Symbol:
Nt5e
Name:
5' nucleotidase, ecto
RGD ID:
61956
Description:
Enables 5'-nucleotidase activity and ferrous iron binding activity. Involved in nucleobase-containing small molecule metabolic process; positive regulation of lipid biosynthetic process; and response to aluminum ion. Located in cell surface and synaptic membrane. Biomarker of status epilepticus. Human ortholog(s) of this gene implicated in hereditary arterial and articular multiple calcification syndrome. Orthologous to human NT5E (5'-nucleotidase ecto); PARTICIPATES IN hypoxia inducible factor pathway; monoterpenoid biosynthetic pathway; niacin metabolic pathway; INTERACTS WITH (+)-schisandrin B; 1,2-dimethylhydrazine; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
5 nucleotidase; 5 nucleotidase ecto; 5' nucleotidase ecto; 5'-deoxynucleotidase; 5'-NT; 5'-nucleotidase; CD73; ecto-5'-nucleotidase; IMP-specific 5'-nucleotidase; MGC112615; Nt5; thymidylate 5'-phosphatase
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
NT5E (5'-nucleotidase ecto) HGNC
EggNOG, Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Nt5e (5' nucleotidase, ecto) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Nt5e (5'-nucleotidase ecto) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
NT5E (5'-nucleotidase ecto) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
NT5E (5'-nucleotidase ecto) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Nt5e (5'-nucleotidase ecto) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
NT5E (5'-nucleotidase ecto) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
NT5E (5'-nucleotidase ecto) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Nt5e (5'-nucleotidase ecto) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Nt5e (5' nucleotidase, ecto)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
NT5E (5'-nucleotidase ecto)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
nt5e (5'-nucleotidase, ecto (CD73))
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG30103
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG42249
Alliance
DIOPT (Hieranoid|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
NT5E-2
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
veil
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
nt5e
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 98,150,925 - 98,195,646 (+) NCBI GRCr8 mRatBN7.2 8 89,271,046 - 89,314,918 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 89,270,696 - 89,314,881 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 94,940,630 - 94,984,431 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 93,139,844 - 93,183,642 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 90,998,970 - 91,042,930 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 95,969,002 - 96,012,733 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 95,968,652 - 96,012,696 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 95,464,591 - 95,508,322 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 93,591,630 - 93,635,481 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 93,610,734 - 93,654,911 (+) NCBI Celera 8 88,841,425 - 88,885,302 (+) NCBI Celera Cytogenetic Map 8 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Nt5e Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NT5E mRNA] CTD PMID:31150632 Nt5e Rat (-)-demecolcine increases expression ISO NT5E (Homo sapiens) 6480464 Demecolcine results in increased expression of NT5E mRNA CTD PMID:23649840 Nt5e Rat (1->4)-beta-D-glucan multiple interactions ISO Nt5e (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NT5E mRNA CTD PMID:36331819 Nt5e Rat 1,2-dichloroethane increases expression ISO Nt5e (Mus musculus) 6480464 ethylene dichloride results in increased expression of NT5E mRNA CTD PMID:28189721 and PMID:28960355 Nt5e Rat 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of NT5E mRNA CTD PMID:27840820 Nt5e Rat 1,2-dimethylhydrazine affects expression ISO Nt5e (Mus musculus) 6480464 1 and 2-Dimethylhydrazine affects the expression of NT5E mRNA CTD PMID:22206623 Nt5e Rat 1-nitropyrene increases expression ISO NT5E (Homo sapiens) 6480464 1-nitropyrene results in increased expression of NT5E mRNA CTD PMID:19041380 Nt5e Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of NT5E mRNA CTD PMID:26865667 Nt5e Rat 17beta-estradiol multiple interactions ISO NT5E (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of NT5E mRNA more ... CTD PMID:20823114 more ... Nt5e Rat 17beta-estradiol affects expression ISO Nt5e (Mus musculus) 6480464 Estradiol affects the expression of NT5E mRNA CTD PMID:39298647 Nt5e Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of NT5E mRNA CTD PMID:32145629 Nt5e Rat 17beta-estradiol decreases expression ISO NT5E (Homo sapiens) 6480464 Estradiol results in decreased expression of NT5E mRNA CTD PMID:24758408 more ... Nt5e Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO NT5E (Homo sapiens) 6480464 2 more ... CTD PMID:38568856 Nt5e Rat 2,2',4,4'-Tetrabromodiphenyl ether affects expression ISO Nt5e (Mus musculus) 6480464 2 more ... CTD PMID:30294300 Nt5e Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Nt5e (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NT5E mRNA CTD PMID:21354282 Nt5e Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of NT5E mRNA CTD PMID:34747641 Nt5e Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of NT5E mRNA CTD PMID:32109520 and PMID:33387578 Nt5e Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Nt5e (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of NT5E mRNA CTD PMID:26377647 Nt5e Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO NT5E (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of NT5E mRNA CTD PMID:22298810 and PMID:22574217 Nt5e Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO NT5E (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of NT5E mRNA CTD PMID:20106945 and PMID:21632981 Nt5e Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Nt5e (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of NT5E mRNA CTD PMID:19933214 and PMID:21889950 Nt5e Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Nt5e (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Nt5e Rat 2,4-dinitrobenzenesulfonic acid multiple interactions ISO Nt5e (Mus musculus) 6480464 [2 and 4-dinitrobenzenesulfonic acid co-treated with GR 159897] results in increased expression of NT5E mRNA CTD PMID:30116771 Nt5e Rat 2,4-dinitrobenzenesulfonic acid decreases expression ISO Nt5e (Mus musculus) 6480464 2 and 4-dinitrobenzenesulfonic acid results in decreased expression of NT5E mRNA CTD PMID:30116771 Nt5e Rat 2-palmitoylglycerol increases expression ISO NT5E (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of NT5E mRNA CTD PMID:37199045 Nt5e Rat 3,3',4,4',5-pentachlorobiphenyl decreases expression EXP 6480464 3 more ... CTD PMID:23196670 Nt5e Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO NT5E (Homo sapiens) 6480464 tetrabromobisphenol A results in decreased expression of NT5E protein CTD PMID:31675489 Nt5e Rat 3,3',5-triiodo-L-thyronine increases expression EXP 6480464 Triiodothyronine results in increased expression of NT5E mRNA CTD PMID:15543949 