Symbol:
Stmn1 (Ensembl: LOC102551813)
Name:
stathmin 1 (Ensembl:stathmin-like)
RGD ID:
2992
Description:
Predicted to enable tubulin binding activity. Predicted to be involved in several processes, including establishment of skin barrier; negative regulation of signal transduction; and regulation of cytoskeleton organization. Predicted to act upstream of or within several processes, including axonogenesis; mitotic spindle organization; and negative regulation of microtubule polymerization. Predicted to be located in cytosol and membrane. Predicted to be active in cytoplasm and neuron projection. Orthologous to human STMN1 (stathmin 1); PARTICIPATES IN mitogen activated protein kinase signaling pathway; INTERACTS WITH (+)-schisandrin B; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1-naphthyl isothiocyanate.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Lap18; Leukemia-associated cytosolic phosphoprotein stathmin; leukemia-associated gene; leukemia-associated phosphoprotein p18; metablastin; MGC72884; NOT NULL; oncoprotein 18; OP18; phosphoprotein p19; PP17; PP19; PR22; prosolin; SMN; stathmin
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
STMN1 (stathmin 1)
HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Stmn1 (stathmin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Stmn1 (stathmin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
STMN1 (stathmin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
STMN1 (stathmin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Stmn1 (stathmin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
STMN1 (stathmin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
STMN1 (stathmin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Stmn1 (stathmin 1)
Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
STMN2 (stathmin 2)
HGNC
OrthoDB
Alliance orthologs 3
Homo sapiens (human):
STMN1 (stathmin 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Stmn1 (stathmin 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
stmn1a (stathmin 1a)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
stmn1b (stathmin 1b)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
stai
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
stmn1
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 151,964,308 - 151,970,843 (+) NCBI GRCr8 mRatBN7.2 5 146,680,757 - 146,687,154 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 146,681,436 - 146,687,154 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 149,383,560 - 149,389,224 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 151,153,616 - 151,159,276 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 151,139,803 - 151,145,467 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 152,680,412 - 152,686,807 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 152,680,407 - 152,686,806 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 156,466,632 - 156,472,404 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 153,226,420 - 153,232,084 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 153,236,461 - 153,242,123 (+) NCBI Celera 5 145,096,588 - 145,102,252 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Stmn1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of STMN1 mRNA] CTD PMID:31150632 Stmn1 Rat (-)-epigallocatechin 3-gallate decreases expression ISO STMN1 (Homo sapiens) 6480464 epigallocatechin gallate results in decreased expression of STMN1 protein CTD PMID:31195006 Stmn1 Rat (1->4)-beta-D-glucan multiple interactions ISO Stmn1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of STMN1 mRNA CTD PMID:36331819 Stmn1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane affects expression ISO Stmn1 (Mus musculus) 6480464 o and p'-DDT affects the expression of STMN1 mRNA CTD PMID:18925944 Stmn1 Rat 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane affects expression EXP 6480464 o and p'-DDT affects the expression of STMN1 mRNA CTD PMID:17984292 Stmn1 Rat 1,2-dimethylhydrazine multiple interactions ISO Stmn1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of STMN1 mRNA] CTD PMID:22206623 Stmn1 Rat 1,2-dimethylhydrazine increases expression ISO Stmn1 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of STMN1 mRNA CTD PMID:22206623 Stmn1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Stmn1 (Mus musculus) 6480464 Levodopa inhibits the reaction [1-Methyl-4-phenyl-1 more ... CTD PMID:23562983 Stmn1 Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine decreases expression ISO Stmn1 (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:23562983 Stmn1 Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of STMN1 mRNA CTD PMID:30723492 Stmn1 Rat 17alpha-ethynylestradiol affects expression ISO Stmn1 (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of STMN1 mRNA CTD PMID:17555576 Stmn1 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of STMN1 mRNA CTD PMID:15834898 and PMID:29097150 Stmn1 Rat 17alpha-ethynylestradiol multiple interactions ISO Stmn1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of STMN1 mRNA CTD PMID:17942748 Stmn1 Rat 17alpha-ethynylestradiol increases expression ISO Stmn1 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of STMN1 mRNA CTD PMID:17942748 Stmn1 Rat 17beta-estradiol increases expression ISO STMN1 (Homo sapiens) 6480464 Estradiol results in increased expression of STMN1 mRNA CTD PMID:16474171 more ... Stmn1 Rat 17beta-estradiol decreases expression ISO Stmn1 (Mus musculus) 6480464 Estradiol results in decreased expression of STMN1 mRNA CTD PMID:39298647 Stmn1 Rat 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of STMN1 mRNA CTD PMID:32145629 Stmn1 Rat 17beta-estradiol decreases phosphorylation ISO STMN1 (Homo sapiens) 6480464 Estradiol results in decreased phosphorylation of STMN1 protein CTD PMID:27026707 Stmn1 Rat 17beta-estradiol decreases expression ISO STMN1 (Homo sapiens) 6480464 Estradiol results in decreased expression of STMN1 mRNA CTD PMID:23019147 and PMID:31614463 Stmn1 Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression EXP 6480464 2 more ... CTD PMID:20959002 Stmn1 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Stmn1 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Stmn1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO STMN1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of STMN1 mRNA CTD PMID:19684285 Stmn1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Stmn1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of STMN1 mRNA CTD PMID:15034205 and PMID:19465110 Stmn1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO STMN1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of STMN1 mRNA CTD PMID:20385220 and PMID:21496263 Stmn1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Stmn1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of STMN1 mRNA and Tetrachlorodibenzodioxin results in increased expression of STMN1 protein CTD PMID:20385220 and PMID:21496263 Stmn1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of STMN1 mRNA CTD PMID:20959002 Stmn1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Stmn1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of STMN1 mRNA CTD PMID:21570461 Stmn1 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of STMN1 mRNA CTD PMID:22298810 and PMID:34747641 Stmn1 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Stmn1 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of STMN1 mRNA and AHR protein inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of STMN1 mRNA] CTD PMID:15034205 and PMID:17942748 Stmn1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression EXP 6480464 2 more ... CTD PMID:19954255 Stmn1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Stmn1 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Stmn1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression EXP 6480464 2 more ... CTD PMID:19954255 Stmn1 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether decreases expression ISO Stmn1 (Mus musculus) 6480464 2 more ... CTD PMID:16451863 Stmn1 Rat 2,5-hexanedione decreases expression EXP 6480464 2 and 5-hexanedione results in decreased expression of STMN1 mRNA CTD PMID:22952946 Stmn1 Rat 2,6-di-tert-butyl-4-methylphenol increases expression ISO Stmn1 (Mus musculus) 6480464 Butylated Hydroxytoluene results in increased expression of STMN1 mRNA CTD PMID:19000923 Stmn1 Rat 2,6-dimethoxyphenol multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with pyrogallol 1 more ... CTD PMID:38598786 Stmn1 Rat 2-acetamidofluorene increases expression EXP 6480464 2-Acetylaminofluorene results in increased expression of STMN1 mRNA CTD PMID:22584684 Stmn1 Rat 2-methoxyethanol decreases expression EXP 6480464 methyl cellosolve results in decreased expression of STMN1 protein CTD PMID:15928459 Stmn1 Rat 2-nitrofluorene