGE-MGC_LOAD
	MGC:93467	IMAGE-MGC_LOAD
NCBI Gene	58813	ENTREZGENE
PANTHER	5'-NUCLEOTIDASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11575	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	5_nucleotid_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Metallophos	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	NT5E	RGD
PhenoGen	Nt5e	PhenoGen
PRINTS	APYRASEFAMLY	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	5_NUCLEOTIDASE_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	5_NUCLEOTIDASE_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF55816	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF56300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC228515
UniProt	5NTD_RAT	UniProtKB/Swiss-Prot
	A0A8I6AV15_RAT	UniProtKB/TrEMBL
	A6I1X9_RAT	UniProtKB/TrEMBL
	F7EWJ6	ENTREZGENE, UniProtKB/TrEMBL
	P21588	ENTREZGENE
	Q4G083	ENTREZGENE
	Q66HL0	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	Q4G083	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Nt5e	5' nucleotidase, ecto	Nt5	5 nucleotidase	Name updated	1299863	APPROVED
2002-06-10	Nt5	5 nucleotidase			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to the plasma membrane
gene_protein	63.965 kDa

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)