Symbol:
Prkag1
Name:
protein kinase AMP-activated non-catalytic subunit gamma 1
RGD ID:
3388
Description:
Enables adenyl ribonucleotide binding activity; protein kinase binding activity; and protein kinase regulator activity. Contributes to AMP-activated protein kinase activity. Involved in regulation of catalytic activity. Part of nucleotide-activated protein kinase complex. Orthologous to human PRKAG1 (protein kinase AMP-activated non-catalytic subunit gamma 1); PARTICIPATES IN adenosine monophosphate-activated protein kinase (AMPK) signaling pathway; vascular endothelial growth factor signaling pathway; hypertrophic cardiomyopathy pathway; INTERACTS WITH 2,6-dinitrotoluene; ammonium chloride; bisphenol A.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
5'-AMP-activated protein kinase subunit gamma-1; AMP-activated protein kinase, noncatalytic gamma-1 subunit; AMPK gamma-1 chain; AMPK gamma1; AMPK subunit gamma-1; AMPKg; NOT NULL; Prkaac; Prkga1; Protein kinase AMP-activated gamma; protein kinase, AMP-activated, gamma 1 non-catalytic subunit
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 131,842,058 - 131,859,484 (-) NCBI GRCr8 mRatBN7.2 7 129,963,105 - 129,980,532 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 129,963,105 - 129,980,561 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 131,770,283 - 131,787,868 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 133,995,841 - 134,013,427 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 133,908,348 - 133,925,941 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 140,489,499 - 140,506,925 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 140,489,492 - 140,546,908 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 114,999,618 - 115,017,043 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 137,582,341 - 137,599,762 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 137,658,778 - 137,676,199 (-) NCBI Celera 7 126,451,833 - 126,469,269 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Prkag1 Rat 1,2-dimethylhydrazine multiple interactions ISO RGD:11139 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PRKAG1 mRNA CTD PMID:22206623 Prkag1 Rat 17alpha-ethynylestradiol multiple interactions ISO RGD:11139 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PRKAG1 mRNA CTD PMID:17942748 Prkag1 Rat 17beta-estradiol increases expression ISO RGD:11139 6480464 Estradiol results in increased expression of PRKAG1 mRNA CTD PMID:39298647 Prkag1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO RGD:11139 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PRKAG1 mRNA; Tetrachlorodibenzodioxin promotes the more ... CTD PMID:17942748|PMID:28213091 Prkag1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO RGD:11139 6480464 Tetrachlorodibenzodioxin results in decreased expression of PRKAG1 mRNA CTD PMID:28213091 Prkag1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO RGD:11139 6480464 Tetrachlorodibenzodioxin affects the expression of PRKAG1 mRNA CTD PMID:21570461 Prkag1 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2,6-dinitrotoluene affects the expression of PRKAG1 mRNA CTD PMID:21346803 Prkag1 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO RGD:734389 6480464 tetrabromobisphenol A results in decreased expression of PRKAG1 protein CTD PMID:31675489 Prkag1 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO RGD:734389 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Prkag1 Rat 4,4'-sulfonyldiphenol increases expression ISO RGD:11139 