Nt5e Rat 3,3',5-triiodo-L-thyronine increases activity EXP 6480464 Triiodothyronine results in increased activity of NT5E protein CTD PMID:15543949 Nt5e Rat 3,4-dichloroaniline increases expression ISO NT5E (Homo sapiens) 6480464 3 and 4-dichloroaniline results in increased expression of NT5E mRNA CTD PMID:24172598 Nt5e Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Nt5e (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of NT5E mRNA CTD PMID:26251327 Nt5e Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of NT5E mRNA CTD PMID:28522335 Nt5e Rat 4,4'-diaminodiphenylmethane affects expression ISO Nt5e (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of NT5E mRNA CTD PMID:18648102 Nt5e Rat 4,4'-sulfonyldiphenol increases expression ISO Nt5e (Mus musculus) 6480464 bisphenol S results in increased expression of NT5E mRNA CTD PMID:30951980 Nt5e Rat 4,4'-sulfonyldiphenol decreases expression ISO Nt5e (Mus musculus) 6480464 bisphenol S results in decreased expression of NT5E mRNA CTD PMID:39298647 Nt5e Rat 4-hydroxyphenyl retinamide decreases expression ISO Nt5e (Mus musculus) 6480464 Fenretinide results in decreased expression of NT5E mRNA CTD PMID:28973697 Nt5e Rat 4-hydroxyphenyl retinamide increases expression ISO Nt5e (Mus musculus) 6480464 Fenretinide results in increased expression of NT5E mRNA CTD PMID:28973697 Nt5e Rat 5-aza-2'-deoxycytidine increases expression ISO NT5E (Homo sapiens) 6480464 Decitabine results in increased expression of NT5E mRNA CTD PMID:16367923 Nt5e Rat 5-azacytidine increases expression ISO NT5E (Homo sapiens) 6480464 Azacitidine results in increased expression of NT5E mRNA CTD PMID:20823114 Nt5e Rat 5-fluorouracil increases expression ISO NT5E (Homo sapiens) 6480464 Fluorouracil results in increased expression of NT5E mRNA CTD PMID:24737281 Nt5e Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of NT5E mRNA CTD PMID:24780913 Nt5e Rat adenosine multiple interactions ISO Nt5e (Mus musculus) 6480464 [alpha and beta-methyleneadenosine 5'-diphosphate results in decreased activity of NT5E protein] inhibits the reaction [Oxygen deficiency results in increased abundance of Adenosine] CTD PMID:23437309 Nt5e Rat ADP decreases activity ISO NT5E (Homo sapiens) 6480464 Adenosine Diphosphate analog results in decreased activity of NT5E protein CTD PMID:18404487 Nt5e Rat aflatoxin B1 decreases expression ISO Nt5e (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of NT5E mRNA CTD PMID:19770486 Nt5e Rat all-trans-retinoic acid increases expression ISO NT5E (Homo sapiens) 6480464 Tretinoin results in increased expression of NT5E mRNA CTD PMID:23830798 Nt5e Rat antimycin A increases expression ISO Nt5e (Mus musculus) 6480464 Antimycin A results in increased expression of NT5E mRNA CTD PMID:19304788 Nt5e Rat aripiprazole multiple interactions ISO NT5E (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of NT5E mRNA CTD PMID:31476115 Nt5e Rat aristolochic acid A decreases expression ISO NT5E (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of NT5E mRNA CTD PMID:33212167 Nt5e Rat arsane multiple interactions ISO NT5E (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of NT5E mRNA CTD PMID:32525701 Nt5e Rat arsenic atom multiple interactions ISO NT5E (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of NT5E mRNA CTD PMID:32525701 Nt5e Rat arsenite(3-) multiple interactions ISO NT5E (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to NT5E protein] CTD PMID:32406909 Nt5e Rat arsenous acid decreases expression ISO NT5E (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of NT5E mRNA CTD PMID:22521957 Nt5e Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of NT5E gene CTD PMID:28931070 Nt5e Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of NT5E mRNA CTD PMID:36841081 Nt5e Rat benzo[a]pyrene multiple interactions ISO Nt5e (Mus musculus) 6480464 Quercetin inhibits the reaction [Benzo(a)pyrene results in increased activity of NT5E protein] CTD PMID:18057710 Nt5e Rat benzo[a]pyrene decreases expression ISO NT5E (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of NT5E mRNA CTD PMID:32234424 Nt5e Rat benzo[a]pyrene decreases methylation ISO NT5E (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of NT5E promoter CTD PMID:27901495 Nt5e Rat benzo[a]pyrene affects methylation ISO NT5E (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of NT5E 3' UTR CTD PMID:27901495 Nt5e Rat benzo[a]pyrene increases activity ISO Nt5e (Mus musculus) 6480464 Benzo(a)pyrene results in increased activity of NT5E protein CTD PMID:18057710 Nt5e Rat benzo[b]fluoranthene increases expression ISO Nt5e (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of NT5E mRNA CTD PMID:26377693 Nt5e Rat beta-naphthoflavone decreases expression ISO NT5E (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of NT5E mRNA CTD PMID:32858204 Nt5e Rat betalain decreases expression ISO Nt5e (Mus musculus) 6480464 Betalains results in decreased expression of NT5E protein CTD PMID:33522684 Nt5e Rat bis(2-ethylhexyl) phthalate increases expression ISO NT5E (Homo sapiens) 6480464 Diethylhexyl Phthalate results in increased expression of NT5E mRNA CTD PMID:31163220 Nt5e Rat bisphenol A increases expression ISO NT5E (Homo sapiens) 6480464 bisphenol A results in increased expression of NT5E mRNA CTD PMID:22576693 Nt5e Rat bisphenol A increases expression ISO Nt5e (Mus musculus) 6480464 bisphenol A results in increased expression of NT5E mRNA CTD PMID:32156529 Nt5e Rat bisphenol A decreases expression ISO NT5E (Homo sapiens) 6480464 bisphenol A results in decreased expression of NT5E protein CTD PMID:31675489 Nt5e Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of NT5E mRNA CTD PMID:25181051 more ... Nt5e Rat bisphenol A decreases methylation ISO NT5E (Homo sapiens) 6480464 bisphenol A results in decreased methylation of NT5E gene CTD PMID:22576693 Nt5e Rat bisphenol AF increases expression ISO NT5E (Homo sapiens) 6480464 bisphenol AF results in increased expression of NT5E protein CTD PMID:34186270 Nt5e Rat Bisphenol B increases expression ISO NT5E (Homo sapiens) 6480464 bisphenol B results in increased expression of NT5E protein CTD PMID:34186270 Nt5e Rat bisphenol F increases expression ISO Nt5e (Mus musculus) 6480464 bisphenol F results in increased expression of NT5E mRNA CTD PMID:30951980 and PMID:38685157 Nt5e Rat bisphenol F increases expression ISO NT5E (Homo sapiens) 6480464 bisphenol F results in increased expression of NT5E protein CTD PMID:34186270 Nt5e Rat bortezomib decreases expression ISO NT5E (Homo sapiens) 6480464 Bortezomib results in decreased expression of NT5E mRNA CTD PMID:20977926 Nt5e Rat bucladesine multiple interactions ISO NT5E (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of NT5E mRNA CTD PMID:20823114 Nt5e Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of NT5E mRNA CTD PMID:24136188 Nt5e Rat cadmium dichloride decreases expression ISO NT5E (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of NT5E mRNA CTD PMID:26314618 Nt5e Rat cadmium dichloride increases expression ISO NT5E (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of NT5E mRNA CTD PMID:38568856 Nt5e Rat