Advanced Search (OLGA)

Gene: Ost4 (oligosaccharyltransferase complex subunit 4, non-catalytic) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ost4

Name:

oligosaccharyltransferase complex subunit 4, non-catalytic

RGD ID:

2300150

Description:

Predicted to be involved in protein N-linked glycosylation via asparagine. Predicted to be part of oligosaccharyltransferase complex A and oligosaccharyltransferase complex B. Orthologous to human OST4 (oligosaccharyltransferase complex subunit 4, non-catalytic); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4; LOC100188932; MGC187574; oligosaccharyltransferase 4 homolog; oligosaccharyltransferase 4 homolog (S. cerevisiae); oligosaccharyltransferase complex subunit 4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	31,191,198 - 31,192,422 (+)	NCBI		GRCr8
mRatBN7.2	6	25,471,254 - 25,472,478 (+)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	6	25,771,579 - 25,772,803 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	26,087,443 - 26,088,667 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	25,566,614 - 25,567,838 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	26,836,216 - 26,837,440 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	26,836,216 - 26,837,440 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	36,651,831 - 36,653,055 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	25,453,992 - 25,455,216 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	6	24,962,051 - 24,963,275 (+)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ost4	Rat	Tatton-Brown-Rahman syndrome		ISO	RGD:3418321	8554872	ClinVar Annotator: match by term: Tatton-Brown-Rahman overgrowth syndrome	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ost4	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:1623976	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of OST4 mRNA	CTD	PMID:36331819
Ost4	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1623976	6480464	1,2-Dimethylhydrazine results in decreased expression of OST4 mRNA	CTD	PMID:22206623
Ost4	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1623976	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of OST4 mRNA	CTD	PMID:22206623
Ost4	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of OST4 mRNA	CTD	PMID:34747641
Ost4	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:3418321	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Ost4	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1623976	6480464	bisphenol S results in increased expression of OST4 mRNA	CTD	PMID:39298647
Ost4	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of OST4 mRNA	CTD	PMID:30047161
Ost4	Rat	aflatoxin B1	increases expression	ISO	RGD:3418321	6480464	Aflatoxin B1 results in increased expression of OST4 mRNA	CTD	PMID:27153756
Ost4	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of OST4 mRNA	CTD	PMID:30047161
Ost4	Rat	aristolochic acid A	decreases expression	ISO	RGD:3418321	6480464	aristolochic acid I results in decreased expression of OST4 mRNA	CTD	PMID:33212167
Ost4	Rat	arsenite(3-)	multiple interactions	ISO	RGD:3418321	6480464	arsenite promotes the reaction [G3BP1 protein binds to OST4 mRNA]	CTD	PMID:32406909
Ost4	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of OST4 mRNA	CTD	PMID:25181051\|PMID:32145629
Ost4	Rat	bisphenol A	increases expression	ISO	RGD:1623976	6480464	bisphenol A results in increased expression of OST4 mRNA	CTD	PMID:32156529
Ost4	Rat	bisphenol A	decreases expression	ISO	RGD:1623976	6480464	bisphenol A results in decreased expression of OST4 mRNA	CTD	PMID:33221593
Ost4	Rat	bisphenol A	decreases expression	ISO	RGD:3418321	6480464	bisphenol A results in decreased expression of OST4 mRNA	CTD	PMID:38568856
Ost4	Rat	bisphenol A	affects expression	ISO	RGD:3418321	6480464	bisphenol A affects the expression of OST4 mRNA	CTD	PMID:30903817
Ost4	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of OST4 gene	CTD	PMID:28505145
Ost4	Rat	bisphenol F	multiple interactions	ISO	RGD:3418321	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Ost4	Rat	chloropicrin	increases expression	ISO	RGD:3418321	6480464	chloropicrin results in increased expression of OST4 mRNA	CTD	PMID:26352163
Ost4	Rat	chlorpyrifos	increases expression	ISO	RGD:1623976	6480464	Chlorpyrifos results in increased expression of OST4 mRNA	CTD	PMID:37019170
Ost4	Rat	cisplatin	increases expression	ISO	RGD:3418321	6480464	Cisplatin results in increased expression of OST4 mRNA	CTD	PMID:27392435
Ost4	Rat	copper atom	decreases expression	EXP		6480464	Copper results in decreased expression of OST4 mRNA	CTD	PMID:30556269
Ost4	Rat	copper(0)	decreases expression	EXP		6480464	Copper results in decreased expression of OST4 mRNA	CTD	PMID:30556269
Ost4	Rat	cyproconazole	increases expression	ISO	RGD:1623976	6480464	cyproconazole results in increased expression of OST4 mRNA	CTD	PMID:22334560
Ost4	Rat	dexamethasone	multiple interactions	ISO	RGD:3418321	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Ost4	Rat	doxorubicin	affects expression	ISO	RGD:3418321	6480464	Doxorubicin affects the expression of OST4 mRNA	CTD	PMID:29803840
Ost4	Rat	epoxiconazole	increases expression	ISO	RGD:1623976	6480464	epoxiconazole results in increased expression of OST4 mRNA	CTD	PMID:22334560\|PMID:35436446
Ost4	Rat	ethanol	affects expression	ISO	RGD:1623976	6480464	Ethanol affects the expression of OST4 mRNA	CTD	PMID:30319688
Ost4	Rat	folic acid	multiple interactions	ISO	RGD:1623976	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of OST4 mRNA	CTD	PMID:22206623
Ost4	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of OST4 mRNA	CTD	PMID:33387578
Ost4	Rat	glafenine	increases expression	EXP		6480464	Glafenine results in increased expression of OST4 mRNA	CTD	PMID:24136188
Ost4	Rat	indometacin	multiple interactions	ISO	RGD:3418321	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] more ...	CTD	PMID:28628672
Ost4	Rat	inulin	multiple interactions	ISO	RGD:1623976	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of OST4 mRNA	CTD	PMID:36331819
Ost4	Rat	isobutanol	multiple interactions	ISO	RGD:3418321	6480464	[[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic more ...	CTD	PMID:29432896
Ost4	Rat	lead diacetate	increases expression	ISO	RGD:3418321	6480464	lead acetate results in increased expression of OST4 mRNA	CTD	PMID:38568856
Ost4	Rat	methidathion	increases expression	ISO	RGD:1623976	6480464	methidathion results in increased expression of OST4 mRNA	CTD	PMID:34813904
Ost4	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of OST4 mRNA	CTD	PMID:30047161
Ost4	Rat	pentachlorophenol	increases expression	ISO	RGD:1623976	6480464	Pentachlorophenol results in increased expression of OST4 mRNA	CTD	PMID:23892564
Ost4	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1623976	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of OST4 mRNA; [perfluorooctane sulfonic more ...	CTD	PMID:36331819
Ost4	Rat	phenobarbital	increases expression	EXP		6480464	Phenobarbital results in increased expression of OST4 mRNA	CTD	PMID:30047161
Ost4	Rat	propiconazole	increases expression	ISO	RGD:1623976	6480464	propiconazole results in increased expression of OST4 mRNA	CTD	PMID:21278054\|PMID:22334560
Ost4	Rat	pyrimidifen	increases expression	ISO	RGD:3418321	6480464	pyrimidifen results in increased expression of OST4 mRNA	CTD	PMID:33512557
Ost4	Rat	rotenone	increases expression	ISO	RGD:3418321	6480464	Rotenone results in increased expression of OST4 mRNA	CTD	PMID:33512557
Ost4	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of OST4 mRNA	CTD	PMID:30047161
Ost4	Rat	testosterone	decreases expression	ISO	RGD:1623976	6480464	Testosterone deficiency results in decreased expression of OST4 mRNA	CTD	PMID:33848595
Ost4	Rat	tetrachloromethane	increases expression	ISO	RGD:1623976	6480464	Carbon Tetrachloride results in increased expression of OST4 mRNA	CTD	PMID:27339419\|PMID:31919559
Ost4	Rat	titanium dioxide	decreases methylation	ISO	RGD:1623976	6480464	titanium dioxide results in decreased methylation of OST4 gene; titanium dioxide results in decreased methylation more ...	CTD	PMID:35295148
Ost4	Rat	toluene	decreases expression	EXP		6480464	Toluene results in decreased expression of OST4 mRNA	CTD	PMID:22967744
Ost4	Rat	trichloroethene	decreases expression	EXP		6480464	Trichloroethylene results in decreased expression of OST4 mRNA	CTD	PMID:33387578
Ost4	Rat	trovafloxacin	increases expression	ISO	RGD:1623976	6480464	trovafloxacin results in increased expression of OST4 mRNA	CTD	PMID:35537566
Ost4	Rat	tungsten	increases expression	ISO	RGD:1623976	6480464	Tungsten results in increased expression of OST4 mRNA	CTD	PMID:30912803

