Symbol:
Atp7b
Name:
ATPase copper transporting beta
RGD ID:
2180
Description:
Enables copper ion binding activity; copper ion transmembrane transporter activity; and zinc ion binding activity. Involved in several processes, including cellular response to copper ion; copper ion export; and lactation. Located in several cellular components, including basolateral plasma membrane; bicellular tight junction; and trans-Golgi network. Used to study Wilson disease; liver carcinoma; and renal adenoma. Human ortholog(s) of this gene implicated in Wilson disease. Orthologous to human ATP7B (ATPase copper transporting beta); PARTICIPATES IN cisplatin drug pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
ATPase Cu++ transporting beta polypeptide (same as Wilson disease); ATPase, Cu++ transporting, beta polypeptide; ATPase, Cu++ transporting, beta polypeptide (same as Wilson disease); copper pump 2; copper-transporting ATPase 2; Hts; PINA; PINA gene, promoter; pineal night-specific ATPase; Wd; wilson disease-associated protein homolog
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
ATP7B (ATPase copper transporting beta) HGNC
Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):
Atp7b (ATPase, copper transporting, beta polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Atp7b (ATPase copper transporting beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
ATP7B (ATPase copper transporting beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
ATP7B (ATPase copper transporting beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Atp7b (ATPase copper transporting beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
ATP7B (ATPase copper transporting beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
ATP7B (ATPase copper transporting beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Atp7b (ATPase copper transporting beta) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
BEND4 (BEN domain containing 4) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Atp7b (ATPase, copper transporting, beta polypeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
ATP7B (ATPase copper transporting beta)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
atp7b (ATPase copper transporting beta)
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
ATP7
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):
CCC2
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
cua-1
Alliance
DIOPT (Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
atp7b
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Allele / Splice:
Atp7bhts
Genetic Models:
WKAH.LEC-Atp7bhts /Tj
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 76,654,725 - 76,726,092 (+) NCBI GRCr8 mRatBN7.2 16 69,952,286 - 70,024,404 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 69,951,778 - 70,023,636 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 75,225,956 - 75,297,317 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 78,664,533 - 78,736,202 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 73,913,825 - 73,985,530 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 74,865,516 - 74,944,935 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 74,865,516 - 74,945,286 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 74,495,179 - 74,575,822 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 74,607,988 - 74,680,080 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 74,608,239 - 74,679,614 (+) NCBI Celera 16 67,837,288 - 67,908,140 (+) NCBI Celera RH 3.4 Map 16 664.21 RGD Cytogenetic Map 16 q12.5 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Atp7b Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ATP7B mRNA] CTD PMID:31150632 Atp7b Rat (-)-epigallocatechin 3-gallate multiple interactions ISO ATP7B (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ATP7B mRNA CTD PMID:22079256 Atp7b Rat 1,1'-azobis(N,N-dimethylformamide) multiple interactions ISO ATP7B (Homo sapiens) 6480464 Diamide promotes the reaction [CLU protein binds to ATP7B protein] CTD PMID:21242307 Atp7b Rat 17beta-estradiol multiple interactions ISO ATP7B (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of ATP7B mRNA CTD PMID:20660070 Atp7b Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of ATP7B mRNA CTD PMID:32145629 and PMID:35192832 Atp7b Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one increases expression ISO ATP7B (Homo sapiens) 6480464 Metribolone results in increased expression of ATP7B mRNA CTD PMID:25320179 Atp7b Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO ATP7B (Homo sapiens) 6480464 AR protein promotes the reaction [Metribolone results in increased expression of ATP7B mRNA] CTD PMID:25320179 Atp7b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of ATP7B mRNA CTD PMID:22298810 Atp7b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of ATP7B mRNA CTD PMID:32109520 Atp7b Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Atp7b (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of ATP7B mRNA CTD PMID:21570461 Atp7b Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO ATP7B (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of ATP7B mRNA CTD PMID:21632981 Atp7b Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Atp7b Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of ATP7B mRNA CTD PMID:21346803 Atp7b Rat 4,4'-diaminodiphenylmethane affects expression ISO Atp7b (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of ATP7B mRNA CTD PMID:18648102 Atp7b Rat 4,4'-sulfonyldiphenol decreases methylation ISO ATP7B (Homo sapiens) 6480464 bisphenol S results in decreased methylation of ATP7B gene CTD PMID:31601247 Atp7b Rat 5-fluorouracil increases response to substance ISO ATP7B (Homo sapiens) 6480464 ATP7B mRNA results in increased susceptibility to Fluorouracil CTD PMID:18593893 Atp7b Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of ATP7B mRNA CTD PMID:24780913 Atp7b Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of ATP7B mRNA CTD PMID:31881176 Atp7b Rat acrylamide increases expression ISO Atp7b (Mus musculus) 6480464 Acrylamide results in increased expression of ATP7B mRNA CTD PMID:30807115 Atp7b Rat acrylamide decreases expression ISO ATP7B (Homo sapiens) 6480464 Acrylamide results in decreased expression of ATP7B mRNA CTD PMID:32763439 Atp7b Rat aflatoxin B1 affects expression ISO ATP7B (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of ATP7B protein CTD PMID:20106945 Atp7b Rat aflatoxin B1 decreases methylation ISO ATP7B (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of ATP7B gene CTD PMID:27153756 Atp7b Rat Aflatoxin B2 alpha increases methylation ISO ATP7B (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of ATP7B intron CTD PMID:30157460 Atp7b Rat all-trans-retinoic acid decreases expression ISO ATP7B (Homo sapiens) 6480464 Tretinoin results in decreased expression of ATP7B mRNA CTD PMID:33167477 Atp7b Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of ATP7B mRNA CTD PMID:16483693 Atp7b Rat ammonium chloride multiple interactions ISO ATP7B (Homo sapiens) 6480464 Ammonium Chloride inhibits the reaction [CLU protein results in increased degradation of ATP7B protein modified form] CTD PMID:21242307 Atp7b Rat antirheumatic drug increases expression ISO ATP7B (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of ATP7B mRNA CTD PMID:24449571 Atp7b Rat aristolochic acid A decreases expression ISO ATP7B (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of ATP7B mRNA CTD PMID:33212167 Atp7b Rat ATP increases phosphorylation ISO ATP7B (Homo sapiens) 6480464 Adenosine Triphosphate results in increased