caffeine decreases activity EXP 6480464 Caffeine results in decreased activity of NT5E protein CTD PMID:28465162 Nt5e Rat caffeine multiple interactions EXP 6480464 caffeic acid inhibits the reaction [Caffeine results in decreased activity of NT5E protein] and Caffeine promotes the reaction [caffeic acid results in decreased activity of NT5E protein] CTD PMID:28465162 Nt5e Rat cannabidiol increases expression ISO NT5E (Homo sapiens) 6480464 Cannabidiol results in increased expression of NT5E mRNA CTD PMID:27932991 Nt5e Rat carbon nanotube decreases expression ISO Nt5e (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of NT5E mRNA CTD PMID:25620056 Nt5e Rat cerium trichloride decreases expression ISO Nt5e (Mus musculus) 6480464 cerous chloride results in decreased expression of NT5E mRNA CTD PMID:23139204 Nt5e Rat chloropicrin decreases expression ISO NT5E (Homo sapiens) 6480464 chloropicrin results in decreased expression of NT5E mRNA CTD PMID:28476498 Nt5e Rat chloropicrin affects expression ISO NT5E (Homo sapiens) 6480464 chloropicrin affects the expression of NT5E mRNA CTD PMID:26352163 Nt5e Rat choline multiple interactions ISO Nt5e (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of NT5E mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of NT5E mRNA CTD PMID:20938992 and PMID:29127188 Nt5e Rat chromium(6+) multiple interactions ISO NT5E (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of NT5E mRNA CTD PMID:38479592 Nt5e Rat ciguatoxin CTX1B affects expression ISO Nt5e (Mus musculus) 6480464 Ciguatoxins affects the expression of NT5E mRNA CTD PMID:18353800 Nt5e Rat cis-caffeic acid multiple interactions EXP 6480464 caffeic acid inhibits the reaction [Caffeine results in decreased activity of NT5E protein] and Caffeine promotes the reaction [caffeic acid results in decreased activity of NT5E protein] CTD PMID:28465162 Nt5e Rat cis-caffeic acid decreases activity EXP 6480464 caffeic acid results in decreased activity of NT5E protein CTD PMID:28465162 Nt5e Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of NT5E mRNA CTD PMID:24386269 Nt5e Rat cobalt dichloride increases expression ISO NT5E (Homo sapiens) 6480464 cobaltous chloride results in increased expression of NT5E protein CTD PMID:27899277 Nt5e Rat cobalt dichloride increases expression ISO Nt5e (Mus musculus) 6480464 cobaltous chloride results in increased expression of NT5E protein CTD PMID:27590504 Nt5e Rat cobalt dichloride decreases expression ISO NT5E (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of NT5E mRNA CTD PMID:17553155 and PMID:19376846 Nt5e Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of NT5E mRNA CTD PMID:22465980 Nt5e Rat copper atom multiple interactions ISO NT5E (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of NT5E mRNA CTD PMID:24690739 Nt5e Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of NT5E mRNA CTD PMID:22465980 Nt5e Rat copper(0) multiple interactions ISO NT5E (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of NT5E mRNA CTD PMID:24690739 Nt5e Rat copper(II) chloride increases expression ISO NT5E (Homo sapiens) 6480464 cupric chloride results in increased expression of NT5E mRNA CTD PMID:38568856 Nt5e Rat coumestrol multiple interactions ISO NT5E (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of NT5E mRNA CTD PMID:19167446 Nt5e Rat coumestrol decreases expression ISO NT5E (Homo sapiens) 6480464 Coumestrol results in decreased expression of NT5E mRNA CTD PMID:19167446 Nt5e Rat crocidolite asbestos increases expression ISO NT5E (Homo sapiens) 6480464 Asbestos and Crocidolite results in increased expression of NT5E mRNA CTD PMID:18687144 Nt5e Rat crocidolite asbestos decreases expression ISO Nt5e (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of NT5E mRNA CTD PMID:29279043 Nt5e Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of NT5E mRNA CTD PMID:26577399 and PMID:27523638 Nt5e Rat cyclosporin A increases expression ISO NT5E (Homo sapiens) 6480464 Cyclosporine results in increased expression of NT5E mRNA CTD PMID:21632981 Nt5e Rat cyclosporin A affects expression ISO NT5E (Homo sapiens) 6480464 Cyclosporine affects the expression of NT5E mRNA CTD PMID:20106945 and PMID:25562108 Nt5e Rat deguelin multiple interactions ISO NT5E (Homo sapiens) 6480464 deguelin inhibits the reaction [Oxygen deficiency results in increased expression of NT5E protein] CTD PMID:27899277 Nt5e Rat dexamethasone increases expression ISO Nt5e (Mus musculus) 6480464 Dexamethasone results in increased expression of NT5E mRNA CTD PMID:22733784 Nt5e Rat diarsenic trioxide decreases expression ISO NT5E (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of NT5E mRNA CTD PMID:22521957 Nt5e Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of NT5E mRNA CTD PMID:21266533 Nt5e Rat dibutyl phthalate increases expression ISO Nt5e (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of NT5E mRNA CTD PMID:17361019 and PMID:21266533 Nt5e Rat diclofenac increases expression ISO Nt5e (Mus musculus) 6480464 Diclofenac results in increased expression of NT5E mRNA CTD PMID:35537566 Nt5e Rat dicrotophos decreases expression ISO NT5E (Homo sapiens) 6480464 dicrotophos results in decreased expression of NT5E mRNA CTD PMID:28302478 Nt5e Rat dimethylarsinic acid multiple interactions ISO Nt5e (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of NT5E mRNA CTD PMID:34876320 Nt5e Rat dioxygen increases expression ISO Nt5e (Mus musculus) 6480464 Oxygen deficiency results in increased expression of NT5E mRNA and Oxygen deficiency results in increased expression of NT5E protein CTD PMID:20880076 and PMID:23437309 Nt5e Rat dioxygen multiple interactions ISO NT5E (Homo sapiens) 6480464 17-(dimethylaminoethylamino)-17-demethoxygeldanamycin inhibits the reaction [Oxygen deficiency results in increased expression of NT5E protein] more ... CTD PMID:27899277 Nt5e Rat dioxygen increases expression ISO NT5E (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of NT5E mRNA and Oxygen deficiency results in increased expression of NT5E protein CTD PMID:27899277 Nt5e Rat dioxygen multiple interactions ISO Nt5e (Mus musculus) 6480464 [alpha and beta-methyleneadenosine 5'-diphosphate results in decreased activity of NT5E protein] inhibits the reaction [Oxygen deficiency results in increased abundance of Adenosine] CTD PMID:23437309 Nt5e Rat disulfiram multiple interactions ISO NT5E (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in increased expression of NT5E mRNA CTD PMID:24690739 Nt5e Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of NT5E mRNA CTD PMID:25152437 Nt5e Rat diuron increases expression ISO NT5E (Homo sapiens) 6480464 Diuron metabolite results in increased expression of NT5E mRNA CTD PMID:24172598 Nt5e Rat dorsomorphin multiple interactions ISO NT5E (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nt5e Rat doxorubicin decreases expression ISO NT5E (Homo sapiens) 6480464 Doxorubicin results in decreased expression of NT5E mRNA CTD PMID:29803840 Nt5e Rat doxorubicin increases expression ISO Nt5e (Mus musculus) 6480464 Doxorubicin results in increased expression of NT5E mRNA CTD PMID:36227756 