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ost4	Rat	protein glycosylation	involved_in	IEA	UniPathway:UPA00378	1600115	GO_REF:0000041	UniProt	GO_REF:0000041
Ost4	Rat	protein N-linked glycosylation via asparagine	involved_in	ISO	RGD:3418321	1624291	PMID:23606741	RGD	PMID:23606741
Ost4	Rat	protein N-linked glycosylation via asparagine	involved_in	IEA	UniProtKB:P0C6T2\|ensembl:ENSP00000457935	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ost4	Rat	protein N-linked glycosylation via asparagine	involved_in	IBA	PANTHER:PTN008298633\|UniProtKB:P0C6T2	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ost4	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-SubCell:SL-0095	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ost4	Rat	endoplasmic reticulum	located_in	IEA	UniProtKB-KW:KW-0256	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ost4	Rat	endoplasmic reticulum membrane	located_in	IEA	UniProtKB-SubCell:SL-0097	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ost4	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ost4	Rat	oligosaccharyltransferase complex	part_of	ISO	RGD:3418321	1624291	PMID:23606741, PMID:31831667	RGD	PMID:23606741\|PMID:31831667
Ost4	Rat	oligosaccharyltransferase complex	part_of	IEA	UniProtKB:P0C6T2\|ensembl:ENSP00000457935	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ost4	Rat	oligosaccharyltransferase complex	part_of	IBA	PANTHER:PTN008298633\|UniProtKB:P0C6T2	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ost4	Rat	oligosaccharyltransferase complex A	part_of	ISO	RGD:3418321	1624291	PMID:31831667, PMID:36697828, PMID:38670073	RGD	PMID:31831667\|PMID:36697828\|PMID:38670073
Ost4	Rat	oligosaccharyltransferase complex A	part_of	IEA	UniProtKB:P0C6T2\|ensembl:ENSP00000457935	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ost4	Rat	oligosaccharyltransferase complex B	part_of	ISO	RGD:3418321	1624291	PMID:31831667	RGD	PMID:31831667
Ost4	Rat	oligosaccharyltransferase complex B	part_of	IEA	UniProtKB:P0C6T2\|ensembl:ENSP00000457935	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ost4	Rat	protein binding	enables	ISO	RGD:3418321	1624291	UniProtKB:A6NI15\|UniProtKB:Q9UMX0 PMID:32296183	RGD	PMID:32296183

