Symbol:
Depp1
Name:
DEPP1 autophagy regulator
RGD ID:
1623004
MGI Page
MGI
Description:
Predicted to be involved in regulation of autophagy. Located in mitochondrion. Is expressed in endothelium of renal artery and metanephros. Orthologous to human DEPP1 (DEPP autophagy regulator 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
8430408G22Rik; De; decidual protein induced by progesterone; Depp; fat-specific expressed; fat-specific-expressed gene protein; Fseg; MGC6835; RIKEN cDNA 8430408G22 gene
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DEPP1 (DEPP autophagy regulator 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB
Rattus norvegicus (Norway rat):
Depp1 (DEPP autophagy regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Depp1 (DEPP autophagy regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DEPP1 (DEPP autophagy regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DEPP1 (DEPP autophagy regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Depp1 (DEPP autophagy regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DEPP1 (DEPP autophagy regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DEPP1 (DEPP autophagy regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Depp1 (DEPP autophagy regulator 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
DEPP1 (DEPP autophagy regulator 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Depp1 (DEPP autophagy regulator 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
si:dkeyp-72g9.4
Alliance
DIOPT (Ensembl Compara|PANTHER)
Danio rerio (zebrafish):
si:ch73-6k14.2
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 116,627,645 - 116,629,808 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 116,627,570 - 116,629,755 (+) Ensembl GRCm39 Ensembl GRCm38 6 116,650,684 - 116,652,847 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 116,650,609 - 116,652,794 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 116,600,702 - 116,602,865 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 116,616,318 - 116,618,413 (+) NCBI MGSCv36 mm8 Celera 6 118,491,933 - 118,494,097 (+) NCBI Celera Cytogenetic Map 6 E3 NCBI cM Map 6 53.83 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Depp1 Mouse (+)-schisandrin B multiple interactions ISO Depp1 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DEPP1 mRNA] CTD PMID:31150632 Depp1 Mouse 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine increases expression ISO DEPP1 (Homo sapiens) 6480464 chlorcyclizine results in increased expression of DEPP1 mRNA CTD PMID:15342952 Depp1 Mouse 1-naphthyl isothiocyanate increases expression ISO DEPP1 (Homo sapiens) 6480464 1-Naphthylisothiocyanate results in increased expression of DEPP1 mRNA CTD PMID:17175557 Depp1 Mouse 1-naphthyl isothiocyanate decreases expression ISO Depp1 (Rattus norvegicus) 6480464 1-Naphthylisothiocyanate results in decreased expression of DEPP1 mRNA CTD PMID:30723492 Depp1 Mouse 17beta-estradiol increases expression ISO DEPP1 (Homo sapiens) 6480464 Estradiol results in increased expression of DEPP1 mRNA CTD PMID:16298037 and PMID:18191855 Depp1 Mouse 17beta-estradiol decreases expression ISO DEPP1 (Homo sapiens) 6480464 Estradiol results in decreased expression of DEPP1 mRNA CTD PMID:31614463 Depp1 Mouse 17beta-estradiol decreases expression ISO Depp1 (Rattus norvegicus) 6480464 Estradiol results in decreased expression of DEPP1 mRNA CTD PMID:32145629 Depp1 Mouse 2,2',4,4'-Tetrabromodiphenyl ether decreases expression ISO Depp1 (Rattus norvegicus) 6480464 2 more ... CTD PMID:31826744 Depp1 Mouse 2,2',5,5'-tetrachlorobiphenyl decreases expression ISO DEPP1 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Depp1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO DEPP1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DEPP1 mRNA CTD PMID:21632981 