6480464 bisphenol S results in increased expression of PRKAG1 mRNA CTD PMID:39298647 Prkag1 Rat 5-aza-2'-deoxycytidine increases expression ISO RGD:734389 6480464 Decitabine results in increased expression of PRKAG1 mRNA CTD PMID:17908484 Prkag1 Rat acrolein multiple interactions ISO RGD:734389 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268 Prkag1 Rat aflatoxin B1 increases methylation ISO RGD:734389 6480464 Aflatoxin B1 results in increased methylation of PRKAG1 gene CTD PMID:27153756 Prkag1 Rat all-trans-retinoic acid increases expression ISO RGD:734389 6480464 Tretinoin results in increased expression of PRKAG1 mRNA CTD PMID:33167477 Prkag1 Rat alpha-pinene multiple interactions ISO RGD:734389 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268 Prkag1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of PRKAG1 mRNA CTD PMID:16483693 Prkag1 Rat antimycin A decreases expression ISO RGD:734389 6480464 Antimycin A results in decreased expression of PRKAG1 mRNA CTD PMID:33512557 Prkag1 Rat aristolochic acid A decreases expression ISO RGD:734389 6480464 aristolochic acid I results in decreased expression of PRKAG1 mRNA CTD PMID:33212167 Prkag1 Rat arsane affects methylation ISO RGD:734389 6480464 Arsenic affects the methylation of PRKAG1 gene CTD PMID:25304211 Prkag1 Rat arsenic atom affects methylation ISO RGD:734389 6480464 Arsenic affects the methylation of PRKAG1 gene CTD PMID:25304211 Prkag1 Rat arsenite(3-) decreases expression ISO RGD:11139 6480464 arsenite results in decreased expression of PRKAG1 protein CTD PMID:37955338 Prkag1 Rat arsenite(3-) multiple interactions ISO RGD:734389 6480464 arsenite promotes the reaction [G3BP1 protein binds to PRKAG1 mRNA] CTD PMID:32406909 Prkag1 Rat azoxystrobin decreases expression ISO RGD:734389 6480464 azoxystrobin results in decreased expression of PRKAG1 mRNA CTD PMID:33512557 Prkag1 Rat benzo[a]pyrene increases expression ISO RGD:11139 6480464 Benzo(a)pyrene results in increased expression of PRKAG1 mRNA CTD PMID:19770486 Prkag1 Rat beta-lapachone increases expression ISO RGD:734389 6480464 beta-lapachone results in increased expression of PRKAG1 mRNA CTD PMID:38218311 Prkag1 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of PRKAG1 gene CTD PMID:28505145 Prkag1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of PRKAG1 mRNA CTD PMID:30816183|PMID:32528016|PMID:34947998 Prkag1 Rat bisphenol A decreases expression ISO RGD:734389 6480464 bisphenol A results in decreased expression of PRKAG1 mRNA; bisphenol A results in decreased expression more ... CTD PMID:29275510|PMID:31675489 Prkag1 Rat bisphenol AF increases expression ISO RGD:734389 6480464 bisphenol AF results in increased expression of PRKAG1 protein CTD PMID:34186270 Prkag1 Rat Bisphenol B increases expression ISO RGD:734389 6480464 bisphenol B results in increased expression of PRKAG1 protein CTD PMID:34186270 Prkag1 Rat bisphenol F multiple interactions ISO RGD:734389 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Prkag1 Rat bisphenol F increases expression ISO RGD:734389 6480464 bisphenol F results in increased expression of PRKAG1 protein CTD PMID:34186270 Prkag1 Rat butyric acid increases expression EXP 6480464 Butyric Acid results in increased expression of PRKAG1 mRNA CTD PMID:12800193 Prkag1 Rat cannabidiol multiple interactions ISO RGD:734389 6480464 [Cannabidiol co-treated with moringin] results in increased expression of PRKAG1 mRNA CTD PMID:30096889 Prkag1 Rat CGP 52608 multiple interactions ISO