Adh5 (alcohol dehydrogenase 5 (class III), chi polypeptide)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Adh5 (alcohol dehydrogenase 5 (class III), chi polypeptide) Rattus norvegicus

Analyze

Symbol:

Adh5

Name:

alcohol dehydrogenase 5 (class III), chi polypeptide

RGD ID:

2292706

Description:

Enables alcohol dehydrogenase (NAD+) activity. Involved in ethanol catabolic process. Predicted to be located in mitochondrion. Predicted to be active in cytosol. Used to study alcohol use disorder. Biomarker of cholestasis. Human ortholog(s) of this gene implicated in AMED syndrome and asthma. Orthologous to human ADH5 (alcohol dehydrogenase 5 (class III), chi polypeptide); PARTICIPATES IN fatty acid metabolic pathway; gluconeogenesis pathway; glycolysis pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; acetamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ADH-B2; alcohol dehydrogenase 2; alcohol dehydrogenase 5; alcohol dehydrogenase B2; alcohol dehydrogenase class-3; alcohol dehydrogenase class-III; class III alcohol dehydrogenase, chi subunit; FALDH; FDH; glutathione-dependent formaldehyde dehydrogenase; GSH-FDH; S-(hydroxymethyl)glutathione dehydrogenase

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ADH5 (alcohol dehydrogenase 5 (class III), chi polypeptide)	HGNC	Ensembl, HomoloGene, Inparanoid, OrthoDB, Panther
Mus musculus (house mouse):	Adh5 (alcohol dehydrogenase 5 (class III), chi polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ADH5 (alcohol dehydrogenase 5 (class III), chi polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ADH5 (alcohol dehydrogenase 5 (class III), chi polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ADH5 (alcohol dehydrogenase 5 (class III), chi polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ADH5 (alcohol dehydrogenase 5 (class III), chi polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Adh5 (alcohol dehydrogenase 5 (class III), chi polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ADH5 (alcohol dehydrogenase 5 (class III), chi polypeptide)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Adh5 (alcohol dehydrogenase 5 (class III), chi polypeptide)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	adh5 (alcohol dehydrogenase 5)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Fdh	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	H24K24.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SFA1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	adh5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	226,975,184 - 226,987,591 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	226,947,466 - 226,987,591 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	234,723,921 - 234,736,337 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	232,623,648 - 232,636,062 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	227,488,332 - 227,500,747 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	243,728,500 - 243,740,907 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	243,700,784 - 243,740,899 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	262,262,936 - 262,275,343 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	235,979,108 - 235,991,515 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	219,131,229 - 219,143,636 (+)	NCBI		Celera
Cytogenetic Map	2	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alcohol use disorder (IMP)

AMED syndrome (ISO)

asthma (ISO)

autism spectrum disorder (ISO)

cholestasis (IEP)

genetic disease (ISO)

pulmonary hypertension (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

12-hydroxylauric acid (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

8'-apo-beta,psi-caroten-8'-al (ISO)

8-hydroxyoctanoic acid (ISO)

acetamide (EXP)

alcohol (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

beta-carotene (ISO)

bifenthrin (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

choline (ISO)

cimetidine (ISO)

clofibrate (ISO)

clozapine (ISO)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

Cuprizon (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

decanoic acid (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dodecanedioic acid (ISO)

dodecanoic acid (ISO)

ethanol (ISO)

fenthion (ISO)

folic acid (ISO)

folpet (ISO)

formaldehyde (ISO)

glutathione (ISO)

glycidyl methacrylate (ISO)

gold atom (ISO)

gold(0) (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

L-methionine (ISO)

methidathion (ISO)

methylparaben (ISO)

nonanoic acid (ISO)

octan-1-ol (ISO)

octanoic acid (ISO)

p-toluidine (EXP)

paracetamol (ISO)

pentachlorophenol (ISO)

phlorizin (ISO)

picoxystrobin (ISO)

potassium chromate (ISO)

progesterone (ISO)

quercetin (ISO)

rotenone (ISO)

S-(hydroxymethyl)glutathione (ISO)

S-methylglutathione (ISO)