increases expression EXP 6480464 2-nitrofluorene results in increased expression of STMN1 mRNA CTD PMID:15890375 Stmn1 Rat 3,3'-Thiobispropanoic acid increases expression ISO STMN1 (Homo sapiens) 6480464 thiodipropionic acid results in increased expression of STMN1 protein CTD PMID:20332019 Stmn1 Rat 3-methylcholanthrene increases expression ISO Stmn1 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of STMN1 mRNA CTD PMID:20713471 Stmn1 Rat 4,4'-diaminodiphenylmethane increases expression ISO Stmn1 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of STMN1 mRNA CTD PMID:18648102 Stmn1 Rat 4,4'-sulfonyldiphenol decreases expression ISO Stmn1 (Mus musculus) 6480464 bisphenol S results in decreased expression of STMN1 mRNA CTD PMID:39298647 Stmn1 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of STMN1 mRNA CTD PMID:15890375 Stmn1 Rat 4-hydroxynon-2-enal increases expression ISO Stmn1 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in increased expression of STMN1 mRNA CTD PMID:19191707 Stmn1 Rat 4-hydroxyphenyl retinamide increases expression ISO Stmn1 (Mus musculus) 6480464 Fenretinide results in increased expression of STMN1 mRNA CTD PMID:28973697 Stmn1 Rat 5-bromo-2'-deoxyuridine multiple interactions ISO Stmn1 (Mus musculus) 6480464 [Bromodeoxyuridine co-treated with furan] results in increased expression of STMN1 mRNA CTD PMID:24910943 Stmn1 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of STMN1 mRNA CTD PMID:18077114 Stmn1 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of STMN1 mRNA CTD PMID:24780913 and PMID:36843608 Stmn1 Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:12376462 Stmn1 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of STMN1 mRNA CTD PMID:31881176 Stmn1 Rat acrylamide increases expression ISO Stmn1 (Mus musculus) 6480464 Acrylamide results in increased expression of STMN1 protein CTD PMID:20025956 Stmn1 Rat afimoxifene decreases expression ISO STMN1 (Homo sapiens) 6480464 afimoxifene results in decreased expression of STMN1 mRNA CTD PMID:16514628 Stmn1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of STMN1 mRNA CTD PMID:15890375 and PMID:25378103 Stmn1 Rat aflatoxin B1 decreases methylation ISO STMN1 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of STMN1 intron CTD PMID:30157460 Stmn1 Rat aflatoxin B1 increases methylation ISO STMN1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of STMN1 gene CTD PMID:27153756 and PMID:28458013 Stmn1 Rat aflatoxin B1 increases expression ISO Stmn1 (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of STMN1 mRNA CTD PMID:19770486 Stmn1 Rat aflatoxin B1 affects expression ISO STMN1 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of STMN1 protein CTD PMID:20106945 Stmn1 Rat Aflatoxin B2 alpha decreases methylation ISO STMN1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of STMN1 3' UTR and aflatoxin B2 results in decreased methylation of STMN1 intron CTD PMID:30157460 Stmn1 Rat all-trans-retinoic acid decreases expression ISO STMN1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of STMN1 mRNA CTD PMID:17218384 Stmn1 Rat amiodarone affects expression EXP 6480464 Amiodarone affects the expression of STMN1 mRNA CTD PMID:18355885 Stmn1 Rat amitriptyline affects expression EXP 6480464 Amitriptyline affects the expression of STMN1 mRNA CTD PMID:18355885 Stmn1 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of STMN1 mRNA CTD PMID:30047161 Stmn1 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of STMN1 mRNA CTD PMID:16483693 Stmn1 Rat ammonium chloride decreases expression EXP 6480464 Ammonium Chloride results in decreased expression of STMN1 protein CTD PMID:16483693 Stmn1 Rat anthracene-1,8,9-triol increases expression ISO Stmn1 (Mus musculus) 6480464 Anthralin results in increased expression of STMN1 protein CTD PMID:20025956 Stmn1 Rat arsenite(3-) decreases expression ISO Stmn1 (Mus musculus) 6480464 arsenite results in decreased expression of STMN1 mRNA CTD PMID:18929588 Stmn1 Rat arsenite(3-) multiple interactions ISO STMN1 (Homo sapiens) 6480464 arsenite promotes the reaction [G3BP1 protein binds to STMN1 mRNA] CTD PMID:32406909 Stmn1 Rat arsenite(3-) increases expression ISO Stmn1 (Mus musculus) 6480464 arsenite results in increased expression of STMN1 mRNA CTD PMID:18191166 Stmn1 Rat arsenous acid decreases expression ISO STMN1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of STMN1 mRNA and Arsenic Trioxide results in decreased expression of STMN1 protein CTD PMID:19364129 and PMID:20657188 Stmn1 Rat arsenous acid decreases response to substance ISO STMN1 (Homo sapiens) 6480464 STMN1 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20657188 Stmn1 Rat arsenous acid increases response to substance ISO STMN1 (Homo sapiens) 6480464 STMN1 protein results in increased susceptibility to Arsenic Trioxide CTD PMID:20707922 Stmn1 Rat arsenous acid multiple interactions ISO STMN1 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one promotes the reaction [Arsenic Trioxide results in increased degradation of STMN1 protein] more ... CTD PMID:20657188 Stmn1 Rat atrazine decreases expression ISO STMN1 (Homo sapiens) 6480464 Atrazine results in decreased expression of STMN1 protein CTD PMID:25275270 Stmn1 Rat azathioprine decreases expression ISO STMN1 (Homo sapiens) 6480464 Azathioprine results in decreased expression of STMN1 mRNA CTD PMID:22623647 Stmn1 Rat azoxystrobin increases expression ISO STMN1 (Homo sapiens) 6480464 azoxystrobin results in increased expression of STMN1 mRNA CTD PMID:33512557 Stmn1 Rat baicalein decreases expression ISO STMN1 (Homo sapiens) 6480464 baicalein results in decreased expression of STMN1 protein CTD PMID:38317500 Stmn1 Rat baicalein multiple interactions ISO STMN1 (Homo sapiens) 6480464 STMN1 protein inhibits the reaction [baicalein results in decreased expression of CTNNB1 protein] more ... CTD PMID:38317500 Stmn1 Rat benzo[a]pyrene decreases expression ISO STMN1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of STMN1 mRNA CTD PMID:20064835 Stmn1 Rat benzo[a]pyrene affects methylation ISO STMN1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of STMN1 3' UTR and Benzo(a)pyrene affects the methylation of STMN1 promoter CTD PMID:27901495 and PMID:30157460 Stmn1 Rat benzo[a]pyrene increases expression ISO Stmn1 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of STMN1 mRNA CTD PMID:15034205 more ... Stmn1 Rat benzo[a]pyrene multiple interactions ISO Stmn1 (Mus musculus) 6480464 AHR protein promotes the reaction [Benzo(a)pyrene results in increased expression of STMN1 mRNA] CTD PMID:15034205 Stmn1 Rat benzo[a]pyrene decreases expression ISO Stmn1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of STMN1 mRNA CTD PMID:21569818 Stmn1 Rat benzo[a]pyrene increases expression ISO STMN1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of STMN1 mRNA CTD PMID:20385220 Stmn1 Rat benzo[b]fluoranthene increases expression ISO Stmn1 (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of STMN1 mRNA CTD PMID:26377693 Stmn1 Rat benzophenone increases expression EXP 6480464 benzophenone results in increased expression of STMN1 mRNA CTD PMID:22584684 Stmn1 Rat beta-naphthoflavone multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of STMN1 mRNA CTD PMID:18164116 Stmn1 Rat bis(2-ethylhexyl) phthalate increases expression ISO Stmn1 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of STMN1 mRNA CTD PMID:34319233 Stmn1 Rat bisphenol A affects expression ISO STMN1 (Homo sapiens) 6480464 bisphenol A affects the expression of STMN1 mRNA CTD PMID:19490990 and PMID:30903817 Stmn1 Rat bisphenol A decreases expression ISO Stmn1 (Mus musculus) 6480464 bisphenol A results in decreased expression of STMN1 mRNA CTD PMID:35598803 Stmn1 Rat bisphenol A decreases expression ISO STMN1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of STMN1 mRNA and bisphenol A results in decreased expression of STMN1 protein CTD PMID:29275510 and PMID:37664457 Stmn1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of STMN1 mRNA CTD PMID:25181051 more ... Stmn1 Rat bisphenol A increases expression ISO STMN1 (Homo sapiens) 6480464 bisphenol A results in increased expression of STMN1 mRNA CTD PMID:16474171 and PMID:25047013 Stmn1 Rat bisphenol AF increases expression ISO STMN1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of STMN1 protein CTD PMID:34186270 Stmn1 Rat Bisphenol B increases expression ISO STMN1 (Homo sapiens) 6480464 bisphenol B results in increased expression of STMN1 protein CTD PMID:34186270 Stmn1 Rat bisphenol F increases expression ISO STMN1 (Homo sapiens) 6480464 bisphenol F results in increased expression of STMN1 protein CTD PMID:34186270 Stmn1 Rat bleomycin A2 increases expression EXP 6480464 Bleomycin results in increased expression of STMN1 protein CTD