phosphorylation of ATP7B protein CTD PMID:19405516 Atp7b Rat ATP multiple interactions ISO ATP7B (Homo sapiens) 6480464 [Copper co-treated with Adenosine Triphosphate] results in increased phosphorylation of ATP7B protein CTD PMID:20964302 Atp7b Rat atrazine decreases expression EXP 6480464 Atrazine results in decreased expression of ATP7B mRNA CTD PMID:36841081 Atp7b Rat bathocuproine disulfonic acid multiple interactions ISO ATP7B (Homo sapiens) 6480464 [Penicillamine co-treated with bathocuproine sulfonate] promotes the reaction [CLU protein binds to ATP7B protein] CTD PMID:21242307 Atp7b Rat benzo[a]pyrene increases methylation ISO ATP7B (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of ATP7B 3' UTR CTD PMID:27901495 Atp7b Rat benzo[a]pyrene decreases expression ISO ATP7B (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of ATP7B mRNA CTD PMID:32234424 Atp7b Rat benzo[a]pyrene affects methylation ISO ATP7B (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of ATP7B intron CTD PMID:30157460 Atp7b Rat benzo[a]pyrene decreases methylation ISO Atp7b (Mus musculus) 6480464 Benzo(a)pyrene results in decreased methylation of ATP7B exon and Benzo(a)pyrene results in decreased methylation of ATP7B intron CTD PMID:27901495 Atp7b Rat benzo[e]pyrene increases methylation ISO ATP7B (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of ATP7B intron CTD PMID:30157460 Atp7b Rat beta-hexachlorocyclohexane increases expression ISO Atp7b (Mus musculus) 6480464 beta-hexachlorocyclohexane results in increased expression of ATP7B mRNA CTD PMID:25270620 Atp7b Rat beta-naphthoflavone decreases expression ISO ATP7B (Homo sapiens) 6480464 beta-Naphthoflavone results in decreased expression of ATP7B mRNA CTD PMID:32858204 Atp7b Rat bis(2-ethylhexyl) phthalate increases expression ISO Atp7b (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of ATP7B mRNA CTD PMID:34319233 Atp7b Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of ATP7B mRNA CTD PMID:25181051 more ... Atp7b Rat bisphenol A increases methylation ISO ATP7B (Homo sapiens) 6480464 bisphenol A results in increased methylation of ATP7B gene CTD PMID:31601247 Atp7b Rat bisphenol A increases expression ISO Atp7b (Mus musculus) 6480464 bisphenol A results in increased expression of ATP7B mRNA CTD PMID:34585602 Atp7b Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of ATP7B mRNA CTD PMID:32145629 Atp7b Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of ATP7B gene CTD PMID:28505145 Atp7b Rat bisphenol F affects expression ISO Atp7b (Mus musculus) 6480464 bisphenol F affects the expression of ATP7B mRNA CTD PMID:38685157 Atp7b Rat brefeldin A multiple interactions ISO ATP7B (Homo sapiens) 6480464 Brefeldin A inhibits the reaction [Copper affects the localization of ATP7B protein] CTD PMID:10982773 Atp7b Rat buta-1,3-diene increases expression ISO Atp7b (Mus musculus) 6480464 1 and 3-butadiene results in increased expression of ATP7B mRNA CTD PMID:29038090 Atp7b Rat cadmium atom multiple interactions ISO ATP7B (Homo sapiens) 6480464 [Water Pollutants and Chemical co-treated with Cadmium] results in increased expression of ATP7B mRNA CTD PMID:26472158 Atp7b Rat cadmium dichloride decreases methylation EXP 6480464 Cadmium Chloride results in decreased methylation of ATP7B promoter CTD PMID:22457795 Atp7b Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of ATP7B mRNA CTD PMID:33453195 Atp7b Rat carboplatin multiple interactions ISO ATP7B (Homo sapiens) 6480464 ATP7B protein binds to and results in increased metabolism of Carboplatin CTD PMID:23751120 Atp7b Rat chloroprene increases expression ISO Atp7b (Mus musculus) 6480464 Chloroprene results in increased expression of ATP7B mRNA CTD PMID:23125180 Atp7b Rat chlorpyrifos decreases expression ISO Atp7b (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of ATP7B mRNA CTD PMID:37019170 Atp7b Rat cholesterol increases abundance EXP 6480464 ATP7B gene mutant form results in increased abundance of Cholesterol CTD PMID:17303181 Atp7b Rat cisplatin multiple interactions ISO ATP7B (Homo sapiens) 6480464 ATP7B protein binds to and results in increased metabolism of Cisplatin and Cisplatin results in increased stability of and results in increased activity of and affects the localization of ATP7B protein polymorphism CTD PMID:21406592 and PMID:23751120 Atp7b Rat cisplatin decreases expression ISO ATP7B (Homo sapiens) 6480464 Cisplatin results in decreased expression of ATP7B mRNA CTD PMID:38462020 Atp7b Rat cisplatin decreases expression ISO Atp7b (Mus musculus) 6480464 Cisplatin results in decreased expression of ATP7B CTD PMID:38462020 Atp7b Rat cisplatin decreases response to substance ISO Atp7b (Mus musculus) 6480464 ATP7B protein results in decreased susceptibility to Cisplatin CTD PMID:16170571 and PMID:20433422 Atp7b Rat cisplatin affects localization ISO Atp7b (Mus musculus) 6480464 Cisplatin affects the localization of ATP7B protein CTD PMID:20433422 Atp7b Rat cisplatin decreases response to substance ISO ATP7B (Homo sapiens) 6480464 ATP7B protein results in decreased susceptibility to Cisplatin CTD PMID:10728692 and PMID:12509969 Atp7b Rat cisplatin affects response to substance ISO ATP7B (Homo sapiens) 6480464 ATP7B mRNA affects the susceptibility to Cisplatin CTD PMID:18610736 Atp7b Rat cisplatin increases secretion ISO ATP7B (Homo sapiens) 6480464 ATP7B protein results in increased secretion of Cisplatin CTD PMID:10728692 Atp7b Rat copper atom increases response to substance ISO ATP7B (Homo sapiens) 6480464 ATP7B gene mutant form results in increased susceptibility to Copper CTD PMID:24892424 Atp7b Rat copper atom decreases response to substance ISO ATP7B (Homo sapiens) 6480464 ATP7B protein mutant form results in decreased susceptibility to Copper CTD PMID:22898812 Atp7b Rat copper atom increases phosphorylation ISO ATP7B (Homo sapiens) 6480464 Copper results in increased phosphorylation of ATP7B protein CTD PMID:11677246 more ... Atp7b Rat copper atom decreases export ISO Atp7b (Mus musculus) 6480464 ATP7B gene mutant form results in decreased export of Copper CTD PMID:22802922 Atp7b Rat copper atom decreases abundance ISO ATP7B (Homo sapiens) 6480464 ATP7B gene mutant form results in decreased abundance of Copper and ATP7B protein results in decreased abundance of Copper CTD PMID:24368744 and PMID:24522273 Atp7b Rat copper atom affects localization EXP 6480464 Copper affects the localization of ATP7B protein CTD PMID:24614235 Atp7b Rat copper atom increases transport EXP 6480464 ATP7B protein results in increased transport of Copper CTD PMID:24614235 Atp7b Rat copper atom increases abundance EXP 6480464 ATP7B gene mutant form results in increased abundance of Copper CTD PMID:15911138 and PMID:21364284 Atp7b Rat copper atom affects abundance ISO Atp7b (Mus musculus) 6480464 ATP7B protein affects the abundance of Copper CTD PMID:17205981 and PMID:21146535 Atp7b Rat copper atom increases export ISO ATP7B (Homo sapiens) 6480464 ATP7B protein results in increased export of Copper CTD PMID:17975309 Atp7b Rat copper atom decreases secretion EXP 6480464 ATP7B gene mutant form results in decreased secretion of Copper and ATP7B protein mutant form results in decreased secretion of Copper CTD PMID:14574444 and PMID:17303181 Atp7b Rat copper atom affects localization ISO Atp7b (Mus musculus) 6480464 Copper affects the localization of ATP7B protein CTD PMID:11157799 Atp7b Rat copper atom decreases response to substance ISO Atp7b (Mus musculus) 6480464 ATP7B protein results in decreased susceptibility to Copper CTD PMID:11157799 Atp7b Rat copper