S-nitrosoglutathione (ISO)

sebacic acid (ISO)

sodium fluoride (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

undecanoic acid (ISO)

urethane (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

ethanol catabolic process (IDA)

ethanol oxidation (IEA)

fatty acid omega-oxidation (ISO,ISS)

formaldehyde catabolic process (IBA,ISO)

positive regulation of blood pressure (ISO)

respiratory system process (ISO)

response to lipopolysaccharide (ISO)

response to nitrosative stress (ISO)

response to redox state (ISO)

retinoid metabolic process (ISO)

Cellular Component

cytosol (IBA)

mitochondrion (ISO)

Molecular Function

alcohol dehydrogenase (NAD+) activity (IDA,IEA,ISO)

alcohol dehydrogenase activity, zinc-dependent (IBA)

fatty acid binding (ISO)

formaldehyde dehydrogenase activity (ISO)

identical protein binding (ISO)

oxidoreductase activity (IEA)

S-(hydroxymethyl)glutathione dehydrogenase activity (IBA,ISO)

S-(hydroxymethyl)glutathione dehydrogenase NAD activity (IEA)

S-(hydroxymethyl)glutathione dehydrogenase NADP activity (IEA)

zinc ion binding (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

fatty acid metabolic pathway (IEA)

gluconeogenesis pathway (IEA)

glycolysis pathway (IEA)

glycolysis/gluconeogenesis pathway (IEA)

phase I biotransformation pathway via cytochrome P450 (IEA)

retinol metabolic pathway (IEA)

tyrosine metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Severity of alcohol withdrawal symptoms depends on developmental stage of Long-Evans rats.	Chung CS, etal., Pharmacol Biochem Behav. 2008 Apr;89(2):137-44. Epub 2007 Dec 8.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Immunocytochemical and biochemical demonstration of formaldhyde dehydrogenase (class III alcohol dehydrogenase) in the nucleus.	Iborra FJ, etal., J Histochem Cytochem 1992 Dec;40(12):1865-78.
4.	Inhibition of nitric oxide synthesis during induced cholestasis ameliorates hepatocellular injury by facilitating S-nitrosothiol homeostasis.	Lopez-Sanchez LM, etal., Lab Invest. 2010 Jan;90(1):116-27. Epub 2009 Oct 5.
5.	Genetic variants of GSNOR and ADRB2 influence response to albuterol in African-American children with severe asthma.	Moore PE, etal., Pediatr Pulmonol. 2009 Jul;44(7):649-54.
6.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
7.	Influence of the immunization against heterologous alcohol dehydrogenase on liver alcohol dehydrogenase isozymes and alcohol abuse of rats.	Pshezhetsky AV, etal., Eur J Biochem. 1993 Mar 15;212(3):757-61.
8.	S-nitrosoglutathione reductase: an important regulator in human asthma.	Que LG, etal., Am J Respir Crit Care Med. 2009 Aug 1;180(3):226-31. Epub 2009 Apr 24.
9.	Protection from experimental asthma by an endogenous bronchodilator.	Que LG, etal., Science. 2005 Jun 10;308(5728):1618-21. Epub 2005 May 26.
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Genetic variation in S-nitrosoglutathione reductase (GSNOR) and childhood asthma.	Wu H, etal., J Allergy Clin Immunol. 2007 Aug;120(2):322-8. Epub 2007 Jun 1.
13.	Increased nitrosoglutathione reductase activity in hypoxic pulmonary hypertension in mice.	Wu X, etal., J Pharmacol Sci. 2010 May;113(1):32-40. Epub 2010 Apr 22.

Additional References at PubMed

PMID:1888714	PMID:3278908	PMID:3653405	PMID:3996732	PMID:6375718	PMID:8460164	PMID:10358022	PMID:12027900	PMID:12477932	PMID:14980227	PMID:15489334	PMID:16081420
PMID:19056867	PMID:23159888	PMID:23376485	PMID:23533145	PMID:24654711	PMID:26746429

Genomics

Comparative Map Data

Adh5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	226,975,184 - 226,987,591 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	226,947,466 - 226,987,591 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	234,723,921 - 234,736,337 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	232,623,648 - 232,636,062 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	227,488,332 - 227,500,747 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	243,728,500 - 243,740,907 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	243,700,784 - 243,740,899 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	262,262,936 - 262,275,343 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	235,979,108 - 235,991,515 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	219,131,229 - 219,143,636 (+)	NCBI		Celera
Cytogenetic Map	2	q44	NCBI

