Advanced Search (OLGA)

Gene: Ost4 (oligosaccharyltransferase complex subunit 4 (non-catalytic)) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Ost4

Name:

oligosaccharyltransferase complex subunit 4 (non-catalytic)

RGD ID:

1623976

MGI Page

MGI

Description:

Predicted to be involved in protein N-linked glycosylation via asparagine. Predicted to be located in endoplasmic reticulum membrane. Predicted to be part of oligosaccharyltransferase complex. Is expressed in Meckel's cartilage; cerebral cortex ventricular layer; and orbito-sphenoid. Orthologous to human OST4 (oligosaccharyltransferase complex subunit 4, non-catalytic).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

2310016E02Rik; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4; oligosaccharyltransferase 4 homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	31,063,860 - 31,065,155 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	31,063,229 - 31,065,132 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	30,906,516 - 30,907,807 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	30,905,885 - 30,907,788 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	31,208,891 - 31,210,161 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	31,183,099 - 31,184,306 (-)	NCBI		MGSCv36	mm8
Celera	5	28,386,153 - 28,387,423 (-)	NCBI		Celera
Cytogenetic Map	5	B1	NCBI
cM Map	5	16.9	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ost4	Mouse	Tatton-Brown-Rahman syndrome		ISO	OST4 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Tatton-Brown-Rahman overgrowth syndrome	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ost4	Mouse	(1->4)-beta-D-glucan	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of OST4 mRNA	CTD	PMID:36331819
Ost4	Mouse	1,2-dimethylhydrazine	multiple interactions	EXP		6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of OST4 mRNA	CTD	PMID:22206623
Ost4	Mouse	1,2-dimethylhydrazine	decreases expression	EXP		6480464	1 and 2-Dimethylhydrazine results in decreased expression of OST4 mRNA	CTD	PMID:22206623
Ost4	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Ost4 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of OST4 mRNA	CTD	PMID:34747641
Ost4	Mouse	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	OST4 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of OST4 mRNA	CTD	PMID:28628672
Ost4	Mouse	6-propyl-2-thiouracil	increases expression	ISO	Ost4 (Rattus norvegicus)	6480464	Propylthiouracil results in increased expression of OST4 mRNA	CTD	PMID:30047161
Ost4	Mouse	aflatoxin B1	increases expression	ISO	OST4 (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of OST4 mRNA	CTD	PMID:27153756
Ost4	Mouse	amitrole	increases expression	ISO	Ost4 (Rattus norvegicus)	6480464	Amitrole results in increased expression of OST4 mRNA	CTD	PMID:30047161
Ost4	Mouse	aristolochic acid A	decreases expression	ISO	OST4 (Homo sapiens)	6480464	aristolochic acid I results in decreased expression of OST4 mRNA	CTD	PMID:33212167
Ost4	Mouse	arsenite(3-)	multiple interactions	ISO	OST4 (Homo sapiens)	6480464	arsenite promotes the reaction [G3BP1 protein binds to OST4 mRNA]	CTD	PMID:32406909
Ost4	Mouse	bisphenol A	increases expression	ISO	Ost4 (Rattus norvegicus)	6480464	bisphenol A results in increased expression of OST4 mRNA	CTD	PMID:25181051 and PMID:32145629
Ost4	Mouse	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of OST4 mRNA	CTD	PMID:32156529
Ost4	Mouse	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of OST4 mRNA	CTD	PMID:33221593
Ost4	Mouse	bisphenol A	decreases expression	ISO	OST4 (Homo sapiens)	6480464	bisphenol A results in decreased expression of OST4 mRNA	CTD	PMID:38568856
Ost4	Mouse	bisphenol A	affects expression	ISO	OST4 (Homo sapiens)	6480464	bisphenol A affects the expression of OST4 mRNA	CTD	PMID:30903817
Ost4	Mouse	bisphenol A	increases methylation	ISO	Ost4 (Rattus norvegicus)	6480464	bisphenol A results in increased methylation of OST4 gene	CTD	PMID:28505145
Ost4	Mouse	bisphenol F	multiple interactions	ISO	OST4 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of OST4 mRNA	CTD	PMID:28628672
Ost4	Mouse	chloropicrin	increases expression	ISO	OST4 (Homo sapiens)	6480464	chloropicrin results in increased expression of OST4 mRNA	CTD	PMID:26352163
Ost4	Mouse	chlorpyrifos	increases expression	EXP		6480464	Chlorpyrifos results in increased expression of OST4 mRNA	CTD	PMID:37019170
Ost4	Mouse	cisplatin	increases expression	ISO	OST4 (Homo sapiens)	6480464	Cisplatin results in increased expression of OST4 mRNA	CTD	PMID:27392435