PMID:25933445 Stmn1 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of STMN1 mRNA CTD PMID:24136188 Stmn1 Rat cadmium atom increases expression ISO STMN1 (Homo sapiens) 6480464 Cadmium results in increased expression of STMN1 protein CTD PMID:16440303 Stmn1 Rat cadmium atom multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of STMN1 protein CTD PMID:33040242 Stmn1 Rat cadmium dichloride increases expression ISO STMN1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of STMN1 protein CTD PMID:16440303 Stmn1 Rat cadmium dichloride decreases expression EXP 6480464 Cadmium Chloride results in decreased expression of STMN1 mRNA CTD PMID:25993096 Stmn1 Rat cadmium dichloride multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of STMN1 protein CTD PMID:33040242 Stmn1 Rat caffeine increases expression ISO Stmn1 (Mus musculus) 6480464 Caffeine results in increased expression of STMN1 protein CTD PMID:20025956 Stmn1 Rat caffeine increases phosphorylation ISO STMN1 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of STMN1 protein CTD PMID:35688186 Stmn1 Rat calcitriol multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of STMN1 mRNA CTD PMID:21592394 Stmn1 Rat calcitriol decreases expression ISO STMN1 (Homo sapiens) 6480464 Calcitriol results in decreased expression of STMN1 mRNA CTD PMID:21592394 Stmn1 Rat calcium atom affects expression EXP 6480464 Calcium affects the expression of STMN1 mRNA CTD PMID:15913539 Stmn1 Rat calcium(0) affects expression EXP 6480464 Calcium affects the expression of STMN1 mRNA CTD PMID:15913539 Stmn1 Rat cannabidiol multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of STMN1 protein CTD PMID:34122009 Stmn1 Rat carbamazepine affects expression ISO STMN1 (Homo sapiens) 6480464 Carbamazepine affects the expression of STMN1 mRNA CTD PMID:24752500 Stmn1 Rat carbon nanotube decreases expression ISO Stmn1 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Stmn1 Rat carbon nanotube increases expression ISO Stmn1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of STMN1 mRNA CTD PMID:25554681 Stmn1 Rat carmustine affects response to substance ISO STMN1 (Homo sapiens) 6480464 STMN1 mRNA affects the susceptibility to Carmustine CTD PMID:17440165 Stmn1 Rat chlordecone decreases expression ISO Stmn1 (Mus musculus) 6480464 Chlordecone results in decreased expression of STMN1 mRNA CTD PMID:33711761 Stmn1 Rat chlorendic acid increases expression EXP 6480464 chlorendic acid results in increased expression of STMN1 mRNA CTD PMID:22584684 Stmn1 Rat chlorophyllin decreases expression ISO STMN1 (Homo sapiens) 6480464 chlorophyllin analog results in decreased expression of STMN1 protein CTD PMID:22852132 Stmn1 Rat cholic acid increases expression ISO Stmn1 (Mus musculus) 6480464 Cholic Acid results in increased expression of STMN1 protein CTD PMID:20025956 Stmn1 Rat chromium(6+) multiple interactions ISO STMN1 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of STMN1 mRNA CTD PMID:38479592 Stmn1 Rat cisplatin increases expression ISO STMN1 (Homo sapiens) 6480464 Cisplatin results in increased expression of STMN1 protein CTD PMID:21924258 Stmn1 Rat cisplatin multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of STMN1 mRNA CTD PMID:27392435 Stmn1 Rat cisplatin decreases expression ISO Stmn1 (Mus musculus) 6480464 Cisplatin results in decreased expression of STMN1 mRNA CTD PMID:21151649 Stmn1 Rat clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of STMN1 mRNA CTD PMID:12011481 Stmn1 Rat clofibrate increases expression ISO Stmn1 (Mus musculus) 6480464 Clofibrate results in increased expression of STMN1 protein CTD PMID:20025956 Stmn1 Rat clomipramine affects expression EXP 6480464 Clomipramine affects the expression of STMN1 mRNA CTD PMID:18355885 Stmn1 Rat cobalt dichloride decreases expression ISO STMN1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of STMN1 mRNA CTD PMID:19320972 Stmn1 Rat copper atom multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of STMN1 mRNA and [NSC 689534 binds to Copper] which results in decreased expression of STMN1 mRNA CTD PMID:20971185 and PMID:30911355 Stmn1 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of STMN1 mRNA CTD PMID:30556269 Stmn1 Rat copper atom increases expression ISO STMN1 (Homo sapiens) 6480464 Copper results in increased expression of STMN1 mRNA CTD PMID:16391388 Stmn1 Rat copper(0) multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of STMN1 mRNA and [NSC 689534 binds to Copper] which results in decreased expression of STMN1 mRNA CTD PMID:20971185 and PMID:30911355 Stmn1 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of STMN1 mRNA CTD PMID:30556269 Stmn1 Rat copper(0) increases expression ISO STMN1 (Homo sapiens) 6480464 Copper results in increased expression of STMN1 mRNA CTD PMID:16391388 Stmn1 Rat copper(II) chloride decreases expression ISO Stmn1 (Mus musculus) 6480464 cupric chloride results in decreased expression of STMN1 protein CTD PMID:29617964 Stmn1 Rat copper(II) sulfate decreases expression ISO STMN1 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of STMN1 mRNA CTD PMID:19549813 Stmn1 Rat corticosterone decreases expression EXP 6480464 Corticosterone results in decreased expression of STMN1 mRNA CTD PMID:15755911 Stmn1 Rat coumestrol multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Stmn1 Rat coumestrol increases expression ISO STMN1 (Homo sapiens) 6480464 Coumestrol results in increased expression of STMN1 mRNA CTD PMID:19167446 Stmn1 Rat crocidolite asbestos decreases expression ISO Stmn1 (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of STMN1 mRNA CTD PMID:29279043 Stmn1 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of STMN1 mRNA CTD PMID:27523638 Stmn1 Rat Cuprizon multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Cuprizone co-treated with Cannabidiol] results in decreased expression of STMN1 protein CTD PMID:34122009 Stmn1 Rat cyclosporin A decreases expression ISO STMN1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of STMN1 mRNA CTD PMID:20106945 more ... Stmn1 Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of STMN1 protein CTD PMID:21561882 Stmn1 Rat cypermethrin multiple interactions EXP 6480464 Minocycline inhibits the reaction [cypermethrin results in decreased expression of STMN1 protein] CTD PMID:21561882 Stmn1 Rat DDE increases expression ISO STMN1 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of STMN1 mRNA CTD PMID:38568856 Stmn1 Rat deoxynivalenol increases phosphorylation ISO Stmn1 (Mus musculus) 6480464 deoxynivalenol results in increased phosphorylation of STMN1 protein CTD PMID:23352502 and PMID:23811945 Stmn1 Rat diarsenic trioxide increases response to substance ISO STMN1 (Homo sapiens) 6480464 STMN1 protein results in increased susceptibility to Arsenic Trioxide CTD PMID:20707922 Stmn1 Rat diarsenic trioxide decreases response to substance ISO STMN1 (Homo sapiens) 6480464 STMN1 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20657188 Stmn1 Rat diarsenic trioxide multiple interactions ISO STMN1 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one promotes the reaction [Arsenic Trioxide results in increased degradation of STMN1 protein] more ... CTD PMID:20657188 Stmn1 Rat diarsenic trioxide decreases expression ISO STMN1 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of STMN1 mRNA and Arsenic Trioxide results in decreased expression of STMN1 protein CTD PMID:19364129 and PMID:20657188 Stmn1 Rat dibenz[a,h]anthracene increases expression ISO Stmn1 (Mus musculus) 6480464 1 more ... CTD PMID:26377693 Stmn1 Rat Dibutyl phosphate affects expression ISO STMN1 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of STMN1 mRNA CTD PMID:37042841 Stmn1 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of STMN1 mRNA CTD PMID:21266533 Stmn1 Rat dibutyl phthalate decreases expression ISO Stmn1 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of STMN1 mRNA CTD PMID:17361019 and PMID:21266533 Stmn1 Rat diclofenac affects expression ISO STMN1 (Homo sapiens) 6480464 Diclofenac affects the expression of STMN1 mRNA CTD PMID:24752500 Stmn1 Rat dicrotophos decreases expression ISO STMN1 (Homo sapiens) 6480464 dicrotophos results in decreased expression of STMN1 mRNA CTD PMID:28302478 Stmn1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of STMN1 mRNA CTD PMID:15890375 Stmn1 Rat doxorubicin affects response to substance ISO STMN1 (Homo sapiens) 6480464 STMN1 affects the susceptibility to Doxorubicin CTD PMID:16458935 Stmn1 Rat doxorubicin decreases expression ISO Stmn1 (Mus musculus) 6480464 Doxorubicin results in decreased expression of STMN1 mRNA CTD PMID:28608983 Stmn1 Rat doxorubicin decreases expression ISO STMN1 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of STMN1 mRNA CTD PMID:29803840 Stmn1 Rat doxorubicin