BioCyc Pathways

protein N-glycosylation initial phase (eukaryotic)

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8889548	PMID:12477932	PMID:15489334	PMID:23606741

Ost4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	31,191,198 - 31,192,422 (+)	NCBI		GRCr8
mRatBN7.2	6	25,471,254 - 25,472,478 (+)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	6	25,771,579 - 25,772,803 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	26,087,443 - 26,088,667 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	25,566,614 - 25,567,838 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	26,836,216 - 26,837,440 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	26,836,216 - 26,837,440 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	36,651,831 - 36,653,055 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	25,453,992 - 25,455,216 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	6	24,962,051 - 24,963,275 (+)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

OST4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	27,070,472 - 27,071,654 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	27,070,472 - 27,071,654 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	27,293,340 - 27,294,522 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	27,146,844 - 27,148,587 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	27,139,684 - 27,140,911 (-)	NCBI		Celera
Cytogenetic Map	2	p23.3	NCBI
HuRef	2	27,035,493 - 27,036,720 (-)	NCBI		HuRef
CHM1_1	2	27,223,256 - 27,224,483 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	27,112,145 - 27,113,327 (-)	NCBI		T2T-CHM13v2.0

Ost4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	31,063,860 - 31,065,155 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	31,063,229 - 31,065,132 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	30,906,516 - 30,907,807 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	30,905,885 - 30,907,788 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	31,208,891 - 31,210,161 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	31,183,099 - 31,184,306 (-)	NCBI		MGSCv36	mm8
Celera	5	28,386,153 - 28,387,423 (-)	NCBI		Celera
Cytogenetic Map	5	B1	NCBI
cM Map	5	16.9	NCBI

Ost4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955469	9,041,549 - 9,042,949 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955469	9,041,549 - 9,042,949 (-)	NCBI	ChiLan1.0	ChiLan1.0

OST4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	99,443,771 - 99,445,044 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	99,447,741 - 99,449,012 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	27,069,526 - 27,070,789 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	27,158,388 - 27,159,641 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	27,159,261 - 27,159,374 (-)	Ensembl	panpan1.1		panPan2

OST4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	21,064,737 - 21,066,524 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	20,956,712 - 20,958,024 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	21,384,511 - 21,385,825 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	17	21,071,744 - 21,072,939 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	21,082,836 - 21,084,027 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	21,129,265 - 21,130,464 (-)	NCBI		UU_Cfam_GSD_1.0