Ost4	Mouse	copper atom	decreases expression	ISO	Ost4 (Rattus norvegicus)	6480464	Copper results in decreased expression of OST4 mRNA	CTD	PMID:30556269
Ost4	Mouse	copper(0)	decreases expression	ISO	Ost4 (Rattus norvegicus)	6480464	Copper results in decreased expression of OST4 mRNA	CTD	PMID:30556269
Ost4	Mouse	cyproconazole	increases expression	EXP		6480464	cyproconazole results in increased expression of OST4 mRNA	CTD	PMID:22334560
Ost4	Mouse	dexamethasone	multiple interactions	ISO	OST4 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of OST4 mRNA	CTD	PMID:28628672
Ost4	Mouse	doxorubicin	affects expression	ISO	OST4 (Homo sapiens)	6480464	Doxorubicin affects the expression of OST4 mRNA	CTD	PMID:29803840
Ost4	Mouse	epoxiconazole	increases expression	EXP		6480464	epoxiconazole results in increased expression of OST4 mRNA	CTD	PMID:22334560 and PMID:35436446
Ost4	Mouse	ethanol	affects expression	EXP		6480464	Ethanol affects the expression of OST4 mRNA	CTD	PMID:30319688
Ost4	Mouse	folic acid	multiple interactions	EXP		6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of OST4 mRNA	CTD	PMID:22206623
Ost4	Mouse	gentamycin	decreases expression	ISO	Ost4 (Rattus norvegicus)	6480464	Gentamicins results in decreased expression of OST4 mRNA	CTD	PMID:33387578
Ost4	Mouse	glafenine	increases expression	ISO	Ost4 (Rattus norvegicus)	6480464	Glafenine results in increased expression of OST4 mRNA	CTD	PMID:24136188
Ost4	Mouse	indometacin	multiple interactions	ISO	OST4 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of OST4 mRNA	CTD	PMID:28628672
Ost4	Mouse	inulin	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of OST4 mRNA	CTD	PMID:36331819
Ost4	Mouse	isobutanol	multiple interactions	ISO	OST4 (Homo sapiens)	6480464	[[Gasoline co-treated with isobutyl alcohol] results in increased abundance of [Particulate Matter co-treated with Polycyclic Aromatic Hydrocarbons]] which results in decreased expression of OST4 mRNA	CTD	PMID:29432896
Ost4	Mouse	lead diacetate	increases expression	ISO	OST4 (Homo sapiens)	6480464	lead acetate results in increased expression of OST4 mRNA	CTD	PMID:38568856
Ost4	Mouse	methidathion	increases expression	EXP		6480464	methidathion results in increased expression of OST4 mRNA	CTD	PMID:34813904
Ost4	Mouse	methimazole	increases expression	ISO	Ost4 (Rattus norvegicus)	6480464	Methimazole results in increased expression of OST4 mRNA	CTD	PMID:30047161
Ost4	Mouse	pentachlorophenol	increases expression	EXP		6480464	Pentachlorophenol results in increased expression of OST4 mRNA	CTD	PMID:23892564
Ost4	Mouse	perfluorooctane-1-sulfonic acid	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of OST4 mRNA more ...	CTD	PMID:36331819
Ost4	Mouse	phenobarbital	increases expression	ISO	Ost4 (Rattus norvegicus)	6480464	Phenobarbital results in increased expression of OST4 mRNA	CTD	PMID:30047161
Ost4	Mouse	propiconazole	increases expression	EXP		6480464	propiconazole results in increased expression of OST4 mRNA	CTD	PMID:21278054 and PMID:22334560
Ost4	Mouse	pyrimidifen	increases expression	ISO	OST4 (Homo sapiens)	6480464	pyrimidifen results in increased expression of OST4 mRNA	CTD	PMID:33512557
Ost4	Mouse	rotenone	increases expression	ISO	OST4 (Homo sapiens)	6480464	Rotenone results in increased expression of OST4 mRNA	CTD	PMID:33512557
Ost4	Mouse	sulfadimethoxine	increases expression	ISO	Ost4 (Rattus norvegicus)	6480464	Sulfadimethoxine results in increased expression of OST4 mRNA	CTD	PMID:30047161
Ost4	Mouse	testosterone	decreases expression	EXP		6480464	Testosterone deficiency results in decreased expression of OST4 mRNA	CTD	PMID:33848595
Ost4	Mouse	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of OST4 mRNA	CTD	PMID:27339419 and PMID:31919559
Ost4	Mouse	titanium dioxide	decreases methylation	EXP		6480464	titanium dioxide results in decreased methylation of OST4 gene and titanium dioxide results in decreased methylation of OST4 promoter	CTD	PMID:35295148
Ost4	Mouse	toluene	decreases expression	ISO	Ost4 (Rattus norvegicus)	6480464	Toluene results in decreased expression of OST4 mRNA	CTD	PMID:22967744
Ost4	Mouse	trichloroethene	decreases expression	ISO	Ost4 (Rattus norvegicus)	6480464	Trichloroethylene results in decreased expression of OST4 mRNA	CTD	PMID:33387578
Ost4	Mouse	trovafloxacin	increases expression	EXP		6480464	trovafloxacin results in increased expression of OST4 mRNA	CTD	PMID:35537566
Ost4	Mouse	tungsten	increases expression	EXP		6480464	Tungsten results in increased expression of OST4 mRNA	CTD	PMID:30912803