ADH5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	99,070,978 - 99,088,788 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	99,070,978 - 99,088,801 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	99,992,129 - 100,009,939 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	100,211,152 - 100,228,954 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	100,349,540 - 100,367,191	NCBI
Celera	4	97,289,594 - 97,307,408 (-)	NCBI		Celera
Cytogenetic Map	4	q23	NCBI
HuRef	4	95,730,971 - 95,748,768 (-)	NCBI		HuRef
CHM1_1	4	99,969,101 - 99,986,899 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	102,385,880 - 102,403,688 (-)	NCBI		T2T-CHM13v2.0

Adh5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	138,142,961 - 138,161,260 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	138,148,854 - 138,161,260 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	138,437,200 - 138,455,499 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	138,443,093 - 138,455,499 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	138,106,128 - 138,118,463 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	138,380,551 - 138,392,886 (+)	NCBI		MGSCv36	mm8
Celera	3	144,865,856 - 144,878,188 (+)	NCBI		Celera
Cytogenetic Map	3	G3	NCBI
cM Map	3	64.26	NCBI

ADH5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	4	97,413,363 - 97,430,017 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	91,470,304 - 91,487,854 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	102,134,375 - 102,151,902 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	102,134,375 - 102,151,902 (-)	Ensembl	panpan1.1		panPan2

ADH5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	21,249,459 - 21,261,130 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	21,249,739 - 21,265,048 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	32	20,665,071 - 20,680,669 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	32	21,435,360 - 21,451,154 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	32	21,432,077 - 21,451,233 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	32	21,401,221 - 21,416,820 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	21,228,031 - 21,243,728 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	18,651,920 - 18,667,674 (+)	NCBI		UU_Cfam_GSD_1.0

ADH5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	121,266,764 - 121,282,310 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	121,266,794 - 121,282,313 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	130,451,304 - 130,466,904 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ADH5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	47,190,031 - 47,211,670 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	47,190,294 - 47,211,651 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	25,620,607 - 25,643,036 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Adh5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004625024	32,348 - 63,242 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004625024	32,237 - 60,983 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Adh5
45 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	29
Count of miRNA genes:	26
Interacting mature miRNAs:	28
Transcripts:	ENSRNOT00000017252
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
8694435	Bw166	Body weight QTL 166	14.08	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	2	182171407	227171407	Rat
9589044	Scfw1	Subcutaneous fat weight QTL 1	5.8	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	2	182171407	227171407	Rat
8694383	Bw158	Body weight QTL 158	7.69	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	2	182171407	227171407	Rat
8694194	Abfw1	Abdominal fat weight QTL 1	11.7	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	2	182171407	227171407	Rat
738013	Alc15	Alcohol consumption QTL 15	4.1	0.00022	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	2	184165752	229165752	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	199341726	234244620	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	200990457	245990457	Rat
2298479	Eau5	Experimental allergic uveoretinitis QTL 5		0.0021	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	2	202446871	237938339	Rat
7207490	Bss111	Bone structure and strength QTL 111	6.4		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	2	211744537	249053267	Rat
7207482	Bss107	Bone structure and strength QTL 107	7		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	2	211744537	249053267	Rat
7207484	Bss108	Bone structure and strength QTL 108	5.3		femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	2	211744537	249053267	Rat
1298075	Scl17	Serum cholesterol level QTL 17	3.4		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	211744537	249053267	Rat
1549836	Bss2	Bone structure and strength QTL 2	7.5		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	2	211744537	249053267	Rat
2317885	Alcrsp28	Alcohol response QTL 28	2.1	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	212828222	249053267	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	214226044	247136170	Rat
2313073	Bmd75	Bone mineral density QTL 75	4.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	2	215377404	237938339	Rat
1331767	Hrtrt12	Heart rate QTL 12	3.373		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	218414747	240841241	Rat
2293833	Kiddil8	Kidney dilation QTL 8	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	219753301	247136170	Rat
2293844	Kiddil7	Kidney dilation QTL 7	3.5		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	219753301	247136170	Rat
9587428	Epfw6	Epididymal fat weight QTL 6	7.47	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	2	223389739	249053267	Rat
7411555	Bw132	Body weight QTL 132		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	223389739	249053267	Rat