affects expression ISO STMN1 (Homo sapiens) 6480464 Doxorubicin affects the expression of STMN1 protein CTD PMID:29385562 Stmn1 Rat Enterolactone multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of STMN1 mRNA CTD PMID:19167446 Stmn1 Rat ethanol increases expression ISO Stmn1 (Mus musculus) 6480464 Ethanol results in increased expression of STMN1 mRNA CTD PMID:30319688 Stmn1 Rat etoposide affects response to substance ISO STMN1 (Homo sapiens) 6480464 STMN1 affects the susceptibility to Etoposide CTD PMID:17172428 Stmn1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of STMN1 mRNA CTD PMID:24136188 Stmn1 Rat fipronil increases expression EXP 6480464 fipronil results in increased expression of STMN1 mRNA CTD PMID:23962444 Stmn1 Rat folic acid decreases expression ISO Stmn1 (Mus musculus) 6480464 Folic Acid results in decreased expression of STMN1 mRNA CTD PMID:25629700 Stmn1 Rat folic acid multiple interactions ISO Stmn1 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of STMN1 mRNA] CTD PMID:22206623 Stmn1 Rat fulvestrant decreases expression ISO STMN1 (Homo sapiens) 6480464 fulvestrant results in decreased expression of STMN1 mRNA CTD PMID:16514628 Stmn1 Rat furan increases expression ISO Stmn1 (Mus musculus) 6480464 furan results in increased expression of STMN1 mRNA CTD PMID:24183702 more ... Stmn1 Rat furan multiple interactions ISO Stmn1 (Mus musculus) 6480464 [Bromodeoxyuridine co-treated with furan] results in increased expression of STMN1 mRNA CTD PMID:24910943 Stmn1 Rat furfural multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of STMN1 protein and [Sodium Chloride co-treated with Furaldehyde] results in increased expression of STMN1 protein CTD PMID:38598786 Stmn1 Rat gemfibrozil affects expression EXP 6480464 Gemfibrozil affects the expression of STMN1 mRNA CTD PMID:12011481 Stmn1 Rat genistein increases expression ISO STMN1 (Homo sapiens) 6480464 Genistein results in increased expression of STMN1 mRNA CTD PMID:16474171 Stmn1 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of STMN1 mRNA CTD PMID:22061828 Stmn1 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of STMN1 mRNA CTD PMID:33387578 Stmn1 Rat geraniol decreases expression ISO STMN1 (Homo sapiens) 6480464 geraniol results in decreased expression of STMN1 mRNA CTD PMID:27683099 Stmn1 Rat glafenine decreases expression EXP 6480464 Glafenine results in decreased expression of STMN1 mRNA CTD PMID:24136188 Stmn1 Rat glycine betaine decreases expression EXP 6480464 Betaine results in decreased expression of STMN1 mRNA CTD PMID:26391144 Stmn1 Rat imipramine affects expression EXP 6480464 Imipramine affects the expression of STMN1 mRNA CTD PMID:18355885 Stmn1 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of STMN1 mRNA CTD PMID:21396975 Stmn1 Rat indole-3-methanol multiple interactions EXP 6480464 [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of STMN1 mRNA CTD PMID:22129741 Stmn1 Rat iprodione increases expression EXP 6480464 iprodione results in increased expression of STMN1 mRNA CTD PMID:28576679 Stmn1 Rat isobutanol multiple interactions ISO STMN1 (Homo sapiens) 6480464 [[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of STMN1 mRNA CTD PMID:29432896 Stmn1 Rat Isobutylparaben increases expression ISO Stmn1 (Mus musculus) 6480464 isobutyl-4-hydroxybenzoate results in increased expression of STMN1 protein CTD PMID:20025956 Stmn1 Rat ivermectin decreases expression ISO STMN1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of STMN1 protein CTD PMID:32959892 Stmn1 Rat ketoconazole affects expression EXP 6480464 Ketoconazole affects the expression of STMN1 mRNA CTD PMID:18355885 Stmn1 Rat lead diacetate multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of STMN1 mRNA CTD PMID:36642386 Stmn1 Rat lead(0) multiple interactions EXP 6480464 [lead acetate results in increased abundance of Lead] which results in increased expression of STMN1 mRNA CTD PMID:36642386 Stmn1 Rat leflunomide decreases expression EXP 6480464 leflunomide results in decreased expression of STMN1 mRNA CTD PMID:24136188 Stmn1 Rat leflunomide decreases expression ISO STMN1 (Homo sapiens) 6480464 leflunomide results in decreased expression of STMN1 mRNA CTD PMID:28988120 Stmn1 Rat levofloxacin decreases expression EXP 6480464 Levofloxacin results in decreased expression of STMN1 mRNA CTD PMID:24136188 Stmn1 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of STMN1 mRNA and Lidocaine results in increased expression of STMN1 protein CTD PMID:27018092 Stmn1 Rat lipopolysaccharide multiple interactions ISO STMN1 (Homo sapiens) 6480464 [NAT10 protein affects the susceptibility to Lipopolysaccharides] which affects the expression of STMN1 mRNA CTD PMID:35877022 Stmn1 Rat lithocholic acid increases expression ISO Stmn1 (Mus musculus) 6480464 Lithocholic Acid results in increased expression of STMN1 mRNA CTD PMID:19000923 Stmn1 Rat lomustine affects response to substance ISO STMN1 (Homo sapiens) 6480464 STMN1 mRNA affects the susceptibility to Lomustine CTD PMID:17440165 Stmn1 Rat lucanthone decreases expression ISO STMN1 (Homo sapiens) 6480464 Lucanthone results in decreased expression of STMN1 mRNA CTD PMID:21148553 Stmn1 Rat LY294002 multiple interactions ISO STMN1 (Homo sapiens) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one promotes the reaction [arsenic trioxide results in increased degradation of STMN1 protein] CTD PMID:20657188 Stmn1 Rat maneb multiple interactions ISO Stmn1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of STMN1 protein more ... CTD PMID:23562983 Stmn1 Rat methamphetamine affects expression EXP 6480464 Methamphetamine affects the expression of STMN1 protein CTD PMID:17904249 Stmn1 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of STMN1 mRNA CTD PMID:15890375 more ... Stmn1 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of STMN1 mRNA CTD PMID:30047161 Stmn1 Rat methylparaben decreases expression ISO STMN1 (Homo sapiens) 6480464 methylparaben results in decreased expression of STMN1 mRNA CTD PMID:31745603 Stmn1 Rat Mezerein increases expression ISO Stmn1 (Mus musculus) 6480464 mezerein results in increased expression of STMN1 mRNA CTD PMID:19000923 Stmn1 Rat microcystin-LR decreases expression EXP 6480464 cyanoginosin LR results in decreased expression of STMN1 mRNA CTD PMID:23342045 Stmn1 Rat minocycline multiple interactions EXP 6480464 Minocycline inhibits the reaction [cypermethrin results in decreased expression of STMN1 protein] CTD PMID:21561882 Stmn1 Rat minocycline multiple interactions ISO Stmn1 (Mus musculus) 6480464 Minocycline inhibits the reaction [[Maneb co-treated with Paraquat] results in decreased expression of STMN1 protein] CTD PMID:23562983 Stmn1 Rat N-methyl-N-nitrosourea increases expression EXP 6480464 Methylnitrosourea results in increased expression of STMN1 mRNA CTD PMID:16525678 Stmn1 Rat N-nitrosodiethylamine multiple interactions ISO Stmn1 (Mus musculus) 6480464 RB1 protein inhibits the reaction [Diethylnitrosamine results in increased expression of STMN1 mRNA] CTD PMID:17854601 Stmn1 Rat N-nitrosodiethylamine increases expression ISO Stmn1 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of STMN1 mRNA CTD PMID:17854601 and PMID:24535843 Stmn1 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with beta-Naphthoflavone] results in increased expression of STMN1 mRNA and [indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of STMN1 mRNA CTD PMID:18164116 and PMID:22129741 Stmn1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of STMN1 mRNA CTD PMID:15890375 Stmn1 Rat N-Nitrosopyrrolidine decreases expression ISO STMN1 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of STMN1 mRNA CTD PMID:32234424 Stmn1 Rat okadaic acid increases expression ISO Stmn1 (Mus musculus) 6480464 Okadaic Acid results in increased expression of STMN1 mRNA CTD PMID:19000923 Stmn1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of STMN1 mRNA CTD PMID:25729387 Stmn1 Rat ozone multiple interactions ISO Stmn1 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of STMN1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of STMN1 mRNA CTD PMID:34911549 Stmn1 Rat ozone increases expression ISO Stmn1 (Mus musculus) 6480464 Ozone results in increased expression of STMN1 mRNA CTD PMID:33026818 Stmn1 Rat paclitaxel affects response to substance ISO STMN1 (Homo sapiens) 6480464 STMN1 affects the susceptibility to Paclitaxel CTD PMID:17172428 Stmn1 Rat palbociclib decreases expression ISO STMN1 (Homo sapiens) 6480464 palbociclib results in decreased expression of STMN1 mRNA CTD PMID:22869556 Stmn1 Rat paracetamol affects expression ISO Stmn1 (Mus musculus) 6480464 Acetaminophen affects the expression of STMN1 mRNA CTD PMID:17562736 Stmn1 Rat paracetamol increases expression ISO