RGD:734389 6480464 CGP 52608 promotes the reaction [RORA protein binds to PRKAG1 gene] CTD PMID:28238834 Prkag1 Rat chlorpyrifos increases expression ISO RGD:11139 6480464 Chlorpyrifos results in increased expression of PRKAG1 mRNA CTD PMID:37019170 Prkag1 Rat choline multiple interactions ISO RGD:11139 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Prkag1 Rat cisplatin increases expression ISO RGD:734389 6480464 Cisplatin results in increased expression of PRKAG1 mRNA CTD PMID:27392435 Prkag1 Rat copper atom multiple interactions ISO RGD:11139 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ... CTD PMID:15467011 Prkag1 Rat copper(0) multiple interactions ISO RGD:11139 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression more ... CTD PMID:15467011 Prkag1 Rat cordycepin affects binding ISO RGD:734389 6480464 cordycepin binds to PRKAG1 protein CTD PMID:24286368 Prkag1 Rat decabromodiphenyl ether decreases expression ISO RGD:734389 6480464 decabromobiphenyl ether results in decreased expression of PRKAG1 protein CTD PMID:31675489 Prkag1 Rat dexamethasone multiple interactions ISO RGD:734389 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Prkag1 Rat Dibutyl phosphate affects expression ISO RGD:734389 6480464 di-n-butylphosphoric acid affects the expression of PRKAG1 mRNA CTD PMID:37042841 Prkag1 Rat dicrotophos decreases expression ISO RGD:734389 6480464 dicrotophos results in decreased expression of PRKAG1 mRNA CTD PMID:28302478 Prkag1 Rat doxorubicin affects expression ISO RGD:734389 6480464 Doxorubicin affects the expression of PRKAG1 protein CTD PMID:29385562 Prkag1 Rat doxorubicin decreases expression ISO RGD:734389 6480464 Doxorubicin results in decreased expression of PRKAG1 mRNA CTD PMID:29803840 Prkag1 Rat elemental selenium increases expression ISO RGD:734389 6480464 Selenium results in increased expression of PRKAG1 mRNA CTD PMID:19244175 Prkag1 Rat fenofibrate increases expression ISO RGD:734389 6480464 Fenofibrate results in increased expression of PRKAG1 protein CTD PMID:25545733 Prkag1 Rat fenpyroximate decreases expression ISO RGD:734389 6480464 fenpyroximate results in decreased expression of PRKAG1 mRNA CTD PMID:33512557 Prkag1 Rat flavonoids decreases expression EXP 6480464 Flavonoids results in decreased expression of PRKAG1 mRNA CTD PMID:18035473 Prkag1 Rat folic acid multiple interactions ISO RGD:11139 6480464 [1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of PRKAG1 mRNA; [Methionine deficiency co-treated more ... CTD PMID:20938992|PMID:22206623 Prkag1 Rat indometacin multiple interactions ISO RGD:734389 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ... CTD PMID:28628672 Prkag1 Rat ivermectin decreases expression ISO RGD:734389 6480464 Ivermectin results in decreased expression of PRKAG1 protein CTD PMID:32959892 Prkag1 Rat L-methionine multiple interactions ISO RGD:11139 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation more ... CTD PMID:20938992 Prkag1 Rat nitrates multiple interactions ISO RGD:11139 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of PRKAG1 more ... CTD PMID:35964746 Prkag1 Rat okadaic acid decreases expression ISO RGD:734389 6480464 Okadaic Acid results in decreased expression of PRKAG1 protein CTD PMID:38832940 Prkag1 Rat ozone multiple interactions ISO RGD:734389 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ... CTD PMID:32699268 Prkag1 Rat paracetamol affects expression ISO RGD:11139 6480464 Acetaminophen affects the expression of PRKAG1 mRNA CTD