atom increases abundance ISO ATP7B (Homo sapiens) 6480464 ATP7B protein mutant form results in increased abundance of Copper CTD PMID:16549536 Atp7b Rat copper atom increases transport ISO ATP7B (Homo sapiens) 6480464 ATP7B protein results in increased transport of Copper CTD PMID:11854914 and PMID:12544487 Atp7b Rat copper atom multiple interactions ISO Atp7b (Mus musculus) 6480464 [ATP7B gene mutant form results in decreased export of Copper] which results in decreased expression of SLC31A1 protein more ... CTD PMID:11803042 more ... Atp7b Rat copper atom increases uptake ISO Atp7b (Mus musculus) 6480464 ATP7B gene mutant form results in increased uptake of Copper CTD PMID:20647314 Atp7b Rat copper atom affects transport ISO ATP7B (Homo sapiens) 6480464 ATP7B protein affects the transport of Copper CTD PMID:16632204 and PMID:17109627 Atp7b Rat copper atom multiple interactions EXP 6480464 [ATP7B protein affects the susceptibility to Copper] which affects the expression of CDKN1A mRNA more ... CTD PMID:23112546 Atp7b Rat copper atom affects abundance EXP 6480464 ATP7B protein affects the abundance of Copper CTD PMID:23112546 Atp7b Rat copper atom affects response to substance EXP 6480464 ATP7B protein affects the susceptibility to Copper CTD PMID:23112546 Atp7b Rat copper atom increases abundance ISO Atp7b (Mus musculus) 6480464 ATP7B gene mutant form results in increased abundance of Copper CTD PMID:11803042 and PMID:26241054 Atp7b Rat copper atom increases expression EXP 6480464 Copper results in increased expression of ATP7B mRNA CTD PMID:15591161 Atp7b Rat copper atom multiple interactions ISO ATP7B (Homo sapiens) 6480464 [[ATOX1 protein binds to Copper] which binds to ATP7B protein] inhibits the reaction [ATOX1 protein binds to Copper] more ... CTD PMID:10982773 more ... Atp7b Rat copper atom affects localization ISO ATP7B (Homo sapiens) 6480464 ATP7B protein polymorphism affects the localization of Copper and Copper affects the localization of ATP7B protein CTD PMID:10982773 more ... Atp7b Rat copper atom affects binding ISO ATP7B (Homo sapiens) 6480464 [ATOX1 protein binds to Copper] which binds to ATP7B protein more ... CTD PMID:16571664 more ... Atp7b Rat copper(0) increases response to substance ISO ATP7B (Homo sapiens) 6480464 ATP7B gene mutant form results in increased susceptibility to Copper CTD PMID:24892424 Atp7b Rat copper(0) increases phosphorylation ISO ATP7B (Homo sapiens) 6480464 Copper results in increased phosphorylation of ATP7B protein CTD PMID:11677246 more ... Atp7b Rat copper(0) decreases response to substance ISO ATP7B (Homo sapiens) 6480464 ATP7B protein mutant form results in decreased susceptibility to Copper CTD PMID:22898812 Atp7b Rat copper(0) decreases export ISO Atp7b (Mus musculus) 6480464 ATP7B gene mutant form results in decreased export of Copper CTD PMID:22802922 Atp7b Rat copper(0) decreases abundance ISO ATP7B (Homo sapiens) 6480464 ATP7B gene mutant form results in decreased abundance of Copper and ATP7B protein results in decreased abundance of Copper CTD PMID:24368744 and PMID:24522273 Atp7b Rat copper(0) affects localization EXP 6480464 Copper affects the localization of ATP7B protein CTD PMID:24614235 Atp7b Rat copper(0) increases transport EXP 6480464 ATP7B protein results in increased transport of Copper CTD PMID:24614235 Atp7b Rat copper(0) increases abundance EXP 6480464 ATP7B gene mutant form results in increased abundance of Copper CTD PMID:15911138 and PMID:21364284 Atp7b Rat copper(0) affects abundance ISO Atp7b (Mus musculus) 6480464 ATP7B protein affects the abundance of Copper CTD PMID:17205981 and PMID:21146535 Atp7b Rat copper(0) increases export ISO ATP7B (Homo sapiens) 6480464 ATP7B protein results in increased export of Copper CTD PMID:17975309 Atp7b Rat copper(0) decreases secretion EXP 6480464 ATP7B gene mutant form results in decreased secretion of Copper and ATP7B protein mutant form results in decreased secretion of Copper CTD PMID:14574444 and PMID:17303181 Atp7b Rat copper(0) affects localization ISO Atp7b (Mus musculus) 6480464 Copper affects the localization of ATP7B protein CTD PMID:11157799 Atp7b Rat copper(0) decreases response to substance ISO Atp7b (Mus musculus) 6480464 ATP7B protein results in decreased susceptibility to Copper CTD PMID:11157799 Atp7b Rat copper(0) increases abundance ISO ATP7B (Homo sapiens) 6480464 ATP7B protein mutant form results in increased abundance of Copper CTD PMID:16549536 Atp7b Rat copper(0) increases transport ISO ATP7B (Homo sapiens) 6480464 ATP7B protein results in increased transport of Copper CTD PMID:11854914 and PMID:12544487 Atp7b Rat copper(0) multiple interactions ISO Atp7b (Mus musculus) 6480464 [ATP7B gene mutant form results in decreased export of Copper] which results in decreased expression of SLC31A1 protein more ... CTD PMID:11803042 more ... Atp7b Rat copper(0) increases uptake ISO Atp7b (Mus musculus) 6480464 ATP7B gene mutant form results in increased uptake of Copper CTD PMID:20647314 Atp7b Rat copper(0) affects transport ISO ATP7B (Homo sapiens) 6480464 ATP7B protein affects the transport of Copper CTD PMID:16632204 and PMID:17109627 Atp7b Rat copper(0) multiple interactions EXP 6480464 [ATP7B protein affects the susceptibility to Copper] which affects the expression of CDKN1A mRNA more ... CTD PMID:23112546 Atp7b Rat copper(0) affects abundance EXP 6480464 ATP7B protein affects the abundance of Copper CTD PMID:23112546 Atp7b Rat copper(0) affects response to substance EXP 6480464 ATP7B protein affects the susceptibility to Copper CTD PMID:23112546 Atp7b Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of ATP7B mRNA CTD PMID:15591161 Atp7b Rat copper(0) multiple interactions ISO ATP7B (Homo sapiens) 6480464 [[ATOX1 protein binds to Copper] which binds to ATP7B protein] inhibits the reaction [ATOX1 protein binds to Copper] more ... CTD PMID:10982773 more ... Atp7b Rat copper(0) increases abundance ISO Atp7b (Mus musculus) 6480464 ATP7B gene mutant form results in increased abundance of Copper CTD PMID:11803042 and PMID:26241054 Atp7b Rat copper(0) affects binding ISO ATP7B (Homo sapiens) 6480464 [ATOX1 protein binds to Copper] which binds to ATP7B protein more ... CTD PMID:16571664 more ... Atp7b Rat copper(0) affects localization ISO ATP7B (Homo sapiens) 6480464 ATP7B protein polymorphism affects the localization of Copper and Copper affects the localization of ATP7B protein CTD PMID:10982773 more ... Atp7b Rat copper(II) chloride decreases response to substance ISO ATP7B (Homo sapiens) 6480464 ATP7B protein results in decreased susceptibility to cupric chloride CTD PMID:10728692 Atp7b Rat copper(II) chloride affects localization ISO ATP7B (Homo sapiens) 6480464 cupric chloride affects the localization of ATP7B protein CTD PMID:16799059 and PMID:24343273 Atp7b Rat copper(II) chloride multiple interactions ISO ATP7B (Homo sapiens) 6480464 ATP7B protein results in decreased susceptibility to [cupric chloride results in increased abundance of Copper] more ... CTD PMID:21242307 and PMID:32278528 Atp7b Rat copper(II) chloride affects localization EXP 6480464 cupric chloride affects the localization of ATP7B protein CTD PMID:16799059 Atp7b Rat copper(II) sulfate decreases response to substance ISO ATP7B (Homo sapiens) 6480464 ATP7B protein results in decreased susceptibility to Copper Sulfate CTD PMID:10728692 Atp7b Rat copper(II) sulfate increases expression ISO ATP7B (Homo sapiens) 6480464 Copper Sulfate results in increased expression of ATP7B mRNA and Copper Sulfate results in increased expression of ATP7B protein