STMN1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of STMN1 mRNA CTD PMID:22230336 Stmn1 Rat paracetamol increases expression ISO Stmn1 (Mus musculus) 6480464 Acetaminophen results in increased expression of STMN1 protein CTD PMID:20025956 Stmn1 Rat paraquat multiple interactions ISO Stmn1 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of STMN1 protein more ... CTD PMID:23562983 Stmn1 Rat perfluorododecanoic acid decreases expression EXP 6480464 perfluorododecanoic acid results in decreased expression of STMN1 protein CTD PMID:19854247 Stmn1 Rat perfluorooctane-1-sulfonic acid increases expression ISO Stmn1 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in increased expression of STMN1 protein CTD PMID:26178269 Stmn1 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Stmn1 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of STMN1 mRNA CTD PMID:36331819 Stmn1 Rat perfluorooctanoic acid decreases expression ISO STMN1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of STMN1 protein CTD PMID:26879310 Stmn1 Rat perfluorooctanoic acid increases expression ISO STMN1 (Homo sapiens) 6480464 perfluorooctanoic acid results in increased expression of STMN1 mRNA CTD PMID:37738295 Stmn1 Rat phenformin decreases expression EXP 6480464 Phenformin results in decreased expression of STMN1 mRNA CTD PMID:31324951 Stmn1 Rat phenobarbital increases expression ISO Stmn1 (Mus musculus) 6480464 Phenobarbital results in increased expression of STMN1 mRNA CTD PMID:20403969 Stmn1 Rat phenobarbital affects expression ISO Stmn1 (Mus musculus) 6480464 Phenobarbital affects the expression of STMN1 mRNA CTD PMID:23091169 Stmn1 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of STMN1 mRNA CTD PMID:12011481 more ... Stmn1 Rat phenylephrine decreases expression EXP 6480464 Phenylephrine results in decreased expression of STMN1 mRNA CTD PMID:18158353 Stmn1 Rat PhIP increases expression EXP 6480464 2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of STMN1 mRNA CTD PMID:12376462 and PMID:29877212 Stmn1 Rat phorbol 13-acetate 12-myristate increases expression ISO Stmn1 (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in increased expression of STMN1 mRNA CTD PMID:19000923 Stmn1 Rat picoxystrobin increases expression ISO STMN1 (Homo sapiens) 6480464 picoxystrobin results in increased expression of STMN1 mRNA CTD PMID:33512557 Stmn1 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of STMN1 mRNA CTD PMID:15890375 and PMID:22484513 Stmn1 Rat pirinixic acid multiple interactions ISO Stmn1 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in increased expression of STMN1 mRNA] CTD PMID:17950772 Stmn1 Rat pirinixic acid increases expression ISO Stmn1 (Mus musculus) 6480464 pirinixic acid results in increased expression of STMN1 mRNA CTD PMID:17950772 more ... Stmn1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of STMN1 mRNA CTD PMID:12011481 more ... Stmn1 Rat piroxicam decreases expression ISO STMN1 (Homo sapiens) 6480464 Piroxicam results in decreased expression of STMN1 mRNA CTD PMID:21858171 Stmn1 Rat potassium nitrate increases expression ISO STMN1 (Homo sapiens) 6480464 potassium nitrate results in increased expression of STMN1 mRNA CTD PMID:15878651 Stmn1 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of STMN1 mRNA CTD PMID:19162173 and PMID:30047161 Stmn1 Rat progesterone decreases expression EXP 6480464 Progesterone results in decreased expression of STMN1 mRNA CTD PMID:20726854 Stmn1 Rat propanal decreases expression ISO STMN1 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of STMN1 mRNA CTD PMID:26079696 Stmn1 Rat propiconazole increases expression ISO Stmn1 (Mus musculus) 6480464 propiconazole results in increased expression of STMN1 mRNA CTD PMID:21278054 Stmn1 Rat quercetin decreases expression ISO STMN1 (Homo sapiens) 6480464 Quercetin results in decreased expression of STMN1 protein CTD PMID:15221776 Stmn1 Rat raloxifene decreases expression ISO STMN1 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of STMN1 mRNA CTD PMID:16514628 Stmn1 Rat resveratrol decreases expression ISO STMN1 (Homo sapiens) 6480464 resveratrol results in decreased expression of STMN1 protein CTD PMID:18089832 Stmn1 Rat resveratrol increases phosphorylation ISO STMN1 (Homo sapiens) 6480464 resveratrol results in increased phosphorylation of STMN1 protein CTD PMID:22349766 Stmn1 Rat resveratrol multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in increased expression of STMN1 mRNA CTD PMID:19167446 Stmn1 Rat rotenone increases expression ISO STMN1 (Homo sapiens) 6480464 Rotenone results in increased expression of STMN1 mRNA CTD PMID:33512557 Stmn1 Rat saccharin increases expression ISO Stmn1 (Mus musculus) 6480464 Saccharin results in increased expression of STMN1 mRNA CTD PMID:19000923 Stmn1 Rat sarin decreases expression EXP 6480464 Sarin results in decreased expression of STMN1 protein CTD PMID:28973502 Stmn1 Rat SB 431542 multiple interactions ISO STMN1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of STMN1 protein CTD PMID:37664457 Stmn1 Rat senecionine increases expression EXP 6480464 senecionine results in increased expression of STMN1 mRNA CTD PMID:32419051 Stmn1 Rat Senkirkine increases expression EXP 6480464 senkirkine results in increased expression of STMN1 mRNA CTD PMID:32419051 Stmn1 Rat sertraline decreases expression ISO STMN1 (Homo sapiens) 6480464 Sertraline results in decreased expression of STMN1 mRNA CTD PMID:24865413 Stmn1 Rat sodium arsenite affects methylation ISO STMN1 (Homo sapiens) 6480464 sodium arsenite affects the methylation of STMN1 gene CTD PMID:28589171 Stmn1 Rat sodium arsenite decreases expression ISO STMN1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of STMN1 mRNA and sodium arsenite results in decreased expression of STMN1 protein CTD PMID:30528433 and PMID:38568856 Stmn1 Rat sodium arsenite increases expression ISO STMN1 (Homo sapiens) 6480464 sodium arsenite results in increased expression of STMN1 mRNA CTD PMID:29301061 Stmn1 Rat sodium chloride multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Sodium Chloride co-treated with Furaldehyde] results in decreased expression of and affects the localization of STMN1 protein more ... CTD PMID:38598786 Stmn1 Rat sodium fluoride increases expression ISO Stmn1 (Mus musculus) 6480464 Sodium Fluoride results in increased expression of STMN1 protein CTD PMID:27548804 Stmn1 Rat sodium nitrite increases expression ISO Stmn1 (Mus musculus) 6480464 Sodium Nitrite results in increased expression of STMN1 protein CTD PMID:20025956 Stmn1 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of STMN1 mRNA CTD PMID:30047161 Stmn1 Rat sunitinib decreases expression ISO STMN1 (Homo sapiens) 6480464 Sunitinib results in decreased expression of STMN1 mRNA CTD PMID:31533062 Stmn1 Rat tamoxifen affects expression ISO Stmn1 (Mus musculus) 6480464 Tamoxifen affects the expression of STMN1 mRNA CTD PMID:17555576 Stmn1 Rat tauroursodeoxycholic acid increases expression EXP 6480464 ursodoxicoltaurine results in increased expression of STMN1 mRNA CTD PMID:15885361 Stmn1 Rat tert-butyl hydroperoxide decreases expression ISO STMN1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of STMN1 mRNA CTD PMID:15336504 Stmn1 Rat testosterone multiple interactions ISO STMN1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in decreased expression of STMN1 mRNA CTD PMID:21592394 Stmn1 Rat testosterone decreases expression ISO STMN1 (Homo sapiens) 6480464 Testosterone results in decreased expression of STMN1 mRNA CTD PMID:21592394 Stmn1 Rat tetrachloromethane affects expression ISO Stmn1 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of STMN1 mRNA CTD PMID:17484886 Stmn1 Rat tetrachloromethane increases expression ISO Stmn1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of STMN1 mRNA CTD PMID:29987408 Stmn1 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of STMN1 mRNA CTD PMID:31150632 Stmn1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of STMN1 mRNA] CTD PMID:31150632 Stmn1 Rat tetrachloromethane multiple interactions ISO Stmn1 (Mus musculus) 6480464 PLG gene mutant form promotes the reaction [Carbon Tetrachloride results in increased expression of STMN1 mRNA] CTD PMID:16006527 Stmn1 Rat thapsigargin decreases expression ISO STMN1 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of STMN1 mRNA CTD PMID:22378314 Stmn1 Rat thapsigargin decreases expression EXP 6480464 Thapsigargin results in decreased expression of STMN1 protein CTD PMID:35544339 Stmn1 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of STMN1 mRNA CTD PMID:23411599 Stmn1 Rat thiram decreases expression ISO STMN1 (Homo sapiens) 6480464 Thiram results in decreased expression of STMN1 mRNA CTD PMID:38568856 Stmn1 Rat titanium dioxide decreases expression ISO Stmn1 (Mus