PMID:17562736 Prkag1 Rat perfluorooctanoic acid increases expression ISO RGD:11139 6480464 perfluorooctanoic acid results in increased expression of PRKAG1 protein CTD PMID:37422089 Prkag1 Rat phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of PRKAG1 mRNA CTD PMID:19162173|PMID:21318169 Prkag1 Rat picoxystrobin decreases expression ISO RGD:734389 6480464 picoxystrobin results in decreased expression of PRKAG1 mRNA CTD PMID:33512557 Prkag1 Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of PRKAG1 mRNA CTD PMID:19162173|PMID:21318169 Prkag1 Rat rotenone decreases expression ISO RGD:734389 6480464 Rotenone results in decreased expression of PRKAG1 mRNA CTD PMID:33512557 Prkag1 Rat selenium atom increases expression ISO RGD:734389 6480464 Selenium results in increased expression of PRKAG1 mRNA CTD PMID:19244175 Prkag1 Rat Soman decreases expression EXP 6480464 Soman results in decreased expression of PRKAG1 mRNA CTD PMID:19281266 Prkag1 Rat tebufenpyrad decreases expression ISO RGD:734389 6480464 4-chloro-N-((4-(1,1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in decreased expression of PRKAG1 mRNA CTD PMID:33512557 Prkag1 Rat tetrachloromethane affects expression EXP 6480464 Carbon Tetrachloride affects the expression of PRKAG1 mRNA CTD PMID:12734012 Prkag1 Rat titanium dioxide decreases methylation ISO RGD:11139 6480464 titanium dioxide results in decreased methylation of PRKAG1 gene CTD PMID:35295148 Prkag1 Rat topiramate decreases expression EXP 6480464 topiramate results in decreased expression of PRKAG1 mRNA CTD PMID:16979414 Prkag1 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of PRKAG1 gene CTD PMID:27618143 Prkag1 Rat triphenyl phosphate affects expression ISO RGD:734389 6480464 triphenyl phosphate affects the expression of PRKAG1 mRNA CTD PMID:37042841
Molecular Function
Only show annotations with direct experimental evidence (0 objects hidden)
Prkag1 Rat ADP binding enables IDA 7794795 PMID:21399626 UniProt Prkag1 Rat AMP binding IDA 1600447 RGD Prkag1 Rat AMP binding enables IBA PANTHER:PTN000350001|PomBase:SPAC1556.08c|RGD:3388|RGD:727782 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Prkag1 Rat AMP binding enables IDA 8554140 PMID:17851531 UniProt Prkag1 Rat AMP binding IMP 1600480 RGD Prkag1 Rat AMP-activated protein kinase activity contributes_to IDA 1600447 RGD Prkag1 Rat AMP-activated protein kinase activity contributes_to IDA 1600691 RGD Prkag1 Rat AMP-activated protein kinase activity contributes_to IMP 1600480 RGD Prkag1 Rat ATP binding enables IDA 8554140 PMID:17851531 UniProt Prkag1 Rat ATP binding enables IEA UniProtKB-KW:KW-0067 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prkag1 Rat nucleotide binding enables IEA UniProtKB-KW:KW-0547 1600115 GO_REF:0000043 UniProt GO_REF:0000043 Prkag1 Rat protein binding IPI RGD:71057 729494 RGD Prkag1 Rat protein binding enables ISO RGD:11139 1624291 UniProtKB:Q9QXS1 PMID:16608880 RGD PMID:16608880 Prkag1 Rat protein binding enables ISO RGD:734389 1624291 UniProtKB:O43741|UniProtKB:O75400-2|UniProtKB:P26367|UniProtKB:P35520|UniProtKB:P50221|UniProtKB:P54646|UniProtKB:P55212|UniProtKB:P60370|UniProtKB:P60412|UniProtKB:Q07627|UniProtKB:Q13131|UniProtKB:Q13829|UniProtKB:Q14145|UniProtKB:Q6FHY5|UniProtKB:Q6P1W5|UniProtKB:Q8TF40|UniProtKB:Q969V4|UniProtKB:Q9BQ66|UniProtKB:Q9BYQ0|UniProtKB:Q9BYQ4|UniProtKB:Q9BYR5|UniProtKB:Q9H8W4|UniProtKB:Q9P278|UniProtKB:Q9Y478|UniProtKB:Q9Y484 