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ost4	Mouse	protein N-linked glycosylation	involved_in	NAS		2290270	PMID:31831667	ComplexPortal	PMID:31831667
Ost4	Mouse	protein N-linked glycosylation	involved_in	ISO	UniProtKB:P0C6T2	2290270		GO_Central	GO_REF:0000119
Ost4	Mouse	protein N-linked glycosylation via asparagine	involved_in	ISO	UniProtKB:P0C6T2	2290270		GO_Central	GO_REF:0000119
Ost4	Mouse	protein N-linked glycosylation via asparagine	involved_in	IBA	PANTHER:PTN008298633 and UniProtKB:P0C6T2	2290270		GO_Central	GO_REF:0000033
Ost4	Mouse	protein N-linked glycosylation via asparagine	involved_in	IEA	UniProtKB:P0C6T2 and ensembl:ENSP00000457935	2290270		Ensembl	GO_REF:0000107

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ost4	Mouse	endoplasmic reticulum membrane	located_in	NAS		2290270	PMID:31831667	ComplexPortal	PMID:31831667
Ost4	Mouse	oligosaccharyltransferase complex	part_of	IBA	PANTHER:PTN008298633 and UniProtKB:P0C6T2	2290270		GO_Central	GO_REF:0000033
Ost4	Mouse	oligosaccharyltransferase complex	part_of	NAS		2290270	PMID:31831667	ComplexPortal	PMID:31831667
Ost4	Mouse	oligosaccharyltransferase complex	part_of	ISO	UniProtKB:P0C6T2	2290270		GO_Central	GO_REF:0000119
Ost4	Mouse	oligosaccharyltransferase complex A	part_of	ISO	OST4 (Homo sapiens)	9068941	PMID:31831667 more ...	UniProt	PMID:31831667 more ...
Ost4	Mouse	oligosaccharyltransferase complex B	part_of	ISO	OST4 (Homo sapiens)	9068941	PMID:31831667	UniProt	PMID:31831667

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ost4	Mouse	molecular_function	enables	ND		2290270		MGI	GO_REF:0000015
Ost4	Mouse	protein binding	enables	ISO	UniProtKB:A6NI15 and UniProtKB:Q9UMX0	9068941	PMID:32296183	IntAct	PMID:32296183

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8889548	PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11752298	PMID:12466851	PMID:12477932	PMID:12904583	PMID:14610273	PMID:16141072	PMID:16141073
PMID:18799693	PMID:21267068	PMID:21873635	PMID:27729526	PMID:31831667	PMID:34321999

Ost4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	31,063,860 - 31,065,155 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	31,063,229 - 31,065,132 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	30,906,516 - 30,907,807 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	30,905,885 - 30,907,788 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	31,208,891 - 31,210,161 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	31,183,099 - 31,184,306 (-)	NCBI		MGSCv36	mm8
Celera	5	28,386,153 - 28,387,423 (-)	NCBI		Celera
Cytogenetic Map	5	B1	NCBI
cM Map	5	16.9	NCBI

OST4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	27,070,472 - 27,071,654 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	27,070,472 - 27,071,654 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	27,293,340 - 27,294,522 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	27,146,844 - 27,148,587 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	27,139,684 - 27,140,911 (-)	NCBI		Celera
Cytogenetic Map	2	p23.3	NCBI
HuRef	2	27,035,493 - 27,036,720 (-)	NCBI		HuRef
CHM1_1	2	27,223,256 - 27,224,483 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	27,112,145 - 27,113,327 (-)	NCBI		T2T-CHM13v2.0