musculus) 6480464 titanium dioxide results in decreased expression of STMN1 mRNA CTD PMID:27760801 Stmn1 Rat titanium dioxide decreases methylation ISO Stmn1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of STMN1 gene and titanium dioxide results in decreased methylation of STMN1 promoter CTD PMID:35295148 Stmn1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of STMN1 mRNA CTD PMID:25729387 Stmn1 Rat trichloroethene increases expression ISO Stmn1 (Mus musculus) 6480464 Trichloroethylene results in increased expression of STMN1 mRNA CTD PMID:25549359 Stmn1 Rat trimellitic anhydride increases expression ISO Stmn1 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of STMN1 mRNA CTD PMID:19042947 Stmn1 Rat triphenyl phosphate increases expression EXP 6480464 triphenyl phosphate results in increased expression of STMN1 mRNA CTD PMID:30589522 Stmn1 Rat triphenyl phosphate affects expression ISO STMN1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of STMN1 mRNA CTD PMID:37042841 Stmn1 Rat triphenylstannane decreases expression ISO STMN1 (Homo sapiens) 6480464 triphenyltin analog results in decreased expression of STMN1 protein CTD PMID:31634547 Stmn1 Rat Triptolide decreases expression EXP 6480464 triptolide results in decreased expression of STMN1 protein CTD PMID:32519852 Stmn1 Rat troglitazone decreases expression ISO STMN1 (Homo sapiens) 6480464 troglitazone results in decreased expression of STMN1 mRNA CTD PMID:19140230 Stmn1 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of STMN1 mRNA CTD PMID:24136188 Stmn1 Rat trovafloxacin decreases expression ISO Stmn1 (Mus musculus) 6480464 trovafloxacin results in decreased expression of STMN1 mRNA CTD PMID:35537566 Stmn1 Rat tungsten increases expression ISO Stmn1 (Mus musculus) 6480464 Tungsten results in increased expression of STMN1 mRNA CTD PMID:30912803 Stmn1 Rat tunicamycin decreases expression ISO STMN1 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of STMN1 mRNA CTD PMID:22378314 Stmn1 Rat uranium atom affects expression ISO STMN1 (Homo sapiens) 6480464 Uranium affects the expression of STMN1 mRNA CTD PMID:15672453 Stmn1 Rat ursodeoxycholic acid increases expression EXP 6480464 Ursodeoxycholic Acid results in increased expression of STMN1 mRNA CTD PMID:15885361 Stmn1 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of STMN1 gene CTD PMID:31079544 Stmn1 Rat vorinostat decreases expression ISO STMN1 (Homo sapiens) 6480464 vorinostat results in decreased expression of STMN1 protein CTD PMID:20543569 Stmn1 Rat zinc dichloride increases expression ISO Stmn1 (Mus musculus) 6480464 zinc chloride results in increased expression of STMN1 mRNA CTD PMID:19000923 Stmn1 Rat zoledronic acid decreases expression ISO STMN1 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of STMN1 mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) (1->4)-beta-D-glucan (ISO) 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO) 1,2-dimethylhydrazine (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 1-naphthyl isothiocyanate (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP,ISO) 2,5-hexanedione (EXP) 2,6-di-tert-butyl-4-methylphenol (ISO) 2,6-dimethoxyphenol (ISO) 2-acetamidofluorene (EXP) 2-methoxyethanol (EXP) 2-nitrofluorene (EXP) 3,3'-Thiobispropanoic acid (ISO) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 4-hydroxynon-2-enal (ISO) 4-hydroxyphenyl retinamide (ISO) 5-bromo-2'-deoxyuridine (ISO) 6-propyl-2-thiouracil (EXP) 7,12-dimethyltetraphene (EXP) acetamide (EXP) acrylamide (ISO) afimoxifene (ISO) aflatoxin B1 (EXP,ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) amiodarone (EXP) amitriptyline (EXP) amitrole (EXP) ammonium chloride (EXP) anthracene-1,8,9-triol (ISO) arsenite(3-) (ISO) arsenous acid (ISO) atrazine (ISO) azathioprine (ISO) azoxystrobin (ISO) baicalein (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) benzophenone (EXP) beta-naphthoflavone (EXP) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (ISO) bleomycin A2 (EXP) buspirone (EXP) cadmium atom (ISO) cadmium dichloride (EXP,ISO) caffeine (ISO) calcitriol (ISO) calcium atom (EXP) calcium(0) (EXP) cannabidiol (ISO) carbamazepine (ISO) carbon nanotube (ISO) carmustine (ISO) chlordecone (ISO) chlorendic acid (EXP) chlorophyllin (ISO) cholic acid (ISO) chromium(6+) (ISO) cisplatin (ISO) clofibrate (EXP,ISO) clomipramine (EXP) cobalt dichloride (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) corticosterone (EXP) coumestrol (ISO) crocidolite asbestos (ISO) Cuprizon (EXP,ISO) cyclosporin A (ISO) cypermethrin (EXP) DDE (ISO) deoxynivalenol (ISO) diarsenic trioxide (ISO) dibenz[a,h]anthracene (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) diclofenac (ISO) dicrotophos (ISO) diethylstilbestrol (EXP) doxorubicin (ISO) Enterolactone (ISO) ethanol (ISO) etoposide (ISO) finasteride (EXP) fipronil (EXP) folic acid (ISO) fulvestrant (ISO) furan (ISO) furfural (ISO) gemfibrozil (EXP) genistein (ISO) gentamycin (EXP) geraniol (ISO) glafenine (EXP) glycine betaine (EXP) imipramine (EXP) indole-3-methanol (EXP) iprodione (EXP) isobutanol (ISO) Isobutylparaben (ISO) ivermectin (ISO) ketoconazole (EXP) lead diacetate (EXP) lead(0) (EXP) leflunomide (EXP,ISO) levofloxacin (EXP) lidocaine (EXP) lipopolysaccharide (ISO) lithocholic acid (ISO) lomustine (ISO) lucanthone (ISO) LY294002 (ISO) maneb (ISO) methamphetamine (EXP) methapyrilene (EXP) methimazole (EXP) methylparaben (ISO) Mezerein (ISO) microcystin-LR (EXP) minocycline (EXP,ISO) N-methyl-N-nitrosourea (EXP) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP) N-Nitrosopyrrolidine (ISO) okadaic acid (ISO) oxaliplatin (EXP) ozone (ISO) paclitaxel (ISO) palbociclib (ISO) paracetamol (ISO) paraquat (ISO) perfluorododecanoic acid (EXP) perfluorooctane-1-sulfonic acid (ISO) perfluorooctanoic acid (ISO) phenformin (EXP) phenobarbital (EXP,ISO) phenylephrine (EXP) PhIP (EXP) phorbol 13-acetate 12-myristate (ISO) picoxystrobin (ISO) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) piroxicam (ISO) potassium nitrate (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (EXP) propanal (ISO) propiconazole (ISO) quercetin (ISO) raloxifene (ISO) resveratrol (ISO) rotenone (ISO) saccharin (ISO) sarin (EXP) SB 431542 (ISO) senecionine (EXP) Senkirkine (EXP) sertraline (ISO) sodium arsenite (ISO) sodium chloride (ISO) sodium fluoride (ISO) sodium nitrite (ISO) sulfadimethoxine (EXP) sunitinib (ISO) tamoxifen (ISO) tauroursodeoxycholic acid (EXP) tert-butyl hydroperoxide (ISO) testosterone (ISO) tetrachloromethane (EXP,ISO) thapsigargin (EXP,ISO) thioacetamide (EXP) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) trichloroethene (ISO) trimellitic anhydride (ISO) triphenyl phosphate (EXP,ISO) triphenylstannane (ISO) Triptolide (EXP) troglitazone (ISO) trovafloxacin (EXP,ISO) tungsten (ISO) tunicamycin (ISO) uranium atom (ISO) ursodeoxycholic acid (EXP) vinclozolin (EXP) vorinostat (ISO) zinc dichloride (ISO) zoledronic acid (ISO)
Biological Process
axonogenesis (ISO) cell differentiation (IEA) establishment of skin barrier (IEA,ISO) hepatocyte growth factor receptor signaling pathway (IEA,ISO) intracellular signal transduction (TAS) microtubule depolymerization (IBA,IEA,ISO,TAS) mitotic cytokinesis (IEA,ISO) mitotic spindle organization (IEA,ISO) negative regulation of guanyl-nucleotide exchange factor activity (ISO) negative regulation of microtubule polymerization (IEA,ISO) negative regulation of Rho protein signal transduction (IEA,ISO) negative regulation of stress fiber assembly (IEA,ISO) negative regulation of thrombin-activated receptor signaling pathway (IEA,ISO) nervous system development (IEA) neuron projection development (IBA) regulation of cell migration (ISO) regulation of microtubule polymerization or depolymerization (IBA,IEA,ISO) response to virus (IEA,ISO)
1.
A single cDNA encodes two isoforms of stathmin, a developmentally regulated neuron-enriched phosphoprotein.
Doye V, etal., J Biol Chem 1989 Jul 25;264(21):12134-7.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
The stathmin phosphoprotein family: intracellular localization and effects on the microtubule network.
Gavet O, etal., J Cell Sci 1998 Nov;111 ( Pt 22):3333-46.
4.
miR-223 and Stathmin-1 Expression in Non-tumor Liver Tissue of Patients with Hepatocellular Carcinoma.
Imura S, etal., Anticancer Res. 2017 Oct;37(10):5877-5883. doi: 10.21873/anticanres.12033.
5.
Identification of cJun-responsive genes in Rat-1a cells using multiple techniques: increased expression of stathmin is necessary for cJun-mediated anchorage-independent growth.
Kinoshita I, etal., Oncogene 2003 May 8;22(18):2710-22.
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Differential, regional, and cellular expression of the stathmin family transcripts in the adult rat brain.