CTD PMID:24815816 Atp7b Rat copper(II) sulfate decreases expression ISO ATP7B (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of ATP7B mRNA CTD PMID:19549813 Atp7b Rat CU-O LINKAGE affects localization ISO ATP7B (Homo sapiens) 6480464 cupric oxide affects the localization of ATP7B protein CTD PMID:24343273 Atp7b Rat CU-O LINKAGE increases expression ISO ATP7B (Homo sapiens) 6480464 cupric oxide analog results in increased expression of ATP7B mRNA and cupric oxide analog results in increased expression of ATP7B protein CTD PMID:24815816 Atp7b Rat cyclosporin A decreases expression ISO ATP7B (Homo sapiens) 6480464 Cyclosporine results in decreased expression of ATP7B mRNA CTD PMID:20106945 and PMID:25562108 Atp7b Rat cytarabine decreases expression ISO ATP7B (Homo sapiens) 6480464 Cytarabine results in decreased expression of ATP7B mRNA CTD PMID:21198554 Atp7b Rat D-penicillamine multiple interactions ISO ATP7B (Homo sapiens) 6480464 [Penicillamine co-treated with ATP7B gene mutant form] results in decreased activity of CAT protein more ... CTD PMID:21242307 and PMID:24368744 Atp7b Rat D-penicillamine multiple interactions ISO Atp7b (Mus musculus) 6480464 Penicillamine inhibits the reaction [ATP7B mutant form results in increased expression of IL1B protein] more ... CTD PMID:22945834 and PMID:38761876 Atp7b Rat decabromodiphenyl ether increases expression EXP 6480464 decabromobiphenyl ether results in increased expression of ATP7B mRNA CTD PMID:23914054 Atp7b Rat dichlorine multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of ATP7B mRNA CTD PMID:18636392 Atp7b Rat dimethylarsinic acid multiple interactions ISO Atp7b (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of ATP7B mRNA CTD PMID:34876320 Atp7b Rat dioxygen multiple interactions ISO Atp7b (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of ATP7B mRNA CTD PMID:30529165 Atp7b Rat dorsomorphin multiple interactions ISO ATP7B (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ATP7B mRNA CTD PMID:27188386 Atp7b Rat doxorubicin decreases expression ISO ATP7B (Homo sapiens) 6480464 Doxorubicin results in decreased expression of ATP7B mRNA CTD PMID:29803840 Atp7b Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of ATP7B mRNA CTD PMID:29391264 Atp7b Rat epoxiconazole decreases expression ISO Atp7b (Mus musculus) 6480464 epoxiconazole results in decreased expression of ATP7B mRNA CTD PMID:35436446 Atp7b Rat eritoran multiple interactions ISO Atp7b (Mus musculus) 6480464 eritoran inhibits the reaction [ATP7B mutant form results in increased expression of IL1B protein] more ... CTD PMID:38761876 Atp7b Rat ferroheme b multiple interactions ISO ATP7B (Homo sapiens) 6480464 ATP7B gene mutant form promotes the reaction [Copper results in decreased abundance of Heme] CTD PMID:19888908 Atp7b Rat folic acid decreases expression ISO ATP7B (Homo sapiens) 6480464 Folic Acid results in decreased expression of ATP7B mRNA CTD PMID:21867686 Atp7b Rat FR900359 increases phosphorylation ISO ATP7B (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of ATP7B protein CTD PMID:37730182 Atp7b Rat genistein decreases expression EXP 6480464 Genistein results in decreased expression of ATP7B mRNA CTD PMID:21782745 Atp7b Rat genistein multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of ATP7B mRNA CTD PMID:21782745 Atp7b Rat glutathione multiple interactions ISO ATP7B (Homo sapiens) 6480464 Penicillamine inhibits the reaction [ATP7B gene mutant form results in decreased abundance of Glutathione] and Zinc Sulfate inhibits the reaction [ATP7B gene mutant form results in decreased abundance of Glutathione] CTD PMID:24368744 Atp7b Rat glutathione decreases abundance ISO ATP7B (Homo sapiens) 6480464 ATP7B gene mutant form results in decreased abundance of Glutathione CTD PMID:24368744 Atp7b Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of ATP7B mRNA CTD PMID:24395379 Atp7b Rat glycine betaine multiple interactions ISO Atp7b (Mus musculus) 6480464 ATP7B protein mutant form promotes the reaction [Betaine results in increased abundance of S-Adenosylmethionine] more ... CTD PMID:22945834 Atp7b Rat GW 4064 multiple interactions ISO Atp7b (Mus musculus) 6480464 ATP7B protein affects the reaction [GW 4064 results in increased expression of ABCB11 mRNA] more ... CTD PMID:26241054 Atp7b Rat heme b multiple interactions ISO ATP7B (Homo sapiens) 6480464 ATP7B gene mutant form promotes the reaction [Copper results in decreased abundance of Heme] CTD PMID:19888908 Atp7b Rat hydrogen peroxide affects expression ISO ATP7B (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of ATP7B mRNA CTD PMID:20044591 Atp7b Rat hydrogen peroxide multiple interactions ISO ATP7B (Homo sapiens) 6480464 Hydrogen Peroxide promotes the reaction [CLU protein binds to ATP7B protein] CTD PMID:21242307 Atp7b Rat inulin multiple interactions ISO Atp7b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ATP7B mRNA CTD PMID:36331819 Atp7b Rat iron atom increases abundance EXP 6480464 ATP7B gene mutant form results in increased abundance of Iron CTD PMID:15911138 Atp7b Rat iron(0) increases abundance EXP 6480464 ATP7B gene mutant form results in increased abundance of Iron CTD PMID:15911138 Atp7b Rat lead(0) affects expression ISO ATP7B (Homo sapiens) 6480464 Lead affects the expression of ATP7B mRNA CTD PMID:28903495 Atp7b Rat luteolin increases expression EXP 6480464 Luteolin results in increased expression of ATP7B mRNA CTD PMID:31201582 Atp7b Rat magnesium atom increases phosphorylation ISO ATP7B (Homo sapiens) 6480464 Magnesium results in increased phosphorylation of ATP7B protein CTD PMID:19405516 Atp7b Rat malonaldehyde increases abundance EXP 6480464 ATP7B gene mutant form results in increased abundance of Malondialdehyde CTD PMID:17303181 Atp7b Rat manganese atom increases phosphorylation ISO ATP7B (Homo sapiens) 6480464 Manganese results in increased phosphorylation of ATP7B protein CTD PMID:19405516 Atp7b Rat manganese atom decreases expression EXP 6480464 Manganese results in decreased expression of ATP7B mRNA and Manganese results in decreased expression of ATP7B protein CTD PMID:24614235 Atp7b Rat manganese atom affects localization EXP 6480464 Manganese affects the localization of ATP7B protein CTD PMID:24614235 Atp7b Rat manganese(0) increases phosphorylation ISO ATP7B (Homo sapiens) 6480464 Manganese results in increased phosphorylation of ATP7B protein CTD PMID:19405516 Atp7b Rat manganese(0) decreases expression EXP 6480464 Manganese results in decreased expression of ATP7B mRNA and Manganese results in decreased expression of ATP7B protein CTD PMID:24614235 Atp7b Rat manganese(0) affects localization EXP 6480464 Manganese affects the localization of ATP7B protein CTD PMID:24614235 Atp7b Rat manganese(II) chloride affects localization EXP 6480464 manganese chloride affects the localization of ATP7B protein CTD PMID:24614235 Atp7b Rat manganese(II) chloride decreases expression EXP 6480464 manganese chloride results in decreased expression of ATP7B mRNA and manganese chloride results in decreased expression of ATP7B protein CTD PMID:24614235 Atp7b Rat menadione affects expression ISO ATP7B (Homo sapiens) 6480464 Vitamin K 3 affects the expression of ATP7B mRNA CTD PMID:20044591 Atp7b Rat methapyrilene increases methylation ISO ATP7B (Homo sapiens) 6480464 Methapyrilene results in increased methylation of ATP7B intron CTD PMID:30157460 Atp7b Rat methoxychlor multiple interactions EXP 6480464 [Genistein co-treated with Methoxychlor] results in decreased expression of ATP7B mRNA CTD PMID:21782745 Atp7b Rat methoxychlor