Ost4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	31,191,198 - 31,192,422 (+)	NCBI		GRCr8
mRatBN7.2	6	25,471,254 - 25,472,478 (+)	NCBI	mRatBN7.2	mRatBN7.2
UTH_Rnor_SHR_Utx	6	25,771,579 - 25,772,803 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	26,087,443 - 26,088,667 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	25,566,614 - 25,567,838 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	26,836,216 - 26,837,440 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	26,836,216 - 26,837,440 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	36,651,831 - 36,653,055 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	25,453,992 - 25,455,216 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	6	24,962,051 - 24,963,275 (+)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

Ost4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955469	9,041,549 - 9,042,949 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955469	9,041,549 - 9,042,949 (-)	NCBI	ChiLan1.0	ChiLan1.0

OST4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	99,443,771 - 99,445,044 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	99,447,741 - 99,449,012 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	27,069,526 - 27,070,789 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	27,158,388 - 27,159,641 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	27,159,261 - 27,159,374 (-)	Ensembl	panpan1.1		panPan2

OST4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	21,064,737 - 21,066,524 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	20,956,712 - 20,958,024 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	21,384,511 - 21,385,825 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	17	21,071,744 - 21,072,939 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	21,082,836 - 21,084,027 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	21,129,265 - 21,130,464 (-)	NCBI		UU_Cfam_GSD_1.0

Ost4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	65,368,798 - 65,370,000 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936493	5,469,512 - 5,470,781 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936493	5,469,511 - 5,470,773 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

OST4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	112,046,398 - 112,046,511 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	112,046,116 - 112,055,376 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	119,044,744 - 119,053,985 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

OST4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	80,546,677 - 80,547,916 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	80,546,839 - 80,547,912 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	31,591,872 - 31,593,162 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ost4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624738	9,171,706 - 9,172,909 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624738	9,171,708 - 9,172,993 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ost4
36 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	481
Count of miRNA genes:	280
Interacting mature miRNAs:	321
Transcripts:	ENSMUST00000132034, ENSMUST00000132253
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1301555	Alcp10_m	alcohol preference locus 10 (mouse)			Not determined		5	31024275	65024480	Mouse
1301776	Skts3_m	skin tumor susceptibility 3 (mouse)			Not determined		5	21667295	55667403	Mouse
1301685	Estq2_m	estradiol regulated response QTL 2 (mouse)			Not determined		5	15634084	49634190	Mouse
11537367	Hmtb11_m	hemostasis and thrombosis 11 (mouse)					5	22100823	64806579	Mouse
4141207	Imrfq1_m	immune response to Factor IX QTL 1 (mouse)			Not determined		5	8124117	42124239	Mouse
1301403	Alcp9_m	alcohol preference locus 9 (mouse)			Not determined		5	31024275	65024480	Mouse
11537368	Hmtb10_m	hemostasis and thrombosis 10 (mouse)					5	22100823	54500318	Mouse
7394748	Mom5_m	modifier of Min 5 (mouse)			Not determined		5	8847672	33475637	Mouse
1301693	Sle6_m	systemic lupus erythematosus susceptibility 6 (mouse)			Not determined		5	8890693	87841837	Mouse
1300701	Cd8ts1_m	CD8 T cell subset 1 (mouse)			Not determined		5	27215348	61215451	Mouse
15039371	Nmrs21_m	NAFLD-associated magnetic resonance shift 21 (mouse)					5	3504823	37504823	Mouse
1357478	Kdnw1_m	kidney weight 1 (mouse)			Not determined		5	8915949	40529869	Mouse
11341716	Rvfs3_m	Rift Valley fever susceptibility 3 (mouse)					5	26441234	138455402	Mouse
14696730	Kidlq1_m	kidney weight, left QTL 1 (mouse)					5	13563152	47563152	Mouse
1300719	Iba5_m	induction of brown adipocytes 5 (mouse)			Not determined		5	20686993	54687134	Mouse
10401122	Pgia41_m	proteoglycan induced arthritis 41 (mouse)			Not determined		5	823144	34823280	Mouse
1301806	Actd2_m	activity-distance traveled 2 (mouse)			Not determined		5	5384520	39384652	Mouse