PMID:16306228, PMID:17028174, PMID:18403135, PMID:18480843, PMID:20562859, PMID:21988832, PMID:22363791, PMID:23455922, PMID:24722188, PMID:25416956, PMID:25852190, PMID:28514442, PMID:28561066, more ... RGD PMID:16306228|PMID:17028174|PMID:18403135|PMID:18480843|PMID:20562859|PMID:21988832|PMID:22363791|PMID:23455922|PMID:24722188|PMID:25416956|PMID:25852190|PMID:28514442|PMID:28561066|PMID:31515488|PMID:32296183|PMID:32707033|PMID:32814053|PMID:33961781|PMID:35271311 Prkag1 Rat protein kinase binding IPI RGD:3387 1600447 RGD Prkag1 Rat protein kinase binding enables IBA PANTHER:PTN000350001|RGD:3388|RGD:727782|UniProtKB:P54619|UniProtKB:Q9UGI9|UniProtKB:Q9UGJ0 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Prkag1 Rat protein kinase binding enables ISO RGD:734389 1624291 PMID:10698692 RGD PMID:10698692 Prkag1 Rat protein kinase binding enables IEA UniProtKB:P54619|ensembl:ENSP00000447433 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkag1 Rat protein kinase binding IPI RGD:620893 1600447 RGD Prkag1 Rat protein kinase regulator activity enables IEA UniProtKB:P54619|ensembl:ENSP00000447433 1600115 GO_REF:0000107 Ensembl GO_REF:0000107 Prkag1 Rat protein kinase regulator activity enables IBA PANTHER:PTN000350001|RGD:3388|SGD:S000003083|UniProtKB:P54619|UniProtKB:Q9UGI9|UniProtKB:Q9UGJ0 1600115 GO_REF:0000033 GO_Central GO_REF:0000033 Prkag1 Rat protein kinase regulator activity enables ISO RGD:734389 1624291 PMID:24563466 RGD PMID:24563466 Prkag1 Rat protein kinase regulator activity enables IDA 7794795 PMID:21399626 GO_Central Prkag1 Rat protein-containing complex binding IDA 1600691 heterooligomerization RGD
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,6-dinitrotoluene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) acrolein (ISO) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-pinene (ISO) ammonium chloride (EXP) antimycin A (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) azoxystrobin (ISO) benzo[a]pyrene (ISO) beta-lapachone (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) butyric acid (EXP) cannabidiol (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) choline (ISO) cisplatin (ISO) copper atom (ISO) copper(0) (ISO) cordycepin (ISO) decabromodiphenyl ether (ISO) dexamethasone (ISO) Dibutyl phosphate (ISO) dicrotophos (ISO) doxorubicin (ISO) elemental selenium (ISO) fenofibrate (ISO) fenpyroximate (ISO) flavonoids (EXP) folic acid (ISO) indometacin (ISO) ivermectin (ISO) L-methionine (ISO) nitrates (ISO) okadaic acid (ISO) ozone (ISO) paracetamol (ISO) perfluorooctanoic acid (ISO) phenobarbital (EXP) picoxystrobin (ISO) pregnenolone 16alpha-carbonitrile (EXP) rotenone (ISO) selenium atom (ISO) Soman (EXP) tebufenpyrad (ISO) tetrachloromethane (EXP) titanium dioxide (ISO) topiramate (EXP) trichloroethene (EXP) triphenyl phosphate (ISO)
Molecular Function
ADP binding (IDA) AMP binding (IBA,IDA,IMP) AMP-activated protein kinase activity (IDA,IMP) ATP binding (IDA,IEA) nucleotide binding (IEA) protein binding (IPI,ISO) protein kinase binding (IBA,IEA,IPI,ISO) protein kinase regulator activity (IBA,IDA,IEA,ISO) protein-containing complex binding (IDA)
1.
Characterization of AMP-activated protein kinase gamma-subunit isoforms and their role in AMP binding.
Cheung PC, etal., Biochem J. 2000 Mar 15;346 Pt 3:659-69.
2.
Non-catalytic beta- and gamma-subunit isoforms of the 5'-AMP-activated protein kinase.
Gao G, etal., J Biol Chem 1996 Apr 12;271(15):8675-81.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
The AMP-activated protein kinase pathway--new players upstream and downstream.