Markers in Region

BE108111

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	226,987,811 - 226,987,994 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	243,741,128 - 243,741,310	NCBI	Rnor6.0
Rnor_5.0	2	262,275,564 - 262,275,746	UniSTS	Rnor5.0
RGSC_v3.4	2	235,991,736 - 235,991,918	UniSTS	RGSC3.4
Celera	2	219,143,857 - 219,144,039	UniSTS
RH 3.4 Map	2	1595.4	UniSTS
Cytogenetic Map	2	q44	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	35	55	41	16	41	1	3	74	35	34	11	1
Low		8	2		3		7	8			7		7
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001126120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC140765	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212535	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212950	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213560	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000016891 ⟹ ENSRNOP00000016891

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	226,949,734 - 226,965,261 (+)	Ensembl
Rnor_6.0 Ensembl	2	243,701,962 - 243,721,816 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000017252 ⟹ ENSRNOP00000017252

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	226,975,098 - 226,987,591 (+)	Ensembl
Rnor_6.0 Ensembl	2	243,728,434 - 243,740,899 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000090253 ⟹ ENSRNOP00000069857

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	226,947,466 - 226,986,716 (+)	Ensembl
Rnor_6.0 Ensembl	2	243,700,784 - 243,740,032 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000104576 ⟹ ENSRNOP00000077866

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	226,948,717 - 226,966,747 (+)	Ensembl

RefSeq Acc Id:

NM_001126120 ⟹ NP_001119592

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	226,975,184 - 226,987,591 (+)	NCBI
Rnor_6.0	2	243,728,500 - 243,740,907 (+)	NCBI
Rnor_5.0	2	262,262,936 - 262,275,343 (+)	NCBI
RGSC_v3.4	2	235,979,108 - 235,991,515 (+)	RGD
Celera	2	219,131,229 - 219,143,636 (+)	RGD

Sequence:

show sequence

CCCGAACTTGCGGACATGGCGAACCAGGTGATCAGGTGTAAGGCTGCAGTCGCCTGGGAGGCCG
GAAAGCCTCTCTCCATAGAGGAGATAGAGGTGGCCCCTCCACAGGCTCATGAAGTTCGAATTAA
GATCATTGCCACTGCTGTTTGCCACACCGATGCCTATACCCTGAGTGGAGCTGATCCTGAGGGG
TGTTTCCCCGTGATCTTAGGACATGAAGGCGCTGGCATTGTGGAGAGTGTTGGCGAAGGGGTTA
CTAAGCTGAAGGCAGGTGATACCGTCATCCCGCTGTACATCCCACAGTGTGGAGAATGCAAGTT
CTGTCTGAATCCTAAAACAAACCTTTGCCAGAAAATAAGAGTCACTCAGGGGAAAGGGTTGATG
CCCGATGGGACCAGCAGGTTTACCTGCAAAGGGAAGCCTATTCTTCACTTCATGGGAACCAGCA
CGTTTTCCGAGTACACAGTGGTGGCAGACATCTCTGTTGCTAAAATTGACCCTTCCGCCCCTTT
GGATAAAGTCTGCCTTCTCGGTTGTGGCATTTCAACTGGCTACGGGGCCGCTGTGAACACTGCC
AAGGTGGAGCCTGGTTCTACCTGTGCCGTCTTTGGCCTGGGAGGAGTTGGATTGGCGGTGATCA
TGGGCTGTAAAGTGGCTGGTGCGTCCCGGATCATTGGTATTGACATCAATAAAGATAAATTCGC
GAAGGCCAAAGAATTTGGAGCCACTGAATGTATTAACCCCCAAGATTTCAGTAAATCCATCCAG
GAAGTCCTCATCGAGATGACAGATGGCGGAGTGGACTTCTCCTTTGAGTGTATCGGTAACGTGA
AGGTCATGAGATCAGCCCTCGAGGCAGCCCACAAAGGCTGGGGTGTCAGTGTGGTGGTTGGTGT
GGCCGCTTCAGGTGAAGAAATCTCCACTCGTCCGTTCCAACTGGTGACAGGACGCACGTGGAAA
GGCACTGCCTTTGGAGGCTGGAAGAGTGTGGAGAGTGTCCCGAAGCTGGTGTCTGAATATATGT
CCAAAAAGATAAAAGTTGACGAATTTGTGACTGGCAATCTGTCCTTCGACCAGATTAACAAAGC
CTTTGATCTGATGCACTCGGGAAACAGCATTCGAACTGTTCTAAAGATGTAAATTCTGAAGAGA
GTACTGCCCATCCTGCACTCTTTCCTGTGATTGAATAGAAACAGACAGGATTTACAAGCTTAAC
TGCCACTTAGACTTCAGGACCCACTAGAAGGAAGGTGCAAAATCGTGGCTGCAATCATGAATGA
GGCAACTGGTCGCCGTGCCTTTCTGAGCTCTCCACACAAATAATTGTTGCTCACCAATGCAACG
TTTTACGTAATAAAAATACACTCTGTGTTTGTGTGAAAGCCGAAAAAAAAAAAAAAAAAAAAAA
AAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001119592	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83724	(Get FASTA)	NCBI Sequence Viewer
	EDL82320	(Get FASTA)	NCBI Sequence Viewer
	P12711	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001119592 ⟸ NM_001126120