Ozon S, etal., J Neurosci Res 1999 Jun 1;56(5):553-64.
8.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
9.
GOA pipeline
RGD automated data pipeline
10.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
11.
Homology between the cDNAs encoding phosphoprotein p19 and SCG10 reveals a novel mammalian gene family preferentially expressed in developing brain.
Schubart UK, etal., DNA 1989 Jul-Aug;8(6):389-98.
12.
Enhanced expression of uterine stathmin during the process of implantation and decidualization in rats.
Tamura K, etal., Endocrinology 2003 Apr;144(4):1464-73.
Stmn1 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 151,964,308 - 151,970,843 (+) NCBI GRCr8 mRatBN7.2 5 146,680,757 - 146,687,154 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 146,681,436 - 146,687,154 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 149,383,560 - 149,389,224 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 151,153,616 - 151,159,276 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 151,139,803 - 151,145,467 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 152,680,412 - 152,686,807 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 152,680,407 - 152,686,806 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 156,466,632 - 156,472,404 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 153,226,420 - 153,232,084 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 153,236,461 - 153,242,123 (+) NCBI Celera 5 145,096,588 - 145,102,252 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
STMN1 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 25,884,179 - 25,906,880 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 25,884,181 - 25,906,991 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 26,210,670 - 26,233,371 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 26,099,194 - 26,105,955 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 25,910,750 - 25,917,510 NCBI Celera 1 24,606,762 - 24,629,447 (-) NCBI Celera Cytogenetic Map 1 p36.11 NCBI HuRef 1 24,466,602 - 24,489,287 (-) NCBI HuRef CHM1_1 1 26,323,940 - 26,346,632 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 25,721,609 - 25,744,310 (-) NCBI T2T-CHM13v2.0
Stmn1 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 134,195,631 - 134,201,154 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 134,195,631 - 134,201,154 (+) Ensembl GRCm39 Ensembl GRCm38 4 134,468,320 - 134,473,843 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 134,468,320 - 134,473,843 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 134,024,235 - 134,029,758 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 133,740,487 - 133,745,915 (+) NCBI MGSCv36 mm8 Celera 4 132,647,807 - 132,653,538 (+) NCBI Celera Cytogenetic Map 4 D2.3 NCBI cM Map 4 66.76 NCBI
Stmn1 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955452 5,388,150 - 5,391,518 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955452 5,387,696 - 5,393,337 (-) NCBI ChiLan1.0 ChiLan1.0
STMN1 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 200,967,177 - 200,973,463 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 200,065,138 - 200,071,427 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 25,159,241 - 25,165,535 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 26,208,731 - 26,230,957 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 26,208,731 - 26,230,925 (-) Ensembl panpan1.1 panPan2
STMN1 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 74,035,462 - 74,043,352 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 74,035,457 - 74,043,349 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 70,610,808 - 70,618,698 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 74,597,990 - 74,605,869 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 74,599,514 - 74,605,869 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 71,422,689 - 71,429,324 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 72,428,285 - 72,436,168 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 73,432,116 - 73,440,006 (+) NCBI UU_Cfam_GSD_1.0
Stmn1 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 44,645,226 - 44,651,269 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 10,468,728 - 10,475,594 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 10,470,006 - 10,475,557 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
STMN1 (Sus scrofa - pig)
Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 6 83,356,412 - 83,362,500 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 6 83,356,404 - 83,362,546 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 6 76,904,244 - 76,934,107 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
STMN1 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 106,866,719 - 106,873,314 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 106,868,838 - 106,874,403 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 9,543,680 - 9,549,933 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Stmn1 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 79 Count of miRNA genes: 55 Interacting mature miRNAs: 69 Transcripts: ENSRNOT00000022574 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 2302369 Scl60 Serum cholesterol level QTL 60 3.13 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 143608201 161165651 Rat 631562 Apr2 Acute phase response QTL 2 3.7 blood murinoglobulin 1 amount (VT:0010597) plasma murinoglobulin 1 level (CMO:0001931) 5 135927956 166875058 Rat 61444 Strs2 Sensitivity to stroke QTL 2 4.7 cerebrum integrity trait (VT:0010549) post-insult time to onset of cerebrovascular lesion (CMO:0002343) 5 135929696 166875058 Rat 1300119 Bp180 Blood pressure QTL 180 3.82 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 144358090 157869054 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631263 Cm24 Cardiac mass QTL 24 3.5 heart mass (VT:0007028) heart left ventricle weight to body weight ratio (CMO:0000530) 5 143799107 158428037 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 1331721 Bp210 Blood pressure QTL 210 3.413 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 5 143069996 166846814 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 2313096 Bmd78 Bone mineral density QTL 78 3.1 0.0001 tibia mineral mass (VT:1000283) total volumetric bone mineral density (CMO:0001728) 5 144377876 161317411 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
RH94569
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 8 87,337,051 - 87,337,208 (+) MAPPER mRatBN7.2 mRatBN7.2 5 146,686,949 - 146,687,106 (+) MAPPER mRatBN7.2 Rnor_6.0 8 94,041,606 - 94,041,762 NCBI Rnor6.0 Rnor_6.0 5 152,686,605 - 152,686,761 NCBI Rnor6.0 Rnor_5.0 8 93,555,446 - 93,555,602 UniSTS Rnor5.0 Rnor_5.0 5 156,472,203 - 156,472,359 UniSTS Rnor5.0 Cytogenetic Map 8 q31 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000022574 ⟹ ENSRNOP00000022574
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 146,683,527 - 146,687,153 (+) Ensembl Rnor_6.0 Ensembl 5 152,681,131 - 152,686,806 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076052 ⟹ ENSRNOP00000068006
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 146,681,436 - 146,687,153 (+) Ensembl Rnor_6.0 Ensembl 5 152,681,101 - 152,686,806 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076736