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_001134692	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_024460	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006504071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA563474	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC109606	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK002224	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK002453	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK003569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK005413	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK009384	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK010297	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK019285	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC002177	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC082316	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BU756604	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY089912	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CA466367	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466524	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DV041491	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000132034 ⟹ ENSMUSP00000126221

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	5	31,063,862 - 31,065,069 (-)	Ensembl
GRCm38.p6 Ensembl	5	30,906,518 - 30,907,725 (-)	Ensembl

Ensembl Acc Id:

ENSMUST00000132253 ⟹ ENSMUSP00000128352

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	5	31,063,229 - 31,065,132 (-)	Ensembl
GRCm38.p6 Ensembl	5	30,905,885 - 30,907,788 (-)	Ensembl

RefSeq Acc Id:

NM_001134692 ⟹ NP_001128164

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	5	31,063,860 - 31,065,132 (-)	NCBI
GRCm38	5	30,906,516 - 30,907,788 (-)	NCBI
MGSCv37	5	31,208,891 - 31,210,161 (-)	RGD
Celera	5	28,386,151 - 28,387,423 (-)	NCBI
cM Map	5		ENTREZGENE

Sequence:

show sequence

GACGGCAGGGTAGAGAAGCCGGAAGTGCCGCGTTGTTCCCCAGCTAGCACTACGAAGTTCCGGCTCAGGTCGCCTACCTCGAGTTTGTGCGTCTGTAGTGTCGGAGTCGGCTGAAGCTGGTCAGGTGA
GGGGCTCGCAGGCGCCGTTTCATAGGCGAGCCCGGCGGAGGCTGGATCGTGGTGGCGAGGATCTGGCTTAGTGAGAGAGCAAGGAGTGCGTGAATCGAGGCTCAGTCCTTCCCCTTGTCCACAGGATG
ATCACGGACGTGCAGCTCGCCATCTTCGCCAACATGCTGGGCGTGTCGCTTTTCTTGCTTGTGGTCCTCTATCACTACGTGGCAGTAAACAACCCCAAGAAGCAGGAATGAAAGTGGCGCTTTCTCCG
CCCCAGGGTTCCAGGACATAGTCTGAGGCAAGATGGAGGGTGTGAGGGCCTTCACACTTCACTTCATCTCTCCTACCCATCACAGCATACAAAGCAACTACACCTGGATTTTTCCAAACAACTTTTAT
TTCCTCAAAGTCTTCCTTAACCCTATGGAGCAAGAAGCTGCCACTGAATAGGGCCCAGTATAGGGGCTGCTTTCTTTTCTACTCCCTCCCCCCAATACAAAAATATAGATATATATATATAGATATAT
AAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_024460 ⟹ NP_077780

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	5	31,063,860 - 31,065,132 (-)	NCBI
GRCm38	5	30,906,516 - 30,907,788 (-)	NCBI
MGSCv37	5	31,208,891 - 31,210,161 (-)	RGD
Celera	5	28,386,151 - 28,387,423 (-)	NCBI
cM Map	5		ENTREZGENE

Sequence:

show sequence

GACGGCAGGGTAGAGAAGCCGGAAGTGCCGCGTTGTTCCCCAGCTAGCACTACGAAGTTCCGGC
TCAGGTCGCCTACCTCGAGTTTGTGCGTCTGTAGTGTCGGAGTCGGCTGAAGCTGGTCAGGATGATCACGGACGTGCAGCTCGCCATCTTCGCCAACATGCTGGGCGTGTCGCTTTTCTTGCTTGTGG
TCCTCTATCACTACGTGGCAGTAAACAACCCCAAGAAGCAGGAATGAAAGTGGCGCTTTCTCCGCCCCAGGGTTCCAGGACATAGTCTGAGGCAAGATGGAGGGTGTGAGGGCCTTCACACTTCACTT
CATCTCTCCTACCCATCACAGCATACAAAGCAACTACACCTGGATTTTTCCAAACAACTTTTATTTCCTCAAAGTCTTCCTTAACCCTATGGAGCAAGAAGCTGCCACTGAATAGGGCCCAGTATAGG
GGCTGCTTTCTTTTCTACTCCCTCCCCCCAATACAAAAATATAGATATATATATATAGATATATAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_006504071 ⟹ XP_006504134

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	5	31,064,489 - 31,065,155 (-)	NCBI
GRCm38	5	30,907,145 - 30,907,807 (-)	NCBI