Ost4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	65,368,798 - 65,370,000 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936493	5,469,512 - 5,470,781 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936493	5,469,511 - 5,470,773 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OST4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	112,046,398 - 112,046,511 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	112,046,116 - 112,055,376 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	119,044,744 - 119,053,985 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OST4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	80,546,677 - 80,547,916 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	80,546,839 - 80,547,912 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	31,591,872 - 31,593,162 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ost4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624738	9,171,706 - 9,172,909 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624738	9,171,708 - 9,172,993 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ost4
4 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	151
Count of miRNA genes:	100
Interacting mature miRNAs:	114
Transcripts:	ENSRNOT00000011373
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1	41223769	Rat
1549905	Stresp10	Stress response QTL 10	6.83	0.0066	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	6	1	27574569	Rat
10401812	Kidm54	Kidney mass QTL 54			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	1	34235784	Rat
2292589	Emca10	Estrogen-induced mammary cancer QTL 10		0.048	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	16536140	61536140	Rat
10401800	Kidm49	Kidney mass QTL 49			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	54641141	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1	41223769	Rat
1578758	Tcas9	Tongue tumor susceptibility QTL 9	3.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	6	1	37618905	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	41223769	Rat
1598843	Cm63	Cardiac mass QTL 63	2.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	1	39036266	Rat
738024	Sach5	Saccharine consumption QTL 5	3.9	0.00039	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	6	1	43394190	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1	41223769	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1	41223769	Rat
738023	Alc17	Alcohol consumption QTL 17	3.1	0.003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	6	1	27574569	Rat
1354616	Despr12	Despair related QTL 12		0.0012	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	6	1	27574569	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	1	42487980	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	1	42487980	Rat
7411584	Foco4	Food consumption QTL 4	4.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	42838846	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	11735669	72593685	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
2300176	Bmd51	Bone mineral density QTL 51	11.7	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	6	1	27574569	Rat
1300128	Rf16	Renal function QTL 16	3.89		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	34434305	Rat
1641898	Colcr4	Colorectal carcinoma resistance QTL4	3.71	0.0007	intestine integrity trait (VT:0010554)	well differentiated malignant colorectal tumor surface area measurement (CMO:0002077)	6	20338777	62613667	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	11735669	72593685	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	72227641	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	1	42487980	Rat
1359023	Bp272	Blood pressure QTL 272	2.5		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	16536140	27261739	Rat
1354664	Slep2	Serum leptin concentration QTL 2	4.49		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	6	16536140	71636405	Rat
2300190	Bmd52	Bone mineral density QTL 52	11.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	6	1	27574569	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001134690	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001134691	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120639	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC157814	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BI277067	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BI298452	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BQ194673	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB706964	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011373 ⟹ ENSRNOP00000011373

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	6	26,836,244 - 26,837,440 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000077903 ⟹ ENSRNOP00000075594

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	6	26,836,216 - 26,837,440 (+)	Ensembl

RefSeq Acc Id:

NM_001134690 ⟹ NP_001128162

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	31,191,226 - 31,192,422 (+)	NCBI
mRatBN7.2	6	25,471,282 - 25,472,478 (+)	NCBI
Rnor_6.0	6	26,836,244 - 26,837,440 (+)	NCBI
Rnor_5.0	6	36,651,831 - 36,653,055 (+)	NCBI
RGSC_v3.4	6	25,453,992 - 25,455,216 (+)	RGD
Celera	6	24,962,079 - 24,963,275 (+)	NCBI

Sequence:

show sequence

TTGGTGTGGCAGTAGGGTCGGAGTCGGGTGGAGCTAGTCAGGTGAGACGCTCCCAGGCTTCGTTTCACAGGCGAACCCGGAGGAGGTTGGATCGTGGTGGCAAGGATCTAGCCTGGTGAGAGAGCAAG
GAGTGTCCGAACCGAGGCTCAGTCCTTCCCCTTGTCCACAGGATGATCACGGACGTGCAGCTCGCCATCTTCGCCAACATGCTGGGCGTGTCGCTTTTCTTGCTTGTGGTCCTCTATCACTACGTGGC
AGTAAATAACCCCAAGAAGCAGGAATGAAAGTGGCGTTTTCTCCGCCCCAGGCTTCCAGGACATAGTCTGAGGCAAGATGGAGGGTGTGAGGGGCCTTCACACTTCACTTCATCTCTCCTACCCATCA
CAGCATACAAAGCAACTACACCTGGATTTTTCCAAACAACTTTTATTTCCTCAAAGTCTTCCTTAACCCTATGGAACAAGAAGCTGCCACTGAATAGGGCCCAGTATAGGGGCTGCTTTCTTTTCTAC
TCCCTCCCCCCAATACAAAAATATAGATATATATATATTTAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001134691 ⟹ NP_001128163