Nt5e Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of NT5E mRNA CTD PMID:29391264 Nt5e Rat Enterolactone multiple interactions ISO NT5E (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of NT5E mRNA CTD PMID:19167446 Nt5e Rat ethanol increases expression EXP 6480464 Ethanol results in increased expression of NT5E mRNA CTD PMID:17920746 Nt5e Rat ethanol multiple interactions ISO Nt5e (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of NT5E mRNA CTD PMID:30517762 Nt5e Rat ethanol affects expression ISO Nt5e (Mus musculus) 6480464 Ethanol affects the expression of NT5E mRNA CTD PMID:19167417 and PMID:30319688 Nt5e Rat ethyl methanesulfonate increases expression ISO NT5E (Homo sapiens) 6480464 Ethyl Methanesulfonate results in increased expression of NT5E mRNA CTD PMID:23649840 Nt5e Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of NT5E mRNA CTD PMID:24136188 and PMID:24793618 Nt5e Rat folic acid multiple interactions ISO Nt5e (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of NT5E mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of NT5E mRNA CTD PMID:20938992 and PMID:29127188 Nt5e Rat formaldehyde increases expression ISO NT5E (Homo sapiens) 6480464 Formaldehyde results in increased expression of NT5E mRNA CTD PMID:23649840 Nt5e Rat formaldehyde decreases expression ISO NT5E (Homo sapiens) 6480464 Formaldehyde results in decreased expression of NT5E mRNA CTD PMID:28937961 Nt5e Rat furan increases methylation EXP 6480464 furan results in increased methylation of NT5E gene CTD PMID:22079235 Nt5e Rat genistein decreases expression ISO NT5E (Homo sapiens) 6480464 Genistein results in decreased expression of NT5E mRNA CTD PMID:26865667 Nt5e Rat genistein decreases expression ISO Nt5e (Mus musculus) 6480464 Genistein results in decreased expression of NT5E mRNA CTD PMID:32186404 Nt5e Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of NT5E mRNA CTD PMID:22061828 Nt5e Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of NT5E mRNA CTD PMID:24136188 Nt5e Rat homocysteine affects activity ISO Nt5e (Mus musculus) 6480464 Homocysteine affects the activity of NT5E protein CTD PMID:24055814 Nt5e Rat hydrogen cyanide increases expression ISO Nt5e (Mus musculus) 6480464 Hydrogen Cyanide results in increased expression of NT5E mRNA CTD PMID:33914522 Nt5e Rat indometacin multiple interactions ISO NT5E (Homo sapiens) 6480464 Indomethacin results in increased expression of and results in increased activity of NT5E protein CTD PMID:17568578 Nt5e Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of NT5E mRNA CTD PMID:36868495 Nt5e Rat indometacin increases expression ISO NT5E (Homo sapiens) 6480464 Indomethacin results in increased expression of NT5E mRNA CTD PMID:17568578 Nt5e Rat ivermectin decreases expression ISO NT5E (Homo sapiens) 6480464 Ivermectin results in decreased expression of NT5E protein CTD PMID:32959892 Nt5e Rat L-methionine multiple interactions ISO Nt5e (Mus musculus) 6480464 [Choline deficiency co-treated with Folic Acid deficiency co-treated with Methionine deficiency] results in increased expression of NT5E mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of NT5E mRNA CTD PMID:20938992 and PMID:29127188 Nt5e Rat lead diacetate increases expression ISO NT5E (Homo sapiens) 6480464 lead acetate results in increased expression of NT5E mRNA CTD PMID:38568856 Nt5e Rat lipopolysaccharide multiple interactions ISO NT5E (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of NT5E mRNA CTD PMID:35811015 Nt5e Rat medroxyprogesterone acetate decreases expression ISO NT5E (Homo sapiens) 6480464 Medroxyprogesterone Acetate results in decreased expression of NT5E mRNA CTD PMID:20843944 Nt5e Rat medroxyprogesterone acetate multiple interactions ISO NT5E (Homo sapiens) 6480464 [Estradiol co-treated with Bucladesine co-treated with Medroxyprogesterone Acetate] results in increased expression of NT5E mRNA CTD PMID:20823114 Nt5e Rat mercury dibromide multiple interactions ISO NT5E (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NT5E mRNA CTD PMID:27188386 Nt5e Rat mercury dichloride decreases activity EXP 6480464 Mercuric Chloride results in decreased activity of NT5E protein CTD PMID:22416658 Nt5e Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of NT5E mRNA CTD PMID:30467583 Nt5e Rat methylarsonic acid multiple interactions ISO Nt5e (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of NT5E mRNA CTD PMID:34876320 Nt5e Rat methylisothiazolinone increases expression ISO NT5E (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of NT5E mRNA CTD PMID:31629900 Nt5e Rat N-nitrosodiethylamine multiple interactions ISO Nt5e (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of NT5E mRNA CTD PMID:24535843 Nt5e Rat N-nitrosodiethylamine increases expression ISO Nt5e (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of NT5E mRNA CTD PMID:24535843 Nt5e Rat nefazodone decreases expression EXP 6480464 nefazodone results in decreased expression of NT5E mRNA CTD PMID:24136188 Nt5e Rat nickel atom increases expression ISO NT5E (Homo sapiens) 6480464 Nickel results in increased expression of NT5E mRNA CTD PMID:24768652 and PMID:25583101 Nt5e Rat nimesulide decreases expression EXP 6480464 nimesulide results in decreased expression of NT5E mRNA CTD PMID:24136188 Nt5e Rat nimesulide multiple interactions ISO Nt5e (Mus musculus) 6480464 NT5E protein affects the reaction [nimesulide inhibits the reaction [lipopolysaccharide and Escherichia coli O111 B4 results in increased abundance of Nitrites]] CTD PMID:27188793 Nt5e Rat nitrites multiple interactions ISO Nt5e (Mus musculus) 6480464 NT5E protein affects the reaction [nimesulide inhibits the reaction [lipopolysaccharide and Escherichia coli O111 B4 results in increased abundance of Nitrites]] CTD PMID:27188793 Nt5e Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of NT5E mRNA CTD PMID:25729387 Nt5e Rat ozone multiple interactions ISO NT5E (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of NT5E mRNA CTD PMID:31476115 Nt5e Rat ozone multiple interactions ISO Nt5e (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of NT5E mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of NT5E mRNA CTD PMID:34911549 Nt5e Rat ozone increases expression EXP 6480464 Ozone results in increased expression of NT5E protein CTD PMID:33146391 Nt5e Rat ozone increases expression ISO NT5E (Homo sapiens) 6480464 Ozone results in increased expression of NT5E mRNA CTD PMID:31476115 Nt5e Rat paracetamol decreases expression ISO NT5E (Homo sapiens) 6480464 Acetaminophen results in decreased expression of NT5E mRNA CTD PMID:21420995 and PMID:22230336 Nt5e Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of NT5E mRNA CTD PMID:33387578 Nt5e Rat paraquat increases expression ISO Nt5e (Mus musculus) 6480464 Paraquat results in increased expression of NT5E mRNA CTD PMID:12595580 Nt5e Rat perfluorononanoic acid decreases expression ISO NT5E (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of NT5E mRNA CTD PMID:32588087 Nt5e Rat perfluorooctane-1-sulfonic acid affects expression ISO Nt5e (Mus musculus) 6480464 perfluorooctane sulfonic acid affects the expression of NT5E mRNA CTD PMID:19429403 