decreases expression EXP 6480464 Methoxychlor results in decreased expression of ATP7B mRNA CTD PMID:21782745 Atp7b Rat methylarsonic acid multiple interactions ISO Atp7b (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of ATP7B mRNA CTD PMID:34876320 Atp7b Rat methylmercury chloride decreases expression ISO ATP7B (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of ATP7B mRNA CTD PMID:23179753 Atp7b Rat monosodium L-glutamate increases expression ISO Atp7b (Mus musculus) 6480464 Sodium Glutamate results in increased expression of ATP7B mRNA CTD PMID:22078008 Atp7b Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal decreases degradation ISO ATP7B (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in decreased degradation of ATP7B protein CTD PMID:21189263 Atp7b Rat N-nitrosodiethylamine affects response to substance EXP 6480464 ATP7B protein affects the susceptibility to Diethylnitrosamine CTD PMID:11509115 Atp7b Rat nickel atom decreases expression ISO ATP7B (Homo sapiens) 6480464 Nickel results in decreased expression of ATP7B mRNA CTD PMID:25583101 Atp7b Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of ATP7B mRNA CTD PMID:33484710 Atp7b Rat nocodazole multiple interactions ISO ATP7B (Homo sapiens) 6480464 Nocodazole inhibits the reaction [Copper affects the localization of ATP7B protein] CTD PMID:10982773 Atp7b Rat oxaliplatin decreases expression ISO ATP7B (Homo sapiens) 6480464 oxaliplatin results in decreased expression of ATP7B mRNA CTD PMID:16773204 Atp7b Rat oxaliplatin affects response to substance ISO ATP7B (Homo sapiens) 6480464 ATP7B protein affects the susceptibility to oxaliplatin CTD PMID:16773204 Atp7b Rat ozone multiple interactions EXP 6480464 [Ozone co-treated with Chlorine] results in increased expression of ATP7B mRNA CTD PMID:18636392 Atp7b Rat ozone multiple interactions ISO ATP7B (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of ATP7B mRNA CTD PMID:35430440 Atp7b Rat ozone multiple interactions ISO Atp7b (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of ATP7B mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of ATP7B mRNA CTD PMID:34911549 Atp7b Rat paracetamol affects expression ISO Atp7b (Mus musculus) 6480464 Acetaminophen affects the expression of ATP7B mRNA CTD PMID:17562736 Atp7b Rat paracetamol decreases expression ISO ATP7B (Homo sapiens) 6480464 Acetaminophen results in decreased expression of ATP7B mRNA CTD PMID:25704631 Atp7b Rat paraquat decreases expression ISO ATP7B (Homo sapiens) 6480464 Paraquat results in decreased expression of ATP7B mRNA CTD PMID:34097952 Atp7b Rat pentachlorophenol decreases expression ISO Atp7b (Mus musculus) 6480464 Pentachlorophenol results in decreased expression of ATP7B mRNA CTD PMID:23892564 Atp7b Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Atp7b (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of ATP7B mRNA CTD PMID:36331819 Atp7b Rat phenylmercury acetate increases expression ISO ATP7B (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of ATP7B mRNA CTD PMID:26272509 Atp7b Rat phenylmercury acetate multiple interactions ISO ATP7B (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ATP7B mRNA CTD PMID:27188386 Atp7b Rat phorbol 13-acetate 12-myristate multiple interactions ISO ATP7B (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate results in increased phosphorylation of PRKD1 protein] which results in increased expression of ATP7B protein CTD PMID:21189263 Atp7b Rat platinum increases uptake ISO Atp7b (Mus musculus) 6480464 ATP7B protein results in increased uptake of Platinum CTD PMID:16170571 Atp7b Rat platinum(0) increases uptake ISO Atp7b (Mus musculus) 6480464 ATP7B protein results in increased uptake of Platinum CTD PMID:16170571 Atp7b Rat potassium chromate decreases expression ISO ATP7B (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of ATP7B mRNA CTD PMID:22079256 Atp7b Rat potassium chromate multiple interactions ISO ATP7B (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of ATP7B mRNA CTD PMID:22079256 Atp7b Rat progesterone multiple interactions ISO ATP7B (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of ATP7B mRNA CTD PMID:20660070 Atp7b Rat protoporphyrin multiple interactions ISO ATP7B (Homo sapiens) 6480464 ATP7B gene mutant form promotes the reaction [Copper results in decreased abundance of protoporphyrin IX] CTD PMID:19888908 Atp7b Rat protoporphyrin decreases chemical synthesis ISO ATP7B (Homo sapiens) 6480464 ATP7B gene mutant form results in decreased chemical synthesis of protoporphyrin IX CTD PMID:19888908 Atp7b Rat quercetin decreases expression ISO ATP7B (Homo sapiens) 6480464 Quercetin results in decreased expression of ATP7B mRNA CTD PMID:21632981 Atp7b Rat quercetin increases expression EXP 6480464 Quercetin results in increased expression of ATP7B mRNA CTD PMID:31201582 Atp7b Rat S-adenosyl-L-homocysteine increases abundance ISO Atp7b (Mus musculus) 6480464 ATP7B protein mutant form results in increased abundance of S-Adenosylhomocysteine CTD PMID:22945834 Atp7b Rat S-adenosyl-L-methioninate multiple interactions ISO Atp7b (Mus musculus) 6480464 ATP7B protein mutant form promotes the reaction [Betaine results in increased abundance of S-Adenosylmethionine] CTD PMID:22945834 Atp7b Rat S-adenosyl-L-methionine multiple interactions ISO Atp7b (Mus musculus) 6480464 ATP7B protein mutant form promotes the reaction [Betaine results in increased abundance of S-Adenosylmethionine] CTD PMID:22945834 Atp7b Rat satraplatin decreases response to substance ISO Atp7b (Mus musculus) 6480464 ATP7B protein results in decreased susceptibility to satraplatin metabolite CTD PMID:16170571 Atp7b Rat SB 431542 multiple interactions ISO ATP7B (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of ATP7B mRNA CTD PMID:27188386 Atp7b Rat silicon dioxide increases expression ISO Atp7b (Mus musculus) 6480464 Silicon Dioxide results in increased expression of ATP7B mRNA CTD PMID:38403151 Atp7b Rat sodium arsenate multiple interactions ISO Atp7b (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of ATP7B mRNA CTD PMID:34876320 Atp7b Rat sodium arsenite affects methylation ISO ATP7B (Homo sapiens) 6480464 sodium arsenite affects the methylation of ATP7B gene CTD PMID:28589171 Atp7b Rat sodium arsenite multiple interactions ISO Atp7b (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in increased expression of ATP7B mRNA CTD PMID:34876320 Atp7b Rat streptozocin decreases expression EXP 6480464 Streptozocin results in decreased expression of ATP7B protein CTD PMID:24927960 Atp7b Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of ATP7B mRNA] CTD PMID:31150632 Atp7b Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of ATP7B mRNA CTD PMID:31150632 Atp7b Rat tetrathiomolybdate(2-) multiple interactions ISO Atp7b (Mus musculus) 6480464 tetrathiomolybdate inhibits the reaction [ATP7B gene mutant form results in increased abundance of Copper] CTD PMID:11803042 Atp7b Rat tetrathiomolybdate(2-) decreases expression ISO ATP7B (Homo sapiens) 6480464 tetrathiomolybdate results in decreased expression of ATP7B protein CTD PMID:37290678 Atp7b Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of ATP7B mRNA CTD PMID:26222700 Atp7b Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of ATP7B mRNA CTD PMID:34492290 Atp7b Rat titanium dioxide affects expression ISO Atp7b (Mus musculus) 6480464 titanium dioxide affects the expression of ATP7B mRNA CTD PMID:17656681 Atp7b Rat titanium dioxide decreases expression ISO Atp7b (Mus musculus) 6480464 titanium dioxide results in decreased expression of ATP7B