Depp1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Depp1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DEPP1 mRNA CTD PMID:33387578 Depp1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO DEPP1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of DEPP1 mRNA CTD PMID:26238291 Depp1 Mouse 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression EXP 6480464 2 more ... CTD PMID:38648751 Depp1 Mouse 2-hydroxypropanoic acid increases expression ISO DEPP1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of DEPP1 mRNA CTD PMID:30851411 Depp1 Mouse 3-chloropropane-1,2-diol multiple interactions EXP 6480464 [alpha-Chlorohydrin co-treated with glycidol] results in increased expression of DEPP1 mRNA CTD PMID:33187795 Depp1 Mouse 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of DEPP1 mRNA more ... CTD PMID:28628672 Depp1 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of DEPP1 mRNA CTD PMID:30951980 Depp1 Mouse 4,4'-sulfonyldiphenol decreases expression EXP 6480464 bisphenol S results in decreased expression of DEPP1 mRNA CTD PMID:33297965 and PMID:39298647 Depp1 Mouse 4,4'-sulfonyldiphenol multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol S] results in increased expression of DEPP1 mRNA CTD PMID:28628672 Depp1 Mouse 4-hydroxyphenyl retinamide increases expression ISO DEPP1 (Homo sapiens) 6480464 Fenretinide results in increased expression of DEPP1 mRNA CTD PMID:15958647 Depp1 Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of DEPP1 mRNA CTD PMID:28973697 Depp1 Mouse 5-aza-2'-deoxycytidine affects expression ISO DEPP1 (Homo sapiens) 6480464 Decitabine affects the expression of DEPP1 mRNA CTD PMID:23300844 Depp1 Mouse 6-propyl-2-thiouracil decreases expression ISO Depp1 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of DEPP1 mRNA CTD PMID:25825206 Depp1 Mouse 6-propyl-2-thiouracil multiple interactions EXP 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of DEPP1 mRNA CTD PMID:36706583 Depp1 Mouse acetamide decreases expression ISO Depp1 (Rattus norvegicus) 6480464 acetamide results in decreased expression of DEPP1 mRNA CTD PMID:31881176 Depp1 Mouse acrylamide affects expression ISO Depp1 (Rattus norvegicus) 6480464 Acrylamide affects the expression of DEPP1 mRNA CTD PMID:28959563 Depp1 Mouse acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of DEPP1 mRNA CTD PMID:35032568 Depp1 Mouse aflatoxin B1 increases expression ISO DEPP1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of DEPP1 mRNA CTD PMID:21632981 and PMID:21641981 Depp1 Mouse aldehydo-D-glucose multiple interactions EXP 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in increased expression of DEPP1 mRNA CTD PMID:37567420 Depp1 Mouse all-trans-retinoic acid increases expression ISO DEPP1 (Homo sapiens) 6480464 Tretinoin results in increased expression of DEPP1 mRNA CTD PMID:23724009 Depp1 Mouse amiodarone increases expression ISO DEPP1 (Homo sapiens) 6480464 Amiodarone results in increased expression of DEPP1 mRNA CTD PMID:17175557 Depp1 Mouse amitriptyline increases expression ISO DEPP1 (Homo sapiens) 6480464 Amitriptyline results in increased expression of DEPP1 mRNA CTD PMID:15342952 more ... Depp1 Mouse Archazolid B increases expression ISO DEPP1 (Homo sapiens) 6480464 archazolid B results in increased expression of DEPP1 mRNA CTD PMID:25218289 Depp1 Mouse arsane increases expression ISO DEPP1 (Homo sapiens) 6480464 Arsenic results in increased expression of DEPP1 mRNA CTD PMID:38036231 Depp1 Mouse arsenic atom increases expression ISO DEPP1 (Homo sapiens) 6480464 Arsenic results in increased expression of DEPP1 mRNA CTD PMID:38036231 Depp1 Mouse atrazine decreases expression ISO Depp1 (Rattus norvegicus) 6480464 Atrazine results in decreased expression of DEPP1 mRNA CTD PMID:36841081 Depp1 Mouse benzo[a]pyrene affects expression ISO