Nt5e Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Nt5e (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of NT5E mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in increased expression of NT5E mRNA CTD PMID:36331819 Nt5e Rat perfluorooctanoic acid affects expression ISO Nt5e (Mus musculus) 6480464 perfluorooctanoic acid affects the expression of NT5E mRNA CTD PMID:19429403 Nt5e Rat phenobarbital increases expression ISO Nt5e (Mus musculus) 6480464 Phenobarbital results in increased expression of NT5E mRNA CTD PMID:19482888 Nt5e Rat phenobarbital affects expression ISO Nt5e (Mus musculus) 6480464 Phenobarbital affects the expression of NT5E mRNA CTD PMID:23091169 Nt5e Rat phenobarbital multiple interactions ISO Nt5e (Mus musculus) 6480464 [Diethylnitrosamine co-treated with Phenobarbital] results in increased expression of NT5E mRNA and NR1I3 protein affects the reaction [Phenobarbital results in increased expression of NT5E mRNA] CTD PMID:19482888 and PMID:24535843 Nt5e Rat phenylmercury acetate increases expression ISO NT5E (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of NT5E mRNA CTD PMID:26272509 Nt5e Rat phenylmercury acetate multiple interactions ISO NT5E (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of NT5E mRNA CTD PMID:27188386 Nt5e Rat pirinixic acid multiple interactions ISO NT5E (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of NT5E mRNA CTD PMID:19710929 Nt5e Rat pirinixic acid increases expression ISO Nt5e (Mus musculus) 6480464 pirinixic acid results in increased expression of NT5E mRNA CTD PMID:20813756 and PMID:23811191 Nt5e Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of NT5E mRNA CTD PMID:16940010 Nt5e Rat pirinixic acid decreases expression ISO Nt5e (Mus musculus) 6480464 pirinixic acid results in decreased expression of NT5E mRNA CTD PMID:17426115 Nt5e Rat pirinixic acid multiple interactions ISO Nt5e (Mus musculus) 6480464 [pirinixic acid co-treated with PPARA] results in increased expression of NT5E mRNA CTD PMID:20813756 Nt5e Rat potassium chromate increases expression ISO NT5E (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of NT5E mRNA CTD PMID:22714537 Nt5e Rat potassium cyanide increases expression ISO Nt5e (Mus musculus) 6480464 Potassium Cyanide results in increased expression of NT5E mRNA CTD PMID:33914522 Nt5e Rat pregnenolone 16alpha-carbonitrile decreases expression ISO Nt5e (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of NT5E mRNA CTD PMID:28903501 Nt5e Rat progesterone increases expression EXP 6480464 Progesterone results in increased expression of NT5E mRNA CTD PMID:20726854 Nt5e Rat progesterone decreases expression ISO NT5E (Homo sapiens) 6480464 Progesterone results in decreased expression of NT5E mRNA CTD PMID:20864642 Nt5e Rat quercetin decreases activity ISO NT5E (Homo sapiens) 6480464 Quercetin results in decreased activity of NT5E protein CTD PMID:17643826 Nt5e Rat quercetin decreases expression ISO Nt5e (Mus musculus) 6480464 Quercetin results in decreased expression of NT5E mRNA CTD PMID:25862958 Nt5e Rat quercetin decreases expression ISO NT5E (Homo sapiens) 6480464 Quercetin results in decreased expression of NT5E mRNA CTD PMID:17643826 and PMID:21632981 Nt5e Rat quercetin multiple interactions ISO Nt5e (Mus musculus) 6480464 Quercetin inhibits the reaction [Benzo(a)pyrene results in increased activity of NT5E protein] CTD PMID:18057710 Nt5e Rat rotenone increases expression ISO Nt5e (Mus musculus) 6480464 Rotenone results in increased expression of NT5E mRNA CTD PMID:19304788 Nt5e Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO NT5E (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of NT5E mRNA CTD PMID:35811015 Nt5e Rat SB 431542 multiple interactions ISO NT5E (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Nt5e Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of NT5E mRNA CTD PMID:32721576 Nt5e Rat silicon dioxide decreases expression ISO Nt5e (Mus musculus) 6480464 Silicon Dioxide results in decreased expression of NT5E mRNA CTD PMID:29203145 Nt5e Rat sodium arsenate increases expression ISO Nt5e (Mus musculus) 6480464 sodium arsenate results in increased expression of NT5E mRNA CTD PMID:21795629 Nt5e Rat sodium arsenate multiple interactions ISO Nt5e (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of NT5E mRNA CTD PMID:34876320 Nt5e Rat sodium arsenate multiple interactions ISO NT5E (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in increased expression of NT5E mRNA CTD PMID:32525701 Nt5e Rat sodium arsenite increases expression ISO NT5E (Homo sapiens) 6480464 sodium arsenite results in increased expression of NT5E mRNA CTD PMID:38568856 Nt5e Rat sodium arsenite multiple interactions ISO Nt5e (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of NT5E mRNA CTD PMID:34876320 Nt5e Rat sodium dichromate decreases expression ISO Nt5e (Mus musculus) 6480464 sodium bichromate results in decreased expression of NT5E mRNA CTD PMID:22155349 Nt5e Rat sodium dichromate decreases expression EXP 6480464 sodium bichromate results in decreased expression of NT5E mRNA CTD PMID:22561333 Nt5e Rat sotorasib multiple interactions ISO NT5E (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of NT5E mRNA CTD PMID:36139627 Nt5e Rat streptozocin multiple interactions ISO Nt5e (Mus musculus) 6480464 [Streptozocin co-treated with Dietary Fats] results in increased expression of NT5E mRNA CTD PMID:29127188 Nt5e Rat temozolomide decreases expression ISO NT5E (Homo sapiens) 6480464 Temozolomide results in decreased expression of NT5E mRNA CTD PMID:31758290 Nt5e Rat tenofovir disoproxil fumarate increases expression ISO NT5E (Homo sapiens) 6480464 Tenofovir results in increased expression of NT5E mRNA CTD PMID:24205323 Nt5e Rat testosterone decreases expression ISO Nt5e (Mus musculus) 6480464 Testosterone results in decreased expression of NT5E mRNA CTD PMID:15788153 more ... Nt5e Rat tetrachloromethane multiple interactions ISO Nt5e (Mus musculus) 6480464 [Carbon Tetrachloride co-treated with Ethanol] results in increased expression of NT5E mRNA more ... CTD PMID:18263696 and PMID:30517762 Nt5e Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of NT5E mRNA] CTD PMID:31150632 Nt5e Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of NT5E mRNA CTD PMID:31150632 Nt5e Rat tetrachloromethane affects expression ISO Nt5e (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of NT5E mRNA CTD PMID:17484886 Nt5e Rat tetrachloromethane increases response to substance ISO Nt5e (Mus musculus) 6480464 NT5E protein results in increased susceptibility to Carbon Tetrachloride CTD PMID:18263696 Nt5e Rat thalidomide decreases expression ISO Nt5e (Mus musculus) 6480464 Thalidomide results in decreased expression of NT5E mRNA CTD PMID:26217789 Nt5e Rat thioacetamide increases response to substance ISO Nt5e (Mus musculus) 6480464 NT5E protein results in increased susceptibility to Thioacetamide CTD PMID:18263696 Nt5e Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of NT5E mRNA CTD PMID:34492290 Nt5e Rat thioacetamide decreases response to substance ISO Nt5e (Mus musculus) 6480464 NT5E protein results in decreased