- UniProtKB:

Q5XIF8 (UniProtKB/Swiss-Prot), P12711 (UniProtKB/Swiss-Prot), A6HW34 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MANQVIRCKAAVAWEAGKPLSIEEIEVAPPQAHEVRIKIIATAVCHTDAYTLSGADPEGCFPVI
LGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGKGLMPDGTS
RFTCKGKPILHFMGTSTFSEYTVVADISVAKIDPSAPLDKVCLLGCGISTGYGAAVNTAKVEPG
STCAVFGLGGVGLAVIMGCKVAGASRIIGIDINKDKFAKAKEFGATECINPQDFSKSIQEVLIE
MTDGGVDFSFECIGNVKVMRSALEAAHKGWGVSVVVGVAASGEEISTRPFQLVTGRTWKGTAFG
GWKSVESVPKLVSEYMSKKIKVDEFVTGNLSFDQINKAFDLMHSGNSIRTVLKM

hide sequence

RefSeq Acc Id:

ENSRNOP00000069857 ⟸ ENSRNOT00000090253

RefSeq Acc Id:

ENSRNOP00000016891 ⟸ ENSRNOT00000016891

RefSeq Acc Id:

ENSRNOP00000017252 ⟸ ENSRNOT00000017252

RefSeq Acc Id:

ENSRNOP00000077866 ⟸ ENSRNOT00000104576

Protein Domains

Alcohol dehydrogenase-like C-terminal Alcohol dehydrogenase-like N-terminal Enoyl reductase (ER)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P12711-F1-model_v2	AlphaFold	P12711	1-374	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2292706	AgrOrtholog
BioCyc Gene	G2FUF-51063	BioCyc
Ensembl Genes	ENSRNOG00000046357	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000016891.5	UniProtKB/TrEMBL
	ENSRNOP00000017252	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000069857.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016891.7	UniProtKB/TrEMBL
	ENSRNOT00000017252	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000090253.2	UniProtKB/TrEMBL
Gene3D-CATH	Medium-chain alcohol dehydrogenases, catalytic domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NAD(P)-binding Rossmann-like Domain	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	ADH_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ADH_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ADH_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ADH_Zn_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GroES-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NAD(P)-bd_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PKS_ER	UniProtKB/TrEMBL
KEGG Report	rno:100145871	UniProtKB/Swiss-Prot
NCBI Gene	100145871	ENTREZGENE
PANTHER	ALCOHOL DEHYDROGENASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ALCOHOL DEHYDROGENASE 4	UniProtKB/TrEMBL
	ALCOHOL DEHYDROGENASE CLASS-3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ADH_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ADH_zinc_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Adh5	PhenoGen
PROSITE	ADH_ZINC	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	PKS_ER	UniProtKB/TrEMBL
Superfamily-SCOP	SSF50129	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SSF51735	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6HW34	ENTREZGENE, UniProtKB/TrEMBL
	ADHX_RAT	UniProtKB/Swiss-Prot
	F7F9U1_RAT	UniProtKB/TrEMBL
	P12711	ENTREZGENE
	Q5XIF8	ENTREZGENE
	Q7TQ90_RAT	UniProtKB/TrEMBL
UniProt Secondary	Q5XIF8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2010-09-15	Adh5	alcohol dehydrogenase 5 (class III), chi polypeptide	Adh5	alcohol dehydrogenase 5	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-05-03	Adh5	alcohol dehydrogenase 5			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)