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	31,191,198 - 31,192,422 (+)	NCBI
mRatBN7.2	6	25,471,254 - 25,472,478 (+)	NCBI
Rnor_6.0	6	26,836,216 - 26,837,440 (+)	NCBI
Rnor_5.0	6	36,651,831 - 36,653,055 (+)	NCBI
RGSC_v3.4	6	25,453,992 - 25,455,216 (+)	RGD
Celera	6	24,962,051 - 24,963,275 (+)	RGD

Sequence:

show sequence

AGTTCCGGCTTAGGTTGCCTACCTCGAGTTGGTGTGGCAGTAGGGTCGGAGTCGGGTGGAGCTA
GTCAGGATGATCACGGACGTGCAGCTCGCCATCTTCGCCAACATGCTGGGCGTGTCGCTTTTCTTGCTTGTGGTCCTCTATCACTACGTGGCAGTAAATAACCCCAAGAAGCAGGAATGAAAGTGGCG
TTTTCTCCGCCCCAGGCTTCCAGGACATAGTCTGAGGCAAGATGGAGGGTGTGAGGGGCCTTCACACTTCACTTCATCTCTCCTACCCATCACAGCATACAAAGCAACTACACCTGGATTTTTCCAAA
CAACTTTTATTTCCTCAAAGTCTTCCTTAACCCTATGGAACAAGAAGCTGCCACTGAATAGGGCCCAGTATAGGGGCTGCTTTCTTTTCTACTCCCTCCCCCCAATACAAAAATATAGATATATATAT
ATTTAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001128162	(Get FASTA)	NCBI Sequence Viewer
	NP_001128163	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI57815	(Get FASTA)	NCBI Sequence Viewer
	B0BLS0	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000104721
	ENSRNOP00000108552

RefSeq Acc Id:	NP_001128163 ⟸ NM_001134691
- UniProtKB:	B0BLS0 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE hide sequence

RefSeq Acc Id:	NP_001128162 ⟸ NM_001134690
- UniProtKB:	B0BLS0 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE hide sequence

Ensembl Acc Id:

ENSRNOP00000075594 ⟸ ENSRNOT00000077903

Ensembl Acc Id:

ENSRNOP00000011373 ⟸ ENSRNOT00000011373

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BLS0-F1-model_v2	AlphaFold	B0BLS0	1-37	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13694458

Promoter ID:

EPDNEW_R4980

Type:

initiation region

Name:

Ost4_1

Description:

oligosaccharyltransferase complex subunit 4, non-catalytic

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	26,836,241 - 26,836,301	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-38332	BioCyc
BioCyc Pathway	MANNOSYL-CHITO-DOLICHOL-BIOSYNTHESIS [protein N-glycosylation initial phase (eukaryotic)]	BioCyc
BioCyc Pathway Image	MANNOSYL-CHITO-DOLICHOL-BIOSYNTHESIS	BioCyc
Ensembl Genes	ENSRNOG00000008605	Ensembl
	ENSRNOG00000074074	ENTREZGENE
Ensembl Transcript	ENSRNOT00000149100	ENTREZGENE
	ENSRNOT00000169806	ENTREZGENE
InterPro	Oligosaccaryltransferase	UniProtKB/Swiss-Prot
	OST4	UniProtKB/Swiss-Prot
	Ost4p_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:100188932	UniProtKB/Swiss-Prot
NCBI Gene	100188932	ENTREZGENE
PANTHER	DOLICHYL-DIPHOSPHOOLIGOSACCHARIDE--PROTEIN GLYCOSYLTRANSFERASE SUBUNIT 4	UniProtKB/Swiss-Prot
	DOLICHYL-DIPHOSPHOOLIGOSACCHARIDE--PROTEIN GLYCOSYLTRANSFERASE SUBUNIT 4	UniProtKB/Swiss-Prot
Pfam	Ost4	UniProtKB/Swiss-Prot
PhenoGen	Ost4	PhenoGen
RatGTEx	ENSRNOG00000008605	RatGTEx
	ENSRNOG00000074074	RatGTEx
Superfamily-SCOP	SSF103464	UniProtKB/Swiss-Prot
UniProt	B0BLS0	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-21	Ost4	oligosaccharyltransferase complex subunit 4, non-catalytic	Ost4	oligosaccharyltransferase complex subunit 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2015-07-17	Ost4	oligosaccharyltransferase complex subunit 4	Ost4	oligosaccharyltransferase 4 homolog (S. cerevisiae)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-08-01	Ost4	oligosaccharyltransferase 4 homolog (S. cerevisiae)	LOC100188932	dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-06	LOC100188932	dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

BioCyc Pathways