susceptibility to Thioacetamide CTD PMID:27899277 Nt5e Rat thioacetamide increases expression ISO Nt5e (Mus musculus) 6480464 Thioacetamide results in increased expression of NT5E mRNA and Thioacetamide results in increased expression of NT5E protein CTD PMID:27899277 Nt5e Rat thiram increases expression ISO NT5E (Homo sapiens) 6480464 Thiram results in increased expression of NT5E mRNA CTD PMID:38568856 Nt5e Rat trametinib multiple interactions ISO NT5E (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of NT5E mRNA CTD PMID:36139627 Nt5e Rat trans-caffeic acid multiple interactions EXP 6480464 caffeic acid inhibits the reaction [Caffeine results in decreased activity of NT5E protein] and Caffeine promotes the reaction [caffeic acid results in decreased activity of NT5E protein] CTD PMID:28465162 Nt5e Rat trans-caffeic acid decreases activity EXP 6480464 caffeic acid results in decreased activity of NT5E protein CTD PMID:28465162 Nt5e Rat trichostatin A increases expression ISO NT5E (Homo sapiens) 6480464 trichostatin A results in increased expression of NT5E mRNA CTD PMID:24935251 Nt5e Rat triphenyl phosphate affects expression ISO NT5E (Homo sapiens) 6480464 triphenyl phosphate affects the expression of NT5E mRNA CTD PMID:37042841 Nt5e Rat triptonide increases expression ISO Nt5e (Mus musculus) 6480464 triptonide results in increased expression of NT5E mRNA CTD PMID:33045310 Nt5e Rat tris(2-butoxyethyl) phosphate decreases expression ISO NT5E (Homo sapiens) 6480464 tris(2-butoxyethyl) phosphate results in decreased expression of NT5E mRNA CTD PMID:29024780 Nt5e Rat troglitazone increases expression ISO Nt5e (Mus musculus) 6480464 troglitazone results in increased expression of NT5E mRNA CTD PMID:28973697 Nt5e Rat uranium atom affects expression ISO NT5E (Homo sapiens) 6480464 Uranium affects the expression of NT5E mRNA CTD PMID:15672453 Nt5e Rat valproic acid decreases expression ISO NT5E (Homo sapiens) 6480464 Valproic Acid results in decreased expression of NT5E mRNA CTD PMID:23179753 Nt5e Rat valproic acid increases expression ISO NT5E (Homo sapiens) 6480464 Valproic Acid results in increased expression of NT5E mRNA CTD PMID:24935251 Nt5e Rat valproic acid decreases methylation ISO NT5E (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of NT5E gene CTD PMID:29154799 Nt5e Rat vincristine increases expression ISO NT5E (Homo sapiens) 6480464 Vincristine results in increased expression of NT5E mRNA CTD PMID:23649840 Nt5e Rat withaferin A increases expression ISO NT5E (Homo sapiens) 6480464 withaferin A results in increased expression of NT5E mRNA CTD PMID:33665778
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(+)-schisandrin B (EXP) (-)-demecolcine (ISO) (1->4)-beta-D-glucan (ISO) 1,2-dichloroethane (ISO) 1,2-dimethylhydrazine (EXP,ISO) 1-nitropyrene (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrobenzenesulfonic acid (ISO) 2-palmitoylglycerol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,3',5-triiodo-L-thyronine (EXP) 3,4-dichloroaniline (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-azacytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) adenosine (ISO) ADP (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) antimycin A (ISO) aripiprazole (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (EXP) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) beta-naphthoflavone (ISO) betalain (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bortezomib (ISO) bucladesine (ISO) buspirone (EXP) cadmium dichloride (ISO) caffeine (EXP) cannabidiol (ISO) carbon nanotube (ISO) cerium trichloride (ISO) chloropicrin (ISO) choline (ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) cis-caffeic acid (EXP) cobalt dichloride (EXP,ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) chloride (ISO) coumestrol (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) deguelin (ISO) dexamethasone (ISO) diarsenic trioxide (ISO) dibutyl phthalate (EXP,ISO) diclofenac (ISO) dicrotophos (ISO) dimethylarsinic acid (ISO) dioxygen (ISO) disulfiram (ISO) diuron (EXP,ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) Enterolactone (ISO) ethanol (EXP,ISO) ethyl methanesulfonate (ISO) flutamide (EXP) folic acid (ISO) formaldehyde (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) glafenine (EXP) homocysteine (ISO) hydrogen cyanide (ISO) indometacin (EXP,ISO) ivermectin (ISO) L-methionine (ISO) lead diacetate (ISO) lipopolysaccharide (ISO) medroxyprogesterone acetate (ISO) mercury dibromide (ISO) mercury dichloride (EXP) methapyrilene (EXP) methylarsonic acid (ISO) methylisothiazolinone (ISO) N-nitrosodiethylamine (ISO) nefazodone (EXP) nickel atom (ISO) nimesulide (EXP,ISO) nitrites (ISO) oxaliplatin (EXP) ozone (EXP,ISO) paracetamol (EXP,ISO) paraquat (ISO) perfluorononanoic acid (ISO) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pirinixic acid (EXP,ISO) potassium chromate (ISO) potassium cyanide (ISO) pregnenolone 16alpha-carbonitrile (ISO) progesterone (EXP,ISO) quercetin (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) silicon dioxide (EXP,ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dichromate (EXP,ISO) sotorasib (ISO) streptozocin (ISO) temozolomide (ISO) tenofovir disoproxil fumarate (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thalidomide (ISO) thioacetamide (EXP,ISO) thiram (ISO) trametinib (ISO) trans-caffeic acid (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) triptonide (ISO) tris(2-butoxyethyl) phosphate (ISO) troglitazone (ISO) uranium atom (ISO) valproic acid (ISO) vincristine (ISO) withaferin A (ISO)
Biological Process
adenosine biosynthetic process (IEA,IMP,ISO) adenosine metabolic process (IDA) ADP catabolic process (IEA,ISO) AMP catabolic process (IBA,IDA,IEA,IMP,ISO) ATP metabolic process (IEA,ISO) calcium ion homeostasis (IEA,ISO) inhibition of non-skeletal tissue mineralization (IEA,ISO) leukocyte cell-cell adhesion (IEA,ISO) negative regulation of inflammatory response (IEA,ISO) nucleotide catabolic process (IEA) positive regulation of lipid biosynthetic process (IEP) response to aluminum ion (IEP) response to ATP (IEA,ISO)
Molecular Function
5'-deoxynucleotidase activity (IEA,ISO) 5'-nucleotidase activity (IBA,IDA,IEA,ISO) ferrous iron binding (IDA) hydrolase activity (IEA) hydrolase activity, acting on ester bonds (IEA) identical protein binding (IEA,ISO) metal ion binding (IEA) nucleotide binding (IEA) obsolete GMP 5'-nucleotidase activity (IEA,ISO) obsolete IMP 5'-nucleotidase activity (IEA,ISO) obsolete thymidylate 5'-phosphatase activity (IEA,ISO) protein binding (ISO) zinc ion binding (IEA,ISO)
1.
Evidence for the involvement of cytosolic 5'-nucleotidase (cN-II) in the synthesis of guanine nucleotides from xanthosine.
Barsotti C, etal., J Biol Chem. 2005 Apr 8;280(14):13465-9. Epub 2005 Feb 6.
2.
The ecto-enzymes CD73 and adenosine deaminase modulate 5'-AMP-derived adenosine in myofibroblasts of the rat small intestine.
Bin A, etal., Purinergic Signal. 2018 Dec;14(4):409-421. doi: 10.1007/s11302-018-9623-6. Epub 2018 Sep 29.
3.
Dynamic changes in the expression pattern of ecto-5'-nucleotidase in the rat model of cortical stab injury.