mRNA CTD PMID:35295148 Atp7b Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of ATP7B mRNA CTD PMID:33387578 Atp7b Rat triclosan increases expression ISO ATP7B (Homo sapiens) 6480464 Triclosan results in increased expression of ATP7B mRNA CTD PMID:30510588 Atp7b Rat tunicamycin increases expression ISO Atp7b (Mus musculus) 6480464 Tunicamycin results in increased expression of ATP7B mRNA CTD PMID:17127020 Atp7b Rat valproic acid decreases methylation ISO ATP7B (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of ATP7B gene CTD PMID:29154799 Atp7b Rat valproic acid increases expression ISO ATP7B (Homo sapiens) 6480464 Valproic Acid results in increased expression of ATP7B mRNA CTD PMID:24935251 and PMID:29154799 Atp7b Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of ATP7B mRNA CTD PMID:20566332 Atp7b Rat zinc acetate increases response to substance ISO Atp7b (Mus musculus) 6480464 ATP7B gene mutant form results in increased susceptibility to Zinc Acetate CTD PMID:26241054 Atp7b Rat zinc acetate multiple interactions ISO Atp7b (Mus musculus) 6480464 [ATP7B gene mutant form results in increased susceptibility to Zinc Acetate] promotes the reaction [NR1H4 protein binds to ABCB11 promoter] more ... CTD PMID:26241054 Atp7b Rat zinc atom increases abundance ISO Atp7b (Mus musculus) 6480464 ATP7B gene mutant form results in increased abundance of Zinc CTD PMID:11803042 Atp7b Rat zinc dichloride decreases expression ISO ATP7B (Homo sapiens) 6480464 zinc chloride results in decreased expression of ATP7B mRNA CTD PMID:18947441 Atp7b Rat zinc dichloride increases expression ISO ATP7B (Homo sapiens) 6480464 zinc chloride results in increased expression of ATP7B mRNA CTD PMID:18947441 Atp7b Rat zinc sulfate multiple interactions ISO ATP7B (Homo sapiens) 6480464 [Zinc Sulfate co-treated with ATP7B gene mutant form] results in decreased activity of CAT protein more ... CTD PMID:24368744 Atp7b Rat zinc(0) increases abundance ISO Atp7b (Mus musculus) 6480464 ATP7B gene mutant form results in increased abundance of Zinc CTD PMID:11803042 Atp7b Rat zoledronic acid decreases expression ISO ATP7B (Homo sapiens) 6480464 zoledronic acid results in decreased expression of ATP7B mRNA CTD PMID:24714768
(+)-schisandrin B (EXP) (-)-epigallocatechin 3-gallate (ISO) 1,1'-azobis(N,N-dimethylformamide) (ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,6-dinitrotoluene (EXP) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (ISO) ammonium chloride (EXP,ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) ATP (ISO) atrazine (EXP) bathocuproine disulfonic acid (ISO) benzo[a]pyrene (ISO) benzo[e]pyrene (ISO) beta-hexachlorocyclohexane (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) brefeldin A (ISO) buta-1,3-diene (ISO) cadmium atom (ISO) cadmium dichloride (EXP) carboplatin (ISO) chloroprene (ISO) chlorpyrifos (ISO) cholesterol (EXP) cisplatin (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) chloride (EXP,ISO) copper(II) sulfate (ISO) CU-O LINKAGE (ISO) cyclosporin A (ISO) cytarabine (ISO) D-penicillamine (ISO) decabromodiphenyl ether (EXP) dichlorine (EXP) dimethylarsinic acid (ISO) dioxygen (ISO) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) eritoran (ISO) ferroheme b (ISO) folic acid (ISO) FR900359 (ISO) genistein (EXP) glutathione (ISO) glycidol (EXP) glycine betaine (ISO) GW 4064 (ISO) heme b (ISO) hydrogen peroxide (ISO) inulin (ISO) iron atom (EXP) iron(0) (EXP) lead(0) (ISO) luteolin (EXP) magnesium atom (ISO) malonaldehyde (EXP) manganese atom (EXP,ISO) manganese(0) (EXP,ISO) manganese(II) chloride (EXP) menadione (ISO) methapyrilene (ISO) methoxychlor (EXP) methylarsonic acid (ISO) methylmercury chloride (ISO) monosodium L-glutamate (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) N-nitrosodiethylamine (EXP) nickel atom (ISO) nitrofen (EXP) nocodazole (ISO) oxaliplatin (ISO) ozone (EXP,ISO) paracetamol (ISO) paraquat (ISO) pentachlorophenol (ISO) perfluorooctane-1-sulfonic acid (ISO) phenylmercury acetate (ISO) phorbol 13-acetate 12-myristate (ISO) platinum (ISO) platinum(0) (ISO) potassium chromate (ISO) progesterone (ISO) protoporphyrin (ISO) quercetin (EXP,ISO) S-adenosyl-L-homocysteine (ISO) S-adenosyl-L-methioninate (ISO) S-adenosyl-L-methionine (ISO) satraplatin (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) streptozocin (EXP) tetrachloromethane (EXP) tetrathiomolybdate(2-) (ISO) thioacetamide (EXP) titanium dioxide (ISO) trichloroethene (EXP) triclosan (ISO) tunicamycin (ISO) valproic acid (ISO) vinclozolin (EXP) zinc acetate (ISO) zinc atom (ISO) zinc dichloride (ISO) zinc sulfate (ISO) zinc(0) (ISO) zoledronic acid (ISO)
Biological Process
cellular response to copper ion (IEP,IMP) cellular response to manganese ion (IEP) circadian rhythm (IEP) copper ion export (IBA,IMP) copper ion import (IBA,IEA,ISO) copper ion transmembrane transport (IEA) copper ion transport (IEA,ISO) establishment of localization in cell (IEA,ISO) intracellular copper ion homeostasis (IBA,IEA,ISO) intracellular zinc ion homeostasis (IEA,ISO) lactation (IEA,IEP,ISO) monoatomic cation transport (IEA) monoatomic ion transport (IEA) protein maturation (IEA,ISO) response to cAMP (IEP) response to copper ion (IEA,IEP,ISO) response to prolactin (IEP) response to zinc ion (IEP) rhythmic process (IEA) sequestering of calcium ion (IEA,ISO)
Cellular Component
apical part of cell (IDA) basolateral plasma membrane (IDA,IEA,ISO) bicellular tight junction (IDA) cytoplasmic vesicle (IEA,ISO) endosome (IEA) Golgi apparatus (IEA,ISO) late endosome (IDA,IEA,ISO) membrane (IEA,ISO) mitochondrion (ISO) perinuclear region of cytoplasm (IDA,IEA,ISO) plasma membrane (IBA) tight junction (IDA) trans-Golgi network (IBA,IDA,IEA,ISO) trans-Golgi network membrane (IEA,ISO,ISS)
1.
Expression of copper-transporting P-type adenosine triphosphatase (ATP7B) as a prognostic factor in human endometrial carcinoma.
Aida T, etal., Gynecol Oncol. 2005 Apr;97(1):41-5.
2.
Effects of copper supplementation on copper absorption, tissue distribution, and copper transporter expression in an infant rat model.
Bauerly KA, etal., Am J Physiol Gastrointest Liver Physiol. 2005 May;288(5):G1007-14. Epub 2004 Dec 9.
3.
Dominant-stable beta-catenin expression causes cell fate alterations and Wnt signaling antagonist expression in a murine granulosa cell tumor model.
Boerboom D, etal., Cancer Res. 2006 Feb 15;66(4):1964-73.
4.
A novel pineal night-specific ATPase encoded by the Wilson disease gene.
Borjigin J, etal., J Neurosci. 1999 Feb 1;19(3):1018-26.
5.
Regulation of copper transport crossing brain barrier systems by Cu-ATPases: effect of manganese exposure.
Fu X, etal., Toxicol Sci. 2014 Jun;139(2):432-51. doi: 10.1093/toxsci/kfu048. Epub 2014 Mar 10.
6.
Therapeutic potential of hepatocyte-like-cells converted from stem cells from human exfoliated deciduous teeth in fulminant Wilson's disease.
Fujiyoshi J, etal., Sci Rep. 2019 Feb 7;9(1):1535. doi: 10.1038/s41598-018-38275-y.
7.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.
NH2-terminal signals in ATP7B Cu-ATPase mediate its Cu-dependent anterograde traffic in polarized hepatic cells.
Guo Y, etal., Am J Physiol Gastrointest Liver Physiol. 2005 Nov;289(5):G904-16. Epub 2005 Jun 30.
9.
ATP7B copper-regulated traffic and association with the tight junctions: copper excretion into the bile.
Hernandez S, etal., Gastroenterology. 2008 Apr;134(4):1215-23. Epub 2008 Jan 17.
10.
Copper-transporting P-type adenosine triphosphatase (ATP7B) is expressed in human breast carcinoma.
Kanzaki A, etal., Jpn J Cancer Res. 2002 Jan;93(1):70-7.