Hardie DG J Cell Sci. 2004 Nov 1;117(Pt 23):5479-87.
5.
Management of cellular energy by the AMP-activated protein kinase system.
Hardie DG, etal., FEBS Lett. 2003 Jul 3;546(1):113-20.
6.
Complexes between the LKB1 tumor suppressor, STRAD alpha/beta and MO25 alpha/beta are upstream kinases in the AMP-activated protein kinase cascade.
Hawley SA, etal., J Biol. 2003;2(4):28. Epub 2003 Sep 24.
7.
Activation of AMPK alpha- and gamma-isoform complexes in the intact ischemic rat heart.
Li J, etal., Am J Physiol Heart Circ Physiol. 2006 Oct;291(4):H1927-34. Epub 2006 Apr 28.
8.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.
GOA pipeline
RGD automated data pipeline
12.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
14.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
15.
Characterization of AMP-activated protein kinase beta and gamma subunits. Assembly of the heterotrimeric complex in vitro.
Woods A, etal., J Biol Chem 1996 Apr 26;271(17):10282-90.
16.
Structural basis for AMP binding to mammalian AMP-activated protein kinase.
Xiao B, etal., Nature. 2007 Sep 27;449(7161):496-500. Epub 2007 Sep 12.
17.
Structure of mammalian AMPK and its regulation by ADP.
Xiao B, etal., Nature. 2011 Apr 14;472(7342):230-3. doi: 10.1038/nature09932. Epub 2011 Mar 13.
Prkag1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 131,842,058 - 131,859,484 (-) NCBI GRCr8 mRatBN7.2 7 129,963,105 - 129,980,532 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 129,963,105 - 129,980,561 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 131,770,283 - 131,787,868 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 133,995,841 - 134,013,427 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 133,908,348 - 133,925,941 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 140,489,499 - 140,506,925 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 140,489,492 - 140,546,908 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 114,999,618 - 115,017,043 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 137,582,341 - 137,599,762 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 137,658,778 - 137,676,199 (-) NCBI Celera 7 126,451,833 - 126,469,269 (-) NCBI Celera Cytogenetic Map 7 q36 NCBI
PRKAG1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 49,002,274 - 49,018,776 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 49,002,274 - 49,018,807 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 49,396,057 - 49,412,559 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 47,682,322 - 47,698,859 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 47,682,322 - 47,698,859 NCBI Celera 12 48,190,841 - 48,207,378 (-) NCBI Celera Cytogenetic Map 12 q13.12 NCBI HuRef 12 46,427,570 - 46,444,145 (-) NCBI HuRef CHM1_1 12 49,361,849 - 49,378,423 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 48,964,449 - 48,980,948 (-) NCBI T2T-CHM13v2.0
Prkag1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 98,710,678 - 98,729,354 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 98,710,678 - 98,729,402 (-) Ensembl GRCm39 Ensembl GRCm38 15 98,812,797 - 98,831,508 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 98,812,797 - 98,831,521 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 98,643,228 - 98,661,939 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 98,640,831 - 98,659,514 (-) NCBI MGSCv36 mm8 Celera 15 100,962,240 - 100,981,052 (-) NCBI Celera Cytogenetic Map 15 F1 NCBI cM Map 15 54.73 NCBI
Prkag1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955500 7,834,550 - 7,850,379 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955500 7,834,550 - 7,850,412 (-) NCBI ChiLan1.0 ChiLan1.0
PRKAG1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 45,166,211 - 45,182,902 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 45,162,975 - 45,179,663 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 39,731,899 - 39,748,620 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 40,611,532 - 40,628,263 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 40,611,532 - 40,628,263 (+) Ensembl panpan1.1 panPan2
PRKAG1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 27 5,556,433 - 5,570,675 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 27 5,556,549 - 5,570,235 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 27 40,686,945 - 40,701,155 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 27 5,607,494 - 5,621,737 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 27 5,607,683 - 5,621,736 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 27 5,571,478 - 5,585,679 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 27 5,561,427 - 5,575,873 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 27 41,079,277 - 41,093,492 (-) NCBI UU_Cfam_GSD_1.0
Prkag1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 66,345,695 - 66,360,254 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936512 6,804,571 - 6,819,077 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936512 6,804,571 - 6,819,096 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PRKAG1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 5 15,033,058 - 15,049,735 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 5 15,033,051 - 15,049,676 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 5 15,443,377 - 15,522,471 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PRKAG1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 45,243,199 - 45,262,143 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 45,243,823 - 45,260,396 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 200,883,310 - 200,900,755 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Prkag1
.