Bjelobaba I, etal., J Neurosci Res. 2011 Jun;89(6):862-73. doi: 10.1002/jnr.22599. Epub 2011 Feb 17.
4.
Ontogenetic profile of ectonucleotidase activities from brain synaptosomes of pilocarpine-treated rats.
de Paula Cognato G, etal., Int J Dev Neurosci. 2005 Dec;23(8):703-9. Epub 2005 Nov 4.
5.
5'-Nucleotidase activity increases in aging rat brain.
Fuchs JL, Neurobiol Aging. 1991 Sep-Oct;12(5):523-30. doi: 10.1016/0197-4580(91)90083-v.
6.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
8.
The effect of aluminium on NTPDase and 5'-nucleotidase activities from rat synaptosomes and platelets.
Kaizer RR, etal., Int J Dev Neurosci. 2007 Oct;25(6):381-6. Epub 2007 Jul 10.
9.
KEGG: Kyoto Encyclopedia of Genes and Genomes
KEGG
10.
Oxidative modification of rat liver 5'-nucleotidase: the mechanisms for protection and re-activation.
Kocic G, etal., Arch Physiol Biochem 2001 Oct;109(4):323-30.
11.
Enzymes of adenosine metabolism in the brain: diurnal rhythm and the effect of sleep deprivation.
Mackiewicz M, etal., J Neurochem. 2003 Apr;85(2):348-57.
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
Primary structure of rat liver 5'-nucleotidase deduced from the cDNA. Presence of the COOH-terminal hydrophobic domain for possible post-translational modification by glycophospholipid.
Misumi Y, etal., J Biol Chem 1990 Feb 5;265(4):2178-83.
14.
Upregulation of Lipid Synthesis in Small Rat Adipocytes by Microvesicle-Associated CD73 From Large Adipocytes.
Muller G, etal., Obesity (Silver Spring). 2011 Mar 3.
15.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
17.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
18.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
19.
GOA pipeline
RGD automated data pipeline
20.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
21.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
22.
Ectonucleotidase and acetylcholinesterase activities in synaptosomes from the cerebral cortex of streptozotocin-induced diabetic rats and treated with resveratrol.
Schmatz R, etal., Brain Res Bull. 2009 Dec 16;80(6):371-6. Epub 2009 Aug 31.
23.
Subcellular localization and properties of 5'-nucleotidase in the rat liver.
Song CS and Bodansky O, J Biol Chem. 1967 Feb 25;242(4):694-9.
24.
Ontogenetic profile of ecto-5'-nucleotidase in rat brain synaptic plasma membranes.
Stanojevic I, etal., Int J Dev Neurosci. 2011 Jun;29(4):397-403. Epub 2011 Mar 23.
25.
Effect of In-Vitro Passaging on the Stem Cell-related Properties of Tendon-Derived Stem Cells (TDSCs) - Implication in Tissue Engineering.
Tan Q, etal., Stem Cells Dev. 2011 Jun 1.
26.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
Nt5e Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 98,150,925 - 98,195,646 (+) NCBI GRCr8 mRatBN7.2 8 89,271,046 - 89,314,918 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 89,270,696 - 89,314,881 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 94,940,630 - 94,984,431 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 93,139,844 - 93,183,642 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 90,998,970 - 91,042,930 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 95,969,002 - 96,012,733 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 95,968,652 - 96,012,696 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 95,464,591 - 95,508,322 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 93,591,630 - 93,635,481 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 93,610,734 - 93,654,911 (+) NCBI Celera 8 88,841,425 - 88,885,302 (+) NCBI Celera Cytogenetic Map 8 q31 NCBI
NT5E Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 85,450,083 - 85,495,784 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 85,449,584 - 85,495,791 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 86,159,801 - 86,205,502 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 86,216,528 - 86,262,215 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 86,216,527 - 86,262,215 NCBI Celera 6 86,586,482 - 86,632,679 (+) NCBI Celera Cytogenetic Map 6 q14.3 NCBI HuRef 6 83,383,590 - 83,429,793 (+) NCBI HuRef CHM1_1 6 86,257,244 - 86,303,451 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 86,666,882 - 86,712,587 (+) NCBI T2T-CHM13v2.0
Nt5e Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 88,209,662 - 88,254,142 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 88,209,250 - 88,254,145 (+) Ensembl GRCm39 Ensembl GRCm38 9 88,327,609 - 88,372,089 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 88,327,197 - 88,372,092 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 88,222,447 - 88,266,927 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 88,125,533 - 88,169,982 (+) NCBI MGSCv36 mm8 Celera 9 85,354,734 - 85,399,137 (+) NCBI Celera Cytogenetic Map 9 E3.1 NCBI cM Map 9 47.24 NCBI
Nt5e Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955411 12,891,236 - 12,948,406 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955411 12,891,236 - 12,946,324 (+) NCBI ChiLan1.0 ChiLan1.0
NT5E Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 105,532,410 - 105,584,140 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 103,429,147 - 103,478,675 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 83,333,428 - 83,379,585 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 86,615,409 - 86,661,594 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 86,615,409 - 86,661,601 (+) Ensembl panpan1.1 panPan2
NT5E Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 45,491,028 - 45,520,019 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 45,491,733 - 45,518,405 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 45,289,507 - 45,334,783 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 46,244,000 - 46,289,219 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 46,243,992 - 46,289,217 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 45,577,415 - 45,622,655 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 45,506,318 - 45,551,536 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 45,693,314 - 45,738,560 (+) NCBI UU_Cfam_GSD_1.0
Nt5e Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 80,624,771 - 80,673,677 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936510 5,797,212 - 5,846,124 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936510 5,797,218 - 5,846,118 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
NT5E Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 54,400,810 - 54,448,742 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 54,400,786 - 54,450,743 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 60,831,831 - 60,881,527 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
NT5E Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 13 10,115,591 - 10,162,178 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 13 10,116,161 - 10,160,414 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666040 186,303,608 - 186,348,855 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Nt5e
.