11.
Mammary gland copper transport is stimulated by prolactin through alterations in Ctr1 and Atp7A localization.
Kelleher SL and Lonnerdal B, Am J Physiol Regul Integr Comp Physiol. 2006 Oct;291(4):R1181-91. Epub 2006 Jun 1.
12.
Marginal maternal Zn intake in rats alters mammary gland Cu transporter levels and milk Cu concentration and affects neonatal Cu metabolism.
Kelleher SL and Lonnerdal B, J Nutr. 2003 Jul;133(7):2141-8.
13.
Maturational arrest of thymocyte development is caused by a deletion in the receptor-like protein tyrosine phosphatase kappa gene in LEC rats.
Kose H, etal., Genomics. 2007 Jun;89(6):673-7. doi: 10.1016/j.ygeno.2007.03.001. Epub 2007 Apr 16.
14.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
15.
Abnormal hepatobiliary and circulating lipid metabolism in the Long-Evans Cinnamon rat model of Wilson's disease.
Levy E, etal., Life Sci. 2007 Mar 27;80(16):1472-83. Epub 2007 Jan 20.
16.
Spontaneous hepatic copper accumulation in Long-Evans Cinnamon rats with hereditary hepatitis. A model of Wilson's disease.
Li Y, etal., J Clin Invest. 1991 May;87(5):1858-61. doi: 10.1172/JCI115208.
17.
Hereditary hepatitis of LEC rats is controlled by a single autosomal recessive gene.
Masuda R, etal., Lab Anim. 1988 Apr;22(2):166-9. doi: 10.1258/002367788780864402.
18.
Restoration of copper metabolism and rescue of hepatic abnormalities in LEC rats, an animal model of Wilson disease, by expression of human ATP7B gene.
Meng Y, etal., Biochim Biophys Acta 2004 Nov 5;1690(3):208-19.
19.
Lentiviral gene transfer ameliorates disease progression in Long-Evans cinnamon rats: an animal model for Wilson disease.
Merle U, etal., Scand J Gastroenterol. 2006 Aug;41(8):974-82. doi: 10.1080/00365520600554790.
20.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
21.
Role of Atp7b gene in spontaneous and N-diethylnitrosamine-induced carcinogenesis in a new congenic strain, WKAH.C-Atp7b rats.
Minami T, etal., Jpn J Cancer Res 2001 Aug;92(8):841-7.
22.
The LEC rat: a model for human hepatitis, liver cancer, and much more.
Mori M, etal., Am J Pathol. 1994 Jan;144(1):200-4.
23.
Copper-transporting P-type adenosine triphosphatase (ATP7B) as a cisplatin based chemoresistance marker in ovarian carcinoma: comparative analysis with expression of MDR1, MRP1, MRP2, LRP and BCRP.
Nakayama K, etal., Int J Cancer. 2002 Oct 10;101(5):488-95.
24.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
25.
Inherited copper toxicity in Long-Evans cinnamon rats exhibiting spontaneous hepatitis: a model of Wilson's disease.
Okayasu T, etal., Pediatr Res. 1992 Mar;31(3):253-7. doi: 10.1203/00006450-199203000-00011.
26.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
27.
Ceruloplasmin gene expression profile changes in the rat mammary gland during pregnancy, lactation and involution.
Platonova NA, etal., J Trace Elem Med Biol. 2017 Sep;43:126-134. doi: 10.1016/j.jtemb.2016.12.013. Epub 2017 Jan 3.
28.
GOA pipeline
RGD automated data pipeline
29.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
30.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
31.
Subcellular targets of cisplatin cytotoxicity: an integrated view.
Sancho-Martinez SM, etal., Pharmacol Ther. 2012 Oct;136(1):35-55. doi: 10.1016/j.pharmthera.2012.07.003. Epub 2012 Jul 14.
32.
The gene responsible for LEC hepatitis, located on rat chromosome 16, is the homolog to the human Wilson disease gene.
Sasaki N, etal., Biochem Biophys Res Commun 1994 Jul 15;202(1):512-8.
33.
Evolution of exchangeable copper and relative exchangeable copper through the course of Wilson's disease in the Long Evans Cinnamon rat.
Schmitt F, etal., PLoS One. 2013 Dec 17;8(12):e82323. doi: 10.1371/journal.pone.0082323. eCollection 2013.
34.
Genetics of Wilson disease and Wilson-like phenotype in a clinical series from eastern Spain.
Sánchez-Monteagudo A, etal., Clin Genet. 2020 Feb 11. doi: 10.1111/cge.13719.
35.
Identification of the "missing domain" of the rat copper-transporting ATPase, atp7b: insight into the structural and metal binding characteristics of its N-terminal copper-binding domain.
Tsay MJ, etal., Biochim Biophys Acta. 2004 Jan 20;1688(1):78-85.
36.
The LEC rat has a deletion in the copper transporting ATPase gene homologous to the Wilson disease gene.
Wu J, etal., Nat Genet 1994 Aug;7(4):541-5.
37.
Expression of the Wilson disease gene is deficient in the Long-Evans Cinnamon rat.
Yamaguchi Y, etal., Biochem J 1994 Jul 1;301 ( Pt 1):1-4.
38.
New mutation causing hereditary hepatitis in the laboratory rat.
Yoshida MC, etal., J Hered 1987 Nov-Dec;78(6):361-5.
Atp7b Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 76,654,725 - 76,726,092 (+) NCBI GRCr8 mRatBN7.2 16 69,952,286 - 70,024,404 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 69,951,778 - 70,023,636 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 75,225,956 - 75,297,317 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 78,664,533 - 78,736,202 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 73,913,825 - 73,985,530 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 74,865,516 - 74,944,935 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 74,865,516 - 74,945,286 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 74,495,179 - 74,575,822 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 74,607,988 - 74,680,080 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 74,608,239 - 74,679,614 (+) NCBI Celera 16 67,837,288 - 67,908,140 (+) NCBI Celera RH 3.4 Map 16 664.21 RGD Cytogenetic Map 16 q12.5 NCBI
ATP7B Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 13 51,932,669 - 52,012,132 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 13 51,930,436 - 52,012,125 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 13 52,506,805 - 52,586,268 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 13 51,404,806 - 51,483,631 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 13 51,404,805 - 51,483,631 NCBI Celera 13 33,555,444 - 33,634,269 (-) NCBI Celera Cytogenetic Map 13 q14.3 NCBI HuRef 13 33,295,317 - 33,374,147 (-) NCBI HuRef CHM1_1 13 52,473,433 - 52,553,190 (-) NCBI CHM1_1 T2T-CHM13v2.0 13 51,147,339 - 51,226,948 (-) NCBI T2T-CHM13v2.0
Atp7b Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 22,482,799 - 22,550,347 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 22,482,801 - 22,550,321 (-) Ensembl GRCm39 Ensembl GRCm38 8 21,992,783 - 22,060,074 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 21,992,785 - 22,060,305 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 23,104,820 - 23,170,546 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 23,459,893 - 23,525,619 (-) NCBI MGSCv36 mm8 Celera 8 23,490,671 - 23,556,555 (-) NCBI Celera Cytogenetic Map 8 A2 NCBI cM Map 8 10.78 NCBI
Atp7b Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955431 5,229,126 - 5,269,616 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955431 5,228,395 - 5,297,120 (-) NCBI ChiLan1.0 ChiLan1.0
ATP7B Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 14 53,366,970 - 53,447,808 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 13 52,012,774 - 52,091,309 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 13 33,063,698 - 33,144,528 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 13 51,808,491 - 51,888,488 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 13 51,810,555 - 51,851,839 (-) Ensembl panpan1.1 panPan2
ATP7B Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 22 162,474 - 225,599 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 22 191,888 - 225,266 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 22 227,530 - 260,908 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 22 144,381 - 208,578 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 22 163,718 - 208,552 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 22 95,838 - 129,431 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 22 145,387 - 179,042 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 22 163,429 - 197,022 (+) NCBI UU_Cfam_GSD_1.0
Atp7b Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 161,210,231 - 161,278,988 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936565 4,694,281 - 4,763,773 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936565 4,694,294 - 4,763,661 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
ATP7B Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 11 15,876,612 - 15,942,064 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 11 15,892,549 - 15,942,070 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 11 16,218,277 - 16,263,614 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
ATP7B Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 3 29,817,712 - 29,899,302 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 3 29,816,860 - 29,899,077 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666057 13,915,907 - 13,997,411 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Atp7b
.