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 5 152,681,112 - 152,684,129 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000076864 ⟹ ENSRNOP00000068405
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 146,681,476 - 146,687,154 (+) Ensembl Rnor_6.0 Ensembl 5 152,680,407 - 152,685,974 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000105029 ⟹ ENSRNOP00000083571
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 146,682,105 - 146,687,153 (+) Ensembl
RefSeq Acc Id:
NM_017166 ⟹ NP_058862
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 151,965,179 - 151,970,839 (+) NCBI mRatBN7.2 5 146,681,487 - 146,687,147 (+) NCBI Rnor_6.0 5 152,681,142 - 152,686,806 (+) NCBI Rnor_5.0 5 156,466,632 - 156,472,404 (+) NCBI RGSC_v3.4 5 153,226,420 - 153,232,084 (+) RGD Celera 5 145,096,588 - 145,102,252 (+) RGD
Sequence:
GGTCCGAGCCGCCTGGCTTAGGCGGAGGCGACGGCAGGGTAGGGAGCAGCCGGGAACGCGGCGAGCCCCTAGCCGGGGACACGGGACGGGCGGAGACCTCGAGCCCTGGGCTTTCCTTGCCAGTGGAT TGTGTAGAGTGTACAGCCAGTCTCTTGTCTTCTGTCCAACATGGCATCTTCTGATATTCAGGTGAAAGAGCTGGAGAAGCGAGCTTCCGGCCAGGCTTTTGAGCTGATTCTCAGCCCTCGATCAAAAG AATCTGTCCCCGAGTTCCCCCTTTCCCCCCCAAAGAAGAAGGATCTTTCCCTGGAGGAAATTCAGAAGAAATTAGAAGCTGCAGAAGAAAGACGCAAGTCTCATGAAGCAGAAGTCTTGAAGCAGCTC GCTGAGAAGCGGGAGCATGAAAAAGAAGTGCTCCAGAAAGCCATTGAGGAGAACAACAACTTCAGCAAAATGGCAGAGGAGAAACTGACCCACAAAATGGAGGCTAACAAAGAGAACCGGGAGGCGCA AATGGCTGCCAAGCTGGAGCGTTTGCGAGAGAAGGACAAGCACGTTGAAGAGGTGCGGAAGAACAAAGAATCCAAAGACCCCGCGGACGAGACCGAGGCTGACTAAGTTGTTCCGAGAACTGACTTTC TCCCCGACCCCTTCCTAAATATCCAAAGACTGTACTGGCCAGTGTCATTTACTTTTTCCTCCCTGACAAATATTCTAGAAGCTGATGTAGGAACCGTATAGGTAGATCCAGACCGTGAGATGTTTTAG GGGCTCAAGGGGAGAAACTGAAAGTGTTTTGCTCTTTTTTAAAGTGTTGGTCTTTCTAACGTAGCTATTTTTCTCGTTGCATCTTTTCCTCTCGGGCACACTCGGTGTGCTGGGTTAATGGCTAGTGC TGTATTGACTGTGGAAGACGTTCGTGAAGAGTATGTAGTGGCTTCTTCCAACCCATTAGATGCTGAGTATCTGTTCACTTTGCGATCCCAATTCTGTCCCAATCTCACCAGATGCTACTGTACTGGAA TGGTTAATAAACTGCACAGTGCTGTTGGTC
hide sequence
RefSeq Acc Id:
XM_006239123 ⟹ XP_006239185
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 151,964,308 - 151,970,843 (+) NCBI mRatBN7.2 5 146,681,341 - 146,687,151 (+) NCBI Rnor_6.0 5 152,681,028 - 152,686,806 (+) NCBI Rnor_5.0 5 156,466,632 - 156,472,404 (+) NCBI
Sequence:
AATGCGGTGCGCCTGGTCCGGGTCACGTGCCGCTGTTTGGCGCTTTTGTGCGCGCCCAGGTCTG TTGGTTCTCAGAGTGTGGCCAGGCGGCTCGGACTGAGCAGGGCTTTCCTTGCCAGTGGATTGTGTAGAGTGTACAGCCAGTCTCTTGTCTTCTGTCCAACATGGCATCTTCTGATATTCAGGTGAAAG AGCTGGAGAAGCGTGCTTCCGGCCAGGCTTTTGAGCTGATTCTCAGCCCTCGATCAAAAGAATCTGTCCCCGAGTTCCCCCTTTCCCCCCCAAAGAAGAAGGATCTTTCCCTGGAGGAAATTCAGAAG AAATTAGAAGCTGCAGAAGAAAGACGCAAGTCTCATGAAGCAGAAGTCTTGAAGCAGCTCGCTGAGAAGCGGGAGCATGAAAAAGAAGTGCTCCAGAAAGCCATTGAGGAGAACAACAACTTCAGCAA AATGGCAGAGGAGAAACTGACCCACAAAATGGAGGCTAACAAAGAGAACCGGGAGGCGCAAATGGCTGCCAAGCTGGAGCGTTTGCGAGAGAAGGACAAGCACGTTGAAGAGGTGCGGAAGAACAAAG AATCCAAAGACCCCGCGGACGAGACCGAGGCTGACTAAGTTGTTCCGAGAACTGACTTTCTCCCCGACCCCTTCCTAAATATCCAAAGACTGTACTGGCCAGTGTCATTTACTTTTTCCCTCCTGACA AATATTCTAGAAGCTGATGTAGGACCGTATAGGTAGATCCAGACCGTGAGATGTTTTAGGGGCTCAAGGGGAGAAACTGAAAGTGTTTTGCTCTTTTTTAAAGTGTTGGTCTTTCTAACGTAGCTATT TTTCTCGTTGCATCTTTTCCTCTCGGGCACACTCGGTGTGCTGGGTTAATGGCTAGTGCTGTATTGACTGTGGAAGACGTTCGTGAAGAGTATGTAGTGGCTTCTTCCAACCCATTAGATGCTGAGTA TCTGTTCACTTTGCGATCCCAATTCTGTCCCAATCTCACCAGATGCTACTGTACTTGAATGGTTAATAAACTGCACAGTGCTGTTGGTC
hide sequence
RefSeq Acc Id:
XM_017593202 ⟹ XP_017448691
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 151,964,329 - 151,970,843 (+) NCBI mRatBN7.2 5 146,680,757 - 146,687,154 (+) NCBI Rnor_6.0 5 152,680,412 - 152,686,807 (+) NCBI
Sequence:
AGATCCTAGTGTTTCCAGCTCGGGAAGCTGATGGTGAGAATGCAAATGACCAAAGGAAGGACCACGCCCGTGACCTGCCAGTAGAAAATGGGTTAGCGACTGCGATGTCGCGCTACAGGGCTTTCCTT GCCAGTGGATTGTGTAGAGTGTACAGCCAGTCTCTTGTCTTCTGTCCAACATGGCATCTTCTGATATTCAGGTGAAAGAGCTGGAGAAGCGTGCTTCCGGCCAGGCTTTTGAGCTGATTCTCAGCCCT CGATCAAAAGAATCTGTCCCCGAGTTCCCCCTTTCCCCCCCAAAGAAGAAGGATCTTTCCCTGGAGGAAATTCAGAAGAAATTAGAAGCTGCAGAAGAAAGACGCAAGTCTCATGAAGCAGAAGTCTT GAAGCAGCTCGCTGAGAAGCGGGAGCATGAAAAAGAAGTGCTCCAGAAAGCCATTGAGGAGAACAACAACTTCAGCAAAATGGCAGAGGAGAAACTGACCCACAAAATGGAGGCTAACAAAGAGAACC GGGAGGCGCAAATGGCTGCCAAGCTGGAGCGTTTGCGAGAGAAGGACAAGCACGTTGAAGAGGTGCGGAAGAACAAAGAATCCAAAGACCCCGCGGACGAGACCGAGGCTGACTAAGTTGTTCCGAGA ACTGACTTTCTCCCCGACCCCTTCCTAAATATCCAAAGACTGTACTGGCCAGTGTCATTTACTTTTTCCCTCCTGACAAATATTCTAGAAGCTGATGTAGGACCGTATAGGTAGATCCAGACCGTGAG ATGTTTTAGGGGCTCAAGGGGAGAAACTGAAAGTGTTTTGCTCTTTTTTAAAGTGTTGGTCTTTCTAACGTAGCTATTTTTCTCGTTGCATCTTTTCCTCTCGGGCACACTCGGTGTGCTGGGTTAAT GGCTAGTGCTGTATTGACTGTGGAAGACGTTCGTGAAGAGTATGTAGTGGCTTCTTCCAACCCATTAGATGCTGAGTATCTGTTCACTTTGCGATCCCAATTCTGTCCCAATCTCACCAGATGCTACT GTACTTGAATGGTTAATAAACTGCACAGTGCTGTTGGTCG
hide sequence
RefSeq Acc Id:
XM_063287250 ⟹ XP_063143320
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 151,965,143 - 151,970,843 (+) NCBI
RefSeq Acc Id:
XM_063287251 ⟹ XP_063143321
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 151,966,464 - 151,970,843 (+) NCBI
RefSeq Acc Id:
XM_063287252 ⟹ XP_063143322
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 151,965,842 - 151,970,843 (+) NCBI
RefSeq Acc Id:
XM_063287253 ⟹ XP_063143323
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 151,964,333 - 151,970,843 (+) NCBI
RefSeq Acc Id:
NP_058862 ⟸ NM_017166
- UniProtKB:
P13668 (UniProtKB/Swiss-Prot), A0A8I5ZX99 (UniProtKB/TrEMBL), A0A8L2QYX2 (UniProtKB/TrEMBL), A6IT24 (UniProtKB/TrEMBL)
- Sequence:
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDK HVEEVRKNKESKDPADETEAD
hide sequence
RefSeq Acc Id:
XP_006239185 ⟸ XM_006239123
- Peptide Label:
isoform X1
- Sequence:
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSH EAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHVEEVRKNKESKDPADETEAD
hide sequence
RefSeq Acc Id:
XP_017448691 ⟸ XM_017593202
- Peptide Label:
isoform X1
- Sequence:
MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDK HVEEVRKNKESKDPADETEAD
hide sequence
Ensembl Acc Id:
ENSRNOP00000022574 ⟸ ENSRNOT00000022574
Ensembl Acc Id:
ENSRNOP00000068405 ⟸ ENSRNOT00000076864
Ensembl Acc Id:
ENSRNOP00000068006 ⟸ ENSRNOT00000076052
Ensembl Acc Id:
ENSRNOP00000083571 ⟸ ENSRNOT00000105029
RefSeq Acc Id:
XP_063143323 ⟸ XM_063287253
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063143320 ⟸ XM_063287250
- Peptide Label:
isoform X1
RefSeq Acc Id:
XP_063143322 ⟸ XM_063287252
- Peptide Label:
isoform X1
- UniProtKB:
P13668 (UniProtKB/Swiss-Prot), A6IT24 (UniProtKB/TrEMBL), A0A8I5ZX99 (UniProtKB/TrEMBL), A0A8L2QYX2 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143321 ⟸ XM_063287251
- Peptide Label:
isoform X1
- UniProtKB:
P13668 (UniProtKB/Swiss-Prot), A6IT24 (UniProtKB/TrEMBL), A0A8I5ZX99 (UniProtKB/TrEMBL), A0A8L2QYX2 (UniProtKB/TrEMBL)
RGD ID: 13694140
Promoter ID: EPDNEW_R4663
Type: initiation region
Name: Stmn1_1
Description: stathmin 1
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 152,681,101 - 152,681,161 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-02-26
Stmn1
stathmin 1
Symbol and Name status set to approved
625702
APPROVED
2002-06-10
Stmn1
stathmin 1
Symbol and Name updated
70585
PROVISIONAL
Note Type
Note
Reference
gene_disease
may be involved in the development of neuroblastomas and melanomas
61521
gene_disease
may be involved in the development of neuroblastomas and melanomas
61528
gene_process
functions as an intracellular relay integrating regulatory signals of the cellular environment
61521
gene_process
functions as an intracellular relay integrating regulatory signals of the cellular environment
61528