Predicted Target Of
Count of predictions: 318 Count of miRNA genes: 216 Interacting mature miRNAs: 252 Transcripts: ENSRNOT00000015057 Prediction methods: Microtar, Miranda, Rnahybrid Result types: miRGate_prediction
12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1300177 Cm2 Cardiac mass QTL 2 3.65 heart mass (VT:0007028) heart weight (CMO:0000017) 8 54259986 100382532 Rat 1549909 Stresp11 Stress response QTL 11 6.83 0.0019 stress-related behavior trait (VT:0010451) number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960) 8 73473045 118473045 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 9590292 Uminl3 Urine mineral level QTL 3 3.62 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 8 71888757 116888757 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 8693654 Alc32 Alcohol consumption QTL 32 2 0.755 drinking behavior trait (VT:0001422) calculated ethanol drink intake rate (CMO:0001615) 8 88612425 107550209 Rat 1358912 Bw51 Body weight QTL 51 2.95 body mass (VT:0001259) body weight (CMO:0000012) 8 51351728 107062046 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1300171 Bp184 Blood pressure QTL 184 3.66 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 8 70513503 118219066 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 2313400 Anxrr25 Anxiety related response QTL 25 aggression-related behavior trait (VT:0015014) tameness/aggressiveness composite score (CMO:0002136) 8 89265192 114019816 Rat 2303171 Bp331 Blood pressure QTL 331 5.57 0.005 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 61290298 119084929 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2293697 Bmd39 Bone mineral density QTL 39 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 8 54043744 98968765 Rat 631210 Bw3 Body weight QTL3 5.9 mesenteric fat pad mass (VT:0010427) mesenteric fat pad weight to body weight ratio (CMO:0000654) 8 69349194 112783834 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 1331837 Bw23 Body weight QTL 23 4.19 0.00007 body mass (VT:0001259) body weight (CMO:0000012) 8 46531722 99083736 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 8694446 Bw170 Body weight QTL 170 12.07 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 8 71888757 116888757 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 631653 Bp125 Blood pressure QTL 125 3.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 66142385 111142385 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 2303570 Gluco48 Glucose level QTL 48 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 49805831 94805831 Rat 70197 BpQTLcluster8 Blood pressure QTL cluster 8 3.482 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 46531639 119088626 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 2300181 Bmd55 Bone mineral density QTL 55 5.7 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 76468691 121468691 Rat 10402857 Bp380 Blood pressure QTL 380 0.95 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 2301402 Bp316 Blood pressure QTL 316 0.005 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 53968765 98968765 Rat 631664 Hcar3 Hepatocarcinoma resistance QTL 3 2.9 0.0005 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 8 54237644 99103503 Rat 8694200 Abfw4 Abdominal fat weight QTL 4 9.07 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 8 71888757 116888757 Rat 8694392 Bw161 Body weight QTL 161 8.06 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 8 71888757 116888757 Rat 61437 Cia6 Collagen induced arthritis QTL 6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 8 82460758 122812818 Rat
RH133920
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 89,314,499 - 89,314,714 (+) MAPPER mRatBN7.2 Rnor_6.0 8 96,012,315 - 96,012,529 NCBI Rnor6.0 Rnor_5.0 8 95,507,904 - 95,508,118 UniSTS Rnor5.0 RGSC_v3.4 8 93,635,063 - 93,635,277 UniSTS RGSC3.4 Celera 8 88,884,884 - 88,885,098 UniSTS RH 3.4 Map 8 1012.2 UniSTS Cytogenetic Map 8 q31 UniSTS
RH144635
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 89,276,206 - 89,276,376 (+) MAPPER mRatBN7.2 Rnor_6.0 8 95,974,163 - 95,974,332 NCBI Rnor6.0 Rnor_5.0 8 95,469,752 - 95,469,921 UniSTS Rnor5.0 RGSC_v3.4 8 93,596,791 - 93,596,960 UniSTS RGSC3.4 Celera 8 88,846,586 - 88,846,755 UniSTS RH 3.4 Map 8 1020.8 UniSTS Cytogenetic Map 8 q31 UniSTS
BF410734
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 89,272,455 - 89,272,557 (+) MAPPER mRatBN7.2 Rnor_6.0 8 95,970,412 - 95,970,513 NCBI Rnor6.0 Rnor_5.0 8 95,466,001 - 95,466,102 UniSTS Rnor5.0 RGSC_v3.4 8 93,593,040 - 93,593,141 UniSTS RGSC3.4 Celera 8 88,842,835 - 88,842,936 UniSTS RH 3.4 Map 8 1014.7 UniSTS Cytogenetic Map 8 q31 UniSTS
BF399571
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 89,308,091 - 89,308,252 (+) MAPPER mRatBN7.2 Rnor_6.0 8 96,005,859 - 96,006,019 NCBI Rnor6.0 Rnor_5.0 8 95,501,448 - 95,501,608 UniSTS Rnor5.0 RGSC_v3.4 8 93,628,656 - 93,628,816 UniSTS RGSC3.4 Celera 8 88,878,476 - 88,878,636 UniSTS RH 3.4 Map 8 1014.0 UniSTS Cytogenetic Map 8 q31 UniSTS
Nt5
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 89,312,610 - 89,312,737 (+) MAPPER mRatBN7.2 Rnor_6.0 8 96,010,426 - 96,010,552 NCBI Rnor6.0 Rnor_5.0 8 95,506,015 - 95,506,141 UniSTS Rnor5.0 RGSC_v3.4 8 93,633,174 - 93,633,300 UniSTS RGSC3.4 Celera 8 88,882,995 - 88,883,121 UniSTS Cytogenetic Map 8 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000015057 ⟹ ENSRNOP00000015057
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 89,270,696 - 89,314,881 (+) Ensembl Rnor_6.0 Ensembl 8 95,968,652 - 96,012,696 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000107471 ⟹ ENSRNOP00000091985
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 89,270,696 - 89,314,881 (+) Ensembl
RefSeq Acc Id:
NM_021576 ⟹ NP_067587
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 98,150,925 - 98,194,794 (+) NCBI mRatBN7.2 8 89,271,046 - 89,314,918 (+) NCBI Rnor_6.0 8 95,969,002 - 96,012,733 (+) NCBI Rnor_5.0 8 95,464,591 - 95,508,322 (+) NCBI RGSC_v3.4 8 93,591,630 - 93,635,481 (+) RGD Celera 8 88,841,425 - 88,885,302 (+) RGD
Sequence:
GGCCAGTTCACCCGCTCAACGCGCTCCTGCCAGCCATGCGTCCCGCGGCTGCTACGGCACCCAAGTGGCTGCTTCTCGCGCTAAGCGCTCTACTACCACTGTGGCCCACAGCCAAATCCTGGGAGCTC
hide sequence
RefSeq Acc Id:
XM_063266046 ⟹ XP_063122116
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 98,151,643 - 98,195,646 (+) NCBI
RefSeq Acc Id:
NP_067587 ⟸ NM_021576
- Peptide Label:
precursor
- UniProtKB:
P21588 (UniProtKB/Swiss-Prot), Q66HL0 (UniProtKB/TrEMBL), Q4G083 (UniProtKB/TrEMBL), F7EWJ6 (UniProtKB/TrEMBL)
- Sequence:
MRPAAATAPKWLLLALSALLPLWPTAKSWELTILHTNDVHSRLEQTSDDSTKCLNASLCVGGVARLFTKVQQIRKEEPNVLLLDAGDQYQGTIWFTVYKGLEVAHFMNLLGYDAMALGNHEFDNGVEG
hide sequence
Ensembl Acc Id:
ENSRNOP00000015057 ⟸ ENSRNOT00000015057
Ensembl Acc Id:
ENSRNOP00000091985 ⟸ ENSRNOT00000107471
RefSeq Acc Id:
XP_063122116 ⟸ XM_063266046
- Peptide Label:
isoform X1
- UniProtKB:
P21588 (UniProtKB/Swiss-Prot)
RGD ID: 13696167 Promoter ID: EPDNEW_R6692 Type: single initiation site Name: Nt5e_2 Description: 5' nucleotidase, ecto SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R6693 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 95,968,630 - 95,968,690 EPDNEW
RGD ID: 13696168 Promoter ID: EPDNEW_R6693 Type: initiation region Name: Nt5e_1 Description: 5' nucleotidase, ecto SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R6692 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 95,968,994 - 95,969,054 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Nt5e
5' nucleotidase, ecto
Nt5
5 nucleotidase
Name updated
1299863 APPROVED
2002-06-10
Nt5
5 nucleotidase
Name updated
70584 APPROVED
Note Type
Note
Reference
gene_cellular_localization
localized to the plasma membrane
gene_protein
63.965 kDa