Predicted Target Of
Count of predictions: 356 Count of miRNA genes: 198 Interacting mature miRNAs: 229 Transcripts: ENSRNOT00000058072 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
2300163 Bmd64 Bone mineral density QTL 64 5.3 0.0001 lumbar vertebra mineral mass (VT:0010511) volumetric bone mineral density (CMO:0001553) 16 37752156 82752156 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70215 Niddm29 Non-insulin dependent diabetes mellitus QTL 29 3.54 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 16 19004435 75226532 Rat 1578768 Stresp22 Stress response QTL 22 2.8 thymus mass (VT:0004954) thymus wet weight (CMO:0000855) 16 35288870 80288870 Rat 7205510 Activ5 Activity QTL 5 3.78 0.00028 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 42396345 84729064 Rat 631525 Pia14 Pristane induced arthritis QTL 14 4.4 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 16 55711087 83402471 Rat 1298527 Arunc2 Aerobic running capacity QTL 2 2.9 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 68532716 75029966 Rat 7411648 Foco22 Food consumption QTL 22 15 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 52726464 84729064 Rat 6903294 Stl30 Serum triglyceride level QTL 30 2.6 0.0013 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 16 25152793 70152793 Rat 2293690 Bss45 Bone structure and strength QTL 45 5.13 0.0001 lumbar vertebra morphology trait (VT:0010494) lumbar vertebra cortical cross-sectional area (CMO:0001690) 16 37752156 82752156 Rat 8694364 Abfw7 Abdominal fat weight QTL 7 12.22 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 16 52726464 84729064 Rat 8694429 Bw164 Body weight QTL 164 5 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 16 52726464 84729064 Rat 70205 Gcr3 Gastric cancer resistance QTL 3 2.3 stomach morphology trait (VT:0000470) stomach tumor diameter (CMO:0001889) 16 17696791 82635055 Rat
RH94694
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 70,022,578 - 70,022,768 (+) MAPPER mRatBN7.2 Rnor_6.0 16 74,943,878 - 74,944,067 NCBI Rnor6.0 Rnor_5.0 16 74,573,744 - 74,573,933 UniSTS Rnor5.0 RGSC_v3.4 16 74,679,023 - 74,679,212 UniSTS RGSC3.4 Celera 16 67,907,083 - 67,907,272 UniSTS RH 3.4 Map 16 664.21 UniSTS Cytogenetic Map 16 q12.2-q12.4 UniSTS
Atp7b
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 16 69,987,114 - 69,987,972 (+) MAPPER mRatBN7.2 Rnor_6.0 16 74,906,171 - 74,907,028 NCBI Rnor6.0 Rnor_5.0 16 74,535,834 - 74,536,691 UniSTS Rnor5.0 RGSC_v3.4 16 74,643,520 - 74,644,377 UniSTS RGSC3.4 Celera 16 67,872,111 - 67,872,968 UniSTS Cytogenetic Map 16 q12.2-q12.4 UniSTS
This gene Atp7b is modified in the following models/strains:
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
49
113
91
90
59
25
59
6
216
95
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000058072 ⟹ ENSRNOP00000054880
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 69,986,513 - 70,023,636 (+) Ensembl Rnor_6.0 Ensembl 16 74,865,516 - 74,944,935 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000089265 ⟹ ENSRNOP00000069905
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 69,973,188 - 70,023,636 (+) Ensembl Rnor_6.0 Ensembl 16 74,886,719 - 74,945,286 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000109904 ⟹ ENSRNOP00000094594
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 69,951,778 - 70,023,636 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000118838 ⟹ ENSRNOP00000086033
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 69,952,286 - 70,023,636 (+) Ensembl
RefSeq Acc Id:
NM_012511 ⟹ NP_036643
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 76,654,725 - 76,726,092 (+) NCBI mRatBN7.2 16 69,952,286 - 70,023,636 (+) NCBI Rnor_6.0 16 74,865,516 - 74,944,935 (+) NCBI Rnor_5.0 16 74,495,179 - 74,575,822 (+) NCBI RGSC_v3.4 16 74,607,988 - 74,680,080 (+) RGD Celera 16 67,837,288 - 67,908,140 (+) RGD
Sequence:
GACAATGCCTGAACAGGAGAGAAAGGTCACAGCCAAAGAGGCCAGTCGGAAAATCTTATCTAAACTTGCTTTGCCCACACGACCGTGGGGACAATCAATGAAGCAGAGCTTCGCCTTCGATAATGTTG
hide sequence
RefSeq Acc Id:
XM_017599991 ⟹ XP_017455480
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 76,675,876 - 76,726,091 (+) NCBI mRatBN7.2 16 69,972,856 - 70,024,404 (+) NCBI Rnor_6.0 16 74,886,737 - 74,944,934 (+) NCBI
Sequence:
TGTGCCTGTCTCTGCCTGTTAGGTGGAACAGCAGGTAGCCGGAGAGGCCTGAGTTATGGATTAG
hide sequence
RefSeq Acc Id:
XM_039094191 ⟹ XP_038950119
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 76,699,248 - 76,726,091 (+) NCBI mRatBN7.2 16 69,996,812 - 70,023,295 (+) NCBI
RefSeq Acc Id:
NP_036643 ⟸ NM_012511
- UniProtKB:
Q9JLY3 (UniProtKB/Swiss-Prot), Q64535 (UniProtKB/Swiss-Prot), Q63676 (UniProtKB/Swiss-Prot), Q9QUG4 (UniProtKB/TrEMBL)
- Sequence:
MPEQERKVTAKEASRKILSKLALPTRPWGQSMKQSFAFDNVGYEGGLDSTCSSSTTTGVVSILGMTCHSCVKSIEDRISSLKGIVSIKVSLEQGSATVKYVPSVLNLQQICLQIEDMGFEASAAEGKA
hide sequence
RefSeq Acc Id:
XP_017455480 ⟸ XM_017599991
- Peptide Label:
isoform X1
- UniProtKB:
A0A0G2JWJ5 (UniProtKB/TrEMBL), F7FE99 (UniProtKB/TrEMBL)
- Sequence:
MEKAQGKMHQTPEQSFLASLSNPQVTLLSVQKRCTFRRSSGLGSLARSDSSDEKDPPQPEEESS
hide sequence
Ensembl Acc Id:
ENSRNOP00000054880 ⟸ ENSRNOT00000058072
Ensembl Acc Id:
ENSRNOP00000069905 ⟸ ENSRNOT00000089265
RefSeq Acc Id:
XP_038950119 ⟸ XM_039094191
- Peptide Label:
isoform X2
Ensembl Acc Id:
ENSRNOP00000094594 ⟸ ENSRNOT00000109904
Ensembl Acc Id:
ENSRNOP00000086033 ⟸ ENSRNOT00000118838
RGD ID: 13700195 Promoter ID: EPDNEW_R10719 Type: initiation region Name: Atp7b_1 Description: ATPase copper transporting beta SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 74,865,497 - 74,865,557 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-17
Atp7b
ATPase copper transporting beta
Atp7b
ATPase, Cu++ transporting, beta polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-11-06
Atp7b
ATPase, Cu++ transporting, beta polypeptide
ATPase, Cu++ transporting, beta polypeptide (same as Wilson disease)
Name updated
625702 APPROVED
2002-06-10
Atp7b
ATPase, Cu++ transporting, beta polypeptide (same as Wilson disease)
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_disease
deletion of 900 bp of the coding region at the 3' end results in the rat model for Wilson disease
631728
gene_function
copper transport ATPase
631728
gene_process
necessary component of copper transport pathway
631728