DEPP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the expression of DEPP1 mRNA CTD PMID:20106945 Depp1 Mouse benzo[a]pyrene increases methylation ISO DEPP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of DEPP1 promoter CTD PMID:27901495 Depp1 Mouse benzo[a]pyrene increases expression ISO DEPP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of DEPP1 mRNA CTD PMID:21632981 more ... Depp1 Mouse benzo[a]pyrene diol epoxide I increases expression ISO DEPP1 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Depp1 Mouse beta-naphthoflavone increases expression ISO DEPP1 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of DEPP1 mRNA CTD PMID:17175557 Depp1 Mouse bexarotene increases expression ISO DEPP1 (Homo sapiens) 6480464 bexarotene results in increased expression of DEPP1 mRNA CTD PMID:17178900 Depp1 Mouse bis(2-ethylhexyl) phthalate increases expression ISO Depp1 (Rattus norvegicus) 6480464 Diethylhexyl Phthalate results in increased expression of DEPP1 mRNA CTD PMID:36005737 Depp1 Mouse bisphenol A affects expression ISO Depp1 (Rattus norvegicus) 6480464 bisphenol A affects the expression of DEPP1 mRNA CTD PMID:25181051 and PMID:30903817 Depp1 Mouse bisphenol A decreases expression ISO Depp1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of DEPP1 mRNA CTD PMID:32145629 more ... Depp1 Mouse bisphenol A multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of DEPP1 mRNA CTD PMID:28628672 Depp1 Mouse bisphenol A increases expression ISO DEPP1 (Homo sapiens) 6480464 bisphenol A results in increased expression of DEPP1 mRNA CTD PMID:29275510 Depp1 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of DEPP1 mRNA CTD PMID:30951980 and PMID:38685157 Depp1 Mouse bisphenol F multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of DEPP1 mRNA CTD PMID:28628672 Depp1 Mouse bromobenzene increases expression ISO Depp1 (Rattus norvegicus) 6480464 bromobenzene results in increased expression of DEPP1 mRNA CTD PMID:32479839 Depp1 Mouse butanal increases expression ISO DEPP1 (Homo sapiens) 6480464 butyraldehyde results in increased expression of DEPP1 mRNA CTD PMID:26079696 Depp1 Mouse cadmium dichloride decreases expression ISO DEPP1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of DEPP1 mRNA CTD PMID:38568856 Depp1 Mouse calcitriol increases expression ISO DEPP1 (Homo sapiens) 6480464 Calcitriol results in increased expression of DEPP1 mRNA CTD PMID:21592394 Depp1 Mouse calcitriol multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of DEPP1 mRNA CTD PMID:21592394 Depp1 Mouse capsaicin increases expression ISO DEPP1 (Homo sapiens) 6480464 Capsaicin results in increased expression of DEPP1 mRNA CTD PMID:36044967 Depp1 Mouse chlordecone increases expression EXP 6480464 Chlordecone results in increased expression of DEPP1 mRNA CTD PMID:33711761 Depp1 Mouse chlorpromazine increases expression ISO DEPP1 (Homo sapiens) 6480464 Chlorpromazine results in increased expression of DEPP1 mRNA CTD PMID:15342952 and PMID:17175557 Depp1 Mouse chlorpyrifos increases expression EXP 6480464 Chlorpyrifos results in increased expression of DEPP1 mRNA CTD PMID:37019170 Depp1 Mouse choline multiple interactions EXP 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of DEPP1 mRNA CTD PMID:33549593 Depp1 Mouse cisplatin affects expression ISO DEPP1 (Homo sapiens) 6480464 Cisplatin affects the expression of DEPP1 mRNA CTD PMID:23300844 Depp1 Mouse cisplatin multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in increased expression of DEPP1 mRNA CTD PMID:27392435 Depp1 Mouse clomipramine increases expression ISO DEPP1 (Homo sapiens) 6480464 Clomipramine results in increased expression of DEPP1 mRNA CTD PMID:15342952 and PMID:17175557 Depp1 Mouse clozapine increases expression ISO DEPP1 (Homo sapiens) 6480464 Clozapine results in increased expression of DEPP1 mRNA CTD PMID:15342952 and PMID:17175557 Depp1 Mouse copper atom increases expression ISO Depp1 (Rattus norvegicus) 6480464 Copper results in increased expression of DEPP1 mRNA CTD PMID:30556269 Depp1 Mouse copper(0) increases expression ISO Depp1 (Rattus norvegicus) 6480464 Copper results in increased expression of DEPP1 mRNA CTD PMID:30556269 Depp1 Mouse copper(II) chloride increases expression ISO DEPP1 (Homo sapiens) 6480464 cupric chloride results in increased expression of DEPP1 mRNA CTD PMID:38568856 Depp1 Mouse cyanocob(III)alamin multiple interactions EXP 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of DEPP1 mRNA CTD PMID:33549593 Depp1 Mouse cyclosporin A affects expression ISO DEPP1 (Homo sapiens) 6480464 Cyclosporine affects the expression of DEPP1 mRNA CTD PMID:20106945 Depp1 Mouse cyclosporin A decreases expression ISO DEPP1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of DEPP1 mRNA CTD PMID:25562108 Depp1 Mouse cyclosporin A increases expression ISO DEPP1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of DEPP1 mRNA CTD PMID:21632981 Depp1 Mouse cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of DEPP1 mRNA CTD PMID:29020013 Depp1 Mouse D-glucose multiple interactions EXP 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in increased expression of DEPP1 mRNA CTD PMID:37567420 Depp1 Mouse dexamethasone increases expression ISO DEPP1 (Homo sapiens) 6480464 Dexamethasone results in increased expression of DEPP1 mRNA CTD PMID:25047013 Depp1 Mouse dexamethasone multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of DEPP1 mRNA more ... CTD PMID:28628672 Depp1 Mouse dextran sulfate increases expression EXP 6480464 Dextran Sulfate results in increased expression of DEPP1 mRNA CTD PMID:35093514 Depp1 Mouse diazinon increases methylation ISO DEPP1 (Homo sapiens) 6480464 Diazinon results in increased methylation of DEPP1 gene CTD PMID:22964155 Depp1 Mouse dicrotophos increases expression ISO DEPP1 (Homo sapiens) 6480464 dicrotophos results in increased expression of DEPP1 mRNA CTD PMID:28302478 Depp1 Mouse diiodine multiple interactions EXP 6480464 [Propylthiouracil co-treated with Iodine deficiency] results in decreased expression of DEPP1 mRNA CTD PMID:36706583 Depp1 Mouse dimethyl sulfoxide affects expression ISO DEPP1 (Homo sapiens) 6480464 Dimethyl Sulfoxide affects the expression of DEPP1 mRNA CTD PMID:24834073 Depp1 Mouse dinophysistoxin 1 increases expression ISO DEPP1 (Homo sapiens) 6480464 dinophysistoxin 1 results in increased expression of DEPP1 mRNA CTD PMID:28939011 Depp1 Mouse diquat increases expression EXP 6480464 Diquat results in increased expression of DEPP1 mRNA CTD PMID:36851058 Depp1 Mouse dorsomorphin multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DEPP1 mRNA CTD PMID:27188386 Depp1 Mouse doxepin increases expression ISO DEPP1 (Homo sapiens) 6480464 Doxepin results in increased expression of DEPP1 mRNA CTD PMID:17567588 Depp1 Mouse endosulfan decreases expression ISO Depp1 (Rattus norvegicus) 6480464 Endosulfan results in decreased expression of DEPP1 mRNA CTD PMID:29391264 Depp1 Mouse epoxiconazole affects expression EXP 6480464 epoxiconazole affects the expression of DEPP1 mRNA CTD PMID:35436446 Depp1 Mouse erythromycin A increases expression ISO DEPP1 (Homo sapiens) 6480464 Erythromycin results in increased expression of DEPP1 mRNA CTD PMID:17175557 Depp1 Mouse flecainide increases expression ISO DEPP1 (Homo sapiens) 6480464 Flecainide results in increased expression of DEPP1 mRNA CTD PMID:15342952 and PMID:17175557 Depp1 Mouse fluoxetine increases expression ISO DEPP1 (Homo sapiens) 6480464 Fluoxetine results in increased expression of DEPP1 mRNA CTD PMID:15342952 more ... Depp1 Mouse folic acid multiple interactions EXP 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of DEPP1 mRNA CTD PMID:33549593 Depp1 Mouse formaldehyde increases expression ISO DEPP1 (Homo sapiens) 6480464 Formaldehyde results in increased expression of DEPP1 mRNA CTD PMID:23649840 Depp1 Mouse fructose multiple interactions EXP 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in increased expression of DEPP1 mRNA CTD PMID:37567420 Depp1 Mouse fulvestrant decreases expression ISO DEPP1 (Homo sapiens) 6480464 fulvestrant results in decreased expression of DEPP1 mRNA CTD PMID:16298037 Depp1 Mouse glucose multiple interactions EXP 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in increased expression of DEPP1 mRNA CTD PMID:37567420 Depp1 Mouse glycidol multiple interactions EXP 6480464 [alpha-Chlorohydrin co-treated with glycidol] results in increased expression of DEPP1 mRNA CTD PMID:33187795 Depp1 Mouse glycine betaine multiple interactions EXP 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of DEPP1 mRNA CTD PMID:33549593 Depp1 Mouse haloperidol increases expression ISO DEPP1 (Homo sapiens) 6480464 Haloperidol results in increased expression of DEPP1 mRNA CTD PMID:17175557 Depp1 Mouse herbicide multiple interactions EXP 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose co-treated with Herbicides] results in increased expression of DEPP1 mRNA CTD PMID:37567420 Depp1 Mouse hydrogen cyanide increases expression EXP 6480464 Hydrogen Cyanide results in increased expression of DEPP1 mRNA CTD PMID:33914522 Depp1 Mouse imipramine increases expression ISO DEPP1 (Homo sapiens) 6480464 Imipramine results in increased expression of DEPP1 mRNA CTD PMID:15342952 and PMID:17567588 Depp1 Mouse indometacin decreases expression ISO DEPP1 (Homo sapiens) 6480464 Indomethacin results in decreased expression of DEPP1 mRNA CTD PMID:17401462 Depp1 Mouse indometacin multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] results in increased expression of DEPP1 mRNA more ... CTD PMID:28628672 Depp1 Mouse inulin multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of DEPP1 mRNA CTD PMID:36331819 Depp1 Mouse isoniazide increases expression ISO DEPP1 (Homo sapiens) 6480464 Isoniazid results in increased expression of DEPP1 mRNA CTD PMID:17175557 Depp1 Mouse ketoconazole decreases expression ISO DEPP1 (Homo sapiens) 6480464 Ketoconazole results in decreased expression of DEPP1 mRNA CTD PMID:17175557 Depp1 Mouse ketoconazole increases expression ISO DEPP1 (Homo sapiens) 6480464 Ketoconazole results in increased expression of DEPP1 mRNA CTD PMID:15342952 and PMID:17175557 Depp1 Mouse L-methionine multiple interactions EXP 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of DEPP1 mRNA CTD PMID:33549593 Depp1 Mouse lead diacetate decreases expression ISO DEPP1 (Homo sapiens) 6480464 lead acetate results in decreased expression of DEPP1 mRNA CTD PMID:38568856 Depp1 Mouse lipopolysaccharide increases expression ISO DEPP1 (Homo sapiens) 6480464 Lipopolysaccharides results in increased expression of DEPP1 mRNA CTD PMID:35811015 Depp1 Mouse lipopolysaccharide multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of DEPP1 mRNA CTD PMID:35811015 Depp1 Mouse manganese(II) chloride increases expression ISO Depp1 (Rattus norvegicus) 6480464 manganese chloride results in increased expression of DEPP1 mRNA CTD PMID:28801915 Depp1 Mouse medroxyprogesterone acetate increases expression ISO DEPP1 (Homo sapiens) 6480464 Medroxyprogesterone Acetate results in increased expression of DEPP1 mRNA CTD PMID:20843944 Depp1 Mouse methamphetamine decreases expression EXP 6480464 Methamphetamine results in decreased expression of DEPP1 mRNA CTD PMID:36914120 Depp1 Mouse mifepristone multiple interactions ISO DEPP1 (Homo sapiens) 6480464 Mifepristone inhibits the reaction [Progesterone results in increased expression of DEPP1 mRNA] CTD PMID:16123073 Depp1 Mouse nickel sulfate increases expression ISO DEPP1 (Homo sapiens) 6480464 nickel sulfate results in increased expression of DEPP1 mRNA CTD PMID:16780908 and PMID:17382205 Depp1 Mouse nitrofen increases expression ISO Depp1 (Rattus norvegicus) 6480464 nitrofen results in increased expression of DEPP1 mRNA CTD PMID:33484710 Depp1 Mouse ofloxacin increases expression ISO DEPP1 (Homo sapiens) 6480464 Ofloxacin results in increased expression of DEPP1 mRNA CTD PMID:17175557 Depp1 Mouse p-anisidine increases expression ISO DEPP1 (Homo sapiens) 6480464 4-anisidine results in increased expression of DEPP1 mRNA CTD PMID:22623647 Depp1 Mouse paracetamol decreases expression ISO DEPP1 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of DEPP1 mRNA CTD PMID:17175557 and PMID:25704631 Depp1 Mouse pentamidine increases expression ISO DEPP1 (Homo sapiens) 6480464 Pentamidine results in increased expression of DEPP1 mRNA CTD PMID:15342952 Depp1 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of DEPP1 mRNA and [perfluorooctane sulfonic acid co-treated with Pectins] results in decreased expression of DEPP1 mRNA CTD PMID:36331819 Depp1 Mouse perfluorooctanoic acid decreases expression ISO DEPP1 (Homo sapiens) 6480464 perfluorooctanoic acid results in decreased expression of DEPP1 mRNA CTD PMID:36326898 Depp1 Mouse perhexiline increases expression ISO DEPP1 (Homo sapiens) 6480464 Perhexiline results in increased expression of DEPP1 mRNA CTD PMID:15342952 and PMID:17175557 Depp1 Mouse phenobarbital increases expression ISO DEPP1 (Homo sapiens) 6480464 Phenobarbital results in increased expression of DEPP1 mRNA CTD PMID:17175557 Depp1 Mouse phenylmercury acetate increases expression ISO DEPP1 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of DEPP1 mRNA CTD PMID:26272509 Depp1 Mouse phenylmercury acetate multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DEPP1 mRNA CTD PMID:27188386 Depp1 Mouse pioglitazone multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [pioglitazone co-treated with tert-Butylhydroperoxide] results in increased expression of DEPP1 mRNA and pioglitazone inhibits the reaction [tert-Butylhydroperoxide results in increased expression of DEPP1 mRNA] CTD PMID:20847119 Depp1 Mouse potassium cyanide increases expression EXP 6480464 Potassium Cyanide results in increased expression of DEPP1 mRNA CTD PMID:33914522 Depp1 Mouse progesterone multiple interactions ISO DEPP1 (Homo sapiens) 6480464 Mifepristone inhibits the reaction [Progesterone results in increased expression of DEPP1 mRNA] CTD PMID:16123073 Depp1 Mouse progesterone increases expression ISO DEPP1 (Homo sapiens) 6480464 Progesterone results in increased expression of DEPP1 mRNA CTD PMID:16123073 more ... Depp1 Mouse quercetin decreases expression ISO DEPP1 (Homo sapiens) 6480464 Quercetin results in decreased expression of DEPP1 mRNA CTD PMID:21632981 Depp1 Mouse quinidine increases expression ISO DEPP1 (Homo sapiens) 6480464 Quinidine results in increased expression of DEPP1 mRNA CTD PMID:17567588 Depp1 Mouse quinolin-8-ol increases expression ISO DEPP1 (Homo sapiens) 6480464 Oxyquinoline results in increased expression of DEPP1 mRNA CTD PMID:21632981 Depp1 Mouse rac-lactic acid increases expression ISO DEPP1 (Homo sapiens) 6480464 Lactic Acid results in increased expression of DEPP1 mRNA CTD PMID:30851411 Depp1 Mouse raloxifene decreases expression ISO DEPP1 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in decreased expression of DEPP1 mRNA CTD PMID:16298037 Depp1 Mouse rotenone increases expression ISO Depp1 (Rattus norvegicus) 6480464 Rotenone results in increased expression of DEPP1 mRNA CTD PMID:28374803 Depp1 Mouse S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO DEPP1 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of DEPP1 mRNA CTD PMID:33725128 Depp1 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of DEPP1 mRNA CTD PMID:35811015 Depp1 Mouse SB 431542 multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DEPP1 mRNA CTD PMID:27188386 Depp1 Mouse sertraline increases expression ISO DEPP1 (Homo sapiens) 6480464 Sertraline results in increased expression of DEPP1 mRNA CTD PMID:15342952 and PMID:17567588 Depp1 Mouse silicon dioxide increases expression ISO DEPP1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of DEPP1 mRNA CTD PMID:25895662 Depp1 Mouse silver atom decreases expression ISO DEPP1 (Homo sapiens) 6480464 Silver results in decreased expression of DEPP1 mRNA CTD PMID:26014281 Depp1 Mouse silver(0) decreases expression ISO DEPP1 (Homo sapiens) 6480464 Silver results in decreased expression of DEPP1 mRNA CTD PMID:26014281 Depp1 Mouse sotalol increases expression ISO DEPP1 (Homo sapiens) 6480464 Sotalol results in increased expression of DEPP1 mRNA CTD PMID:17175557 Depp1 Mouse sotorasib multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of DEPP1 mRNA CTD PMID:36139627 Depp1 Mouse sunitinib increases expression ISO DEPP1 (Homo sapiens) 6480464 Sunitinib results in increased expression of DEPP1 mRNA CTD PMID:31533062 Depp1 Mouse tamoxifen decreases expression ISO DEPP1 (Homo sapiens) 6480464 Tamoxifen results in decreased expression of DEPP1 mRNA CTD PMID:16298037 Depp1 Mouse tamoxifen increases expression ISO DEPP1 (Homo sapiens) 6480464 Tamoxifen results in increased expression of DEPP1 mRNA CTD PMID:15342952 and PMID:17175557 Depp1 Mouse temozolomide decreases expression ISO DEPP1 (Homo sapiens) 6480464 Temozolomide results in decreased expression of DEPP1 mRNA CTD PMID:31758290 Depp1 Mouse tert-butyl hydroperoxide multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [pioglitazone co-treated with tert-Butylhydroperoxide] results in increased expression of DEPP1 mRNA more ... CTD PMID:20847119 Depp1 Mouse tert-butyl hydroperoxide increases expression ISO DEPP1 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of DEPP1 mRNA CTD PMID:20847119 Depp1 Mouse testosterone multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [Testosterone co-treated with Calcitriol] results in increased expression of DEPP1 mRNA CTD PMID:21592394 Depp1 Mouse testosterone increases expression EXP 6480464 Testosterone deficiency results in increased expression of DEPP1 mRNA CTD PMID:33848595 Depp1 Mouse testosterone increases expression ISO DEPP1 (Homo sapiens) 6480464 Testosterone results in increased expression of DEPP1 mRNA CTD PMID:21592394 Depp1 Mouse tetrachloromethane decreases expression ISO Depp1 (Rattus norvegicus) 6480464 Carbon Tetrachloride results in decreased expression of DEPP1 mRNA CTD PMID:31150632 Depp1 Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of DEPP1 mRNA CTD PMID:31919559 Depp1 Mouse tetrachloromethane multiple interactions EXP 6480464 [PANX1 protein co-treated with Carbon Tetrachloride] affects the expression of DEPP1 mRNA CTD PMID:29987408 Depp1 Mouse tetrachloromethane multiple interactions ISO Depp1 (Rattus norvegicus) 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in decreased expression of DEPP1 mRNA] CTD PMID:31150632 Depp1 Mouse tetracycline increases expression ISO DEPP1 (Homo sapiens) 6480464 Tetracycline results in increased expression of DEPP1 mRNA CTD PMID:17175557 Depp1 Mouse thioacetamide decreases expression ISO Depp1 (Rattus norvegicus) 6480464 Thioacetamide results in decreased expression of DEPP1 mRNA CTD PMID:34492290 Depp1 Mouse thioridazine increases expression ISO DEPP1 (Homo sapiens) 6480464 Thioridazine results in increased expression of DEPP1 mRNA CTD PMID:15342952 and PMID:17175557 Depp1 Mouse thiram increases expression ISO DEPP1 (Homo sapiens) 6480464 Thiram results in increased expression of DEPP1 mRNA CTD PMID:38568856 Depp1 Mouse titanium dioxide affects expression ISO Depp1 (Rattus norvegicus) 6480464 titanium dioxide affects the