Predicted Target Of
Count of predictions: 210 Count of miRNA genes: 155 Interacting mature miRNAs: 177 Transcripts: ENSRNOT00000020093 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300179 Kidm5 Kidney mass QTL 5 3.51 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 7 43747012 135012528 Rat 1354582 Stl11 Serum triglyceride level QTL 11 3.42 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 119513385 135012528 Rat 731176 Glom5 Glomerulus QTL 5 2.5 0.0035 kidney glomerulus morphology trait (VT:0005325) count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002) 7 96670164 135012528 Rat 1300112 Bp183 Blood pressure QTL 183 3.51 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 111182207 135012528 Rat 2306821 Bp335 Blood pressure QTL 335 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 106571501 135012528 Rat 631663 Bw6 Body weight QTL 6 3.4 body mass (VT:0001259) body weight (CMO:0000012) 7 111075573 134976056 Rat 1331731 Bp216 Blood pressure QTL 216 2.851 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 102297359 133492884 Rat 1558655 Swd4 Spike wave discharge measurement QTL 4 3.68 0.0002 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge severity grade (CMO:0001988) 7 86983365 131983365 Rat 731174 Uae23 Urinary albumin excretion QTL 23 2.4 0.0042 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 7 104603555 135012528 Rat 1357339 Stl14 Serum triglyceride level QTL 14 3.45 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 7 112729683 133492707 Rat 1331748 Bp215 Blood pressure QTL 215 4.043 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 112308254 133492884 Rat 634331 Pia17 Pristane induced arthritis QTL 17 4.7 joint integrity trait (VT:0010548) arthritic paw count (CMO:0001460) 7 73829340 130221005 Rat 1358914 Bp266 Blood pressure QTL 266 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat 2299163 Iddm34 Insulin dependent diabetes mellitus QTL 34 2.71 blood glucose amount (VT:0000188) age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140) 7 91281130 135012528 Rat 70173 Niddm19 Non-insulin dependent diabetes mellitus QTL 19 4.33 0.00005 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 7 64002457 135012528 Rat 1549899 Stresp8 Stress response QTL 8 4.37 0.0008 stress-related behavior trait (VT:0010451) defensive burying duration (CMO:0001961) 7 90482196 135012528 Rat 1358891 Bp265 Blood pressure QTL 265 2.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 83591953 134666232 Rat
RH130668
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 129,963,345 - 129,963,545 (+) MAPPER mRatBN7.2 Rnor_6.0 7 140,489,740 - 140,489,939 NCBI Rnor6.0 Rnor_5.0 X 114,999,859 - 115,000,058 UniSTS Rnor5.0 RGSC_v3.4 7 137,582,577 - 137,582,776 UniSTS RGSC3.4 Celera 7 126,452,069 - 126,452,268 UniSTS RH 3.4 Map 7 1086.5 UniSTS Cytogenetic Map 7 q36 UniSTS
RH124519
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 129,963,913 - 129,964,014 (+) MAPPER mRatBN7.2 Rnor_6.0 7 140,490,308 - 140,490,408 NCBI Rnor6.0 Rnor_5.0 X 115,000,427 - 115,000,527 UniSTS Rnor5.0 RGSC_v3.4 7 137,583,145 - 137,583,245 UniSTS RGSC3.4 Celera 7 126,452,637 - 126,452,737 UniSTS Cytogenetic Map 7 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000077502 ⟹ ENSRNOP00000069442
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 129,962,887 - 130,020,325 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000083354 ⟹ ENSRNOP00000070458
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 129,963,105 - 129,966,458 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000089544 ⟹ ENSRNOP00000074816
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 129,963,105 - 129,966,398 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000105867 ⟹ ENSRNOP00000091419
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 129,963,106 - 129,980,561 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000111826 ⟹ ENSRNOP00000081837
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 129,962,986 - 130,020,325 (-) Ensembl
RefSeq Acc Id:
NM_013010 ⟹ NP_037142
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 131,842,063 - 131,859,484 (-) NCBI mRatBN7.2 7 129,963,110 - 129,980,532 (-) NCBI Rnor_6.0 7 140,489,504 - 140,506,925 (-) NCBI Rnor_5.0 X 114,999,618 - 115,017,043 (-) NCBI RGSC_v3.4 7 137,582,341 - 137,599,762 (-) RGD Celera 7 126,451,833 - 126,469,269 (-) RGD
Sequence:
CTGGCGGGTGCTAGCAATGGAGTCGGTTGCTGCAGAGAGCGCTCCAGCTCCGGAGAATGAACACTCTCAAGAGACCCCGGAATCGAACAGTAGTGTGTACACCACCTTCATGAAGTCTCATCGCTGCT
hide sequence
RefSeq Acc Id:
XM_006257331 ⟹ XP_006257393
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 131,842,058 - 131,859,415 (-) NCBI mRatBN7.2 7 129,963,105 - 129,980,470 (-) NCBI Rnor_6.0 7 140,489,499 - 140,506,823 (-) NCBI Rnor_5.0 X 114,999,618 - 115,017,043 (-) NCBI
Sequence:
AGCTTGCCGCGGGAGTCCGGGACTCCCCTCCTCTGCTTCGGTGGGTGCATCTCCGAGGTCTGGGCCACACCCGTGTCCGCCTGGGGTCTGCAGTACCCTGAGAGACGAAGCGGGCTGTGAGCTTGGAG
hide sequence
RefSeq Acc Id:
NP_037142 ⟸ NM_013010
- UniProtKB:
Q4QQW6 (UniProtKB/Swiss-Prot), P80385 (UniProtKB/Swiss-Prot), A0A0G2K913 (UniProtKB/TrEMBL)
- Sequence:
MESVAAESAPAPENEHSQETPESNSSVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPL
hide sequence
RefSeq Acc Id:
XP_006257393 ⟸ XM_006257331
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2R2B3 (UniProtKB/TrEMBL), A6KCB1 (UniProtKB/TrEMBL)
- Sequence:
MKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPES
hide sequence
Ensembl Acc Id:
ENSRNOP00000070458 ⟸ ENSRNOT00000083354
Ensembl Acc Id:
ENSRNOP00000091419 ⟸ ENSRNOT00000105867
Ensembl Acc Id:
ENSRNOP00000074816 ⟸ ENSRNOT00000089544
Ensembl Acc Id:
ENSRNOP00000069442 ⟸ ENSRNOT00000077502
Ensembl Acc Id:
ENSRNOP00000081837 ⟸ ENSRNOT00000111826
RGD ID: 13695633 Promoter ID: EPDNEW_R6157 Type: multiple initiation site Name: Prkag1_1 Description: protein kinase AMP-activated non-catalytic subunit gamma 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 140,506,937 - 140,506,997 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-03
Prkag1
protein kinase AMP-activated non-catalytic subunit gamma 1
Prkag1
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2003-04-09
Prkag1
protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Prkga1
Protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Symbol and Name updated
629477 APPROVED
2001-12-10
Prkga1
Protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Symbol and Name updated to reflect Human and Mouse nomenclature
69665 APPROVED