Sequence:

show sequence

GCGCGCGCCGCCGGAGCAGACGAGACGGCAGGGTAGAGAAGCCGGAAGTGCCGCGTTGTTCCCCAGCTAGCACTACGAAGTTCCGGCTCAGGTCGCCTACCTCGAGTTTGTGCGTCTGTAGTGTCGGA
GTCGGCTGAAGCTGGTCAGGATGATCACGGACGTGCAGCTCGCCATCTTCGCCAACATGCTGGGCGTGTCGCTTTTCTTGCTTGTGGTCCTCTATCACTACGTGGCAGTAAACAACCCCAAGAAGCAG
GAATGAAAGTGGCGCTTTCTCCGCCCCAGGTTTCCAGGAGATA

hide sequence


Protein RefSeqs	NP_001128164	(Get FASTA)	NCBI Sequence Viewer
	NP_077780	(Get FASTA)	NCBI Sequence Viewer
	XP_006504134	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH02177	(Get FASTA)	NCBI Sequence Viewer
	AAH82316	(Get FASTA)	NCBI Sequence Viewer
	BAC24992	(Get FASTA)	NCBI Sequence Viewer
	BAC25041	(Get FASTA)	NCBI Sequence Viewer
	BAC25115	(Get FASTA)	NCBI Sequence Viewer
	BAC25288	(Get FASTA)	NCBI Sequence Viewer
	BAC25588	(Get FASTA)	NCBI Sequence Viewer
	BAE43146	(Get FASTA)	NCBI Sequence Viewer
	EDL37303	(Get FASTA)	NCBI Sequence Viewer
	EDL37304	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000126221
	ENSMUSP00000126221.2
	ENSMUSP00000128352
	ENSMUSP00000128352.2
GenBank Protein	Q99LX8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_077780 ⟸ NM_024460
- UniProtKB:	Q99LX8 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE hide sequence

RefSeq Acc Id:	NP_001128164 ⟸ NM_001134692
- UniProtKB:	Q99LX8 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE hide sequence

RefSeq Acc Id:	XP_006504134 ⟸ XM_006504071
- Peptide Label:	isoform X1
- UniProtKB:	Q99LX8 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MITDVQLAIFANMLGVSLFLLVVLYHYVAVNNPKKQE hide sequence

Ensembl Acc Id:

ENSMUSP00000126221 ⟸ ENSMUST00000132034

Ensembl Acc Id:

ENSMUSP00000128352 ⟸ ENSMUST00000132253

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q99LX8-F1-model_v2	AlphaFold	Q99LX8	1-37	view protein structure

RGD ID:

6886310

Promoter ID:

EPDNEW_M6606

Type:

initiation region

Name:

Ost4_1

Description:

Mus musculus oligosaccharyltransferase complex subunit 4 (non-catalytic), transcript variant 2, mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	5	30,907,740 - 30,907,800	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000038803	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000132034	ENTREZGENE
	ENSMUST00000132034.5	UniProtKB/Swiss-Prot
	ENSMUST00000132253	ENTREZGENE
	ENSMUST00000132253.5	UniProtKB/Swiss-Prot
InterPro	Oligosaccaryltransferase	UniProtKB/Swiss-Prot
	OST4	UniProtKB/Swiss-Prot
	Ost4p_sf	UniProtKB/Swiss-Prot
KEGG Report	mmu:67695	UniProtKB/Swiss-Prot
MGD	MGI:1914945	ENTREZGENE
NCBI Gene	67695	ENTREZGENE
PANTHER	DOLICHYL-DIPHOSPHOOLIGOSACCHARIDE--PROTEIN GLYCOSYLTRANSFERASE SUBUNIT 4	UniProtKB/Swiss-Prot
	DOLICHYL-DIPHOSPHOOLIGOSACCHARIDE--PROTEIN GLYCOSYLTRANSFERASE SUBUNIT 4	UniProtKB/Swiss-Prot
Pfam	Ost4	UniProtKB/Swiss-Prot
PhenoGen	Ost4	PhenoGen
Superfamily-SCOP	SSF103464	UniProtKB/Swiss-Prot
UniProt	OST4_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-29	Ost4	oligosaccharyltransferase complex subunit 4 (non-catalytic)		oligosaccharyltransferase 4 homolog (S. cerevisiae)	Symbol and/or name change	5135510	APPROVED
2011-07-27	Ost4	oligosaccharyltransferase 4 homolog (S. cerevisiae)	2310016E02Rik	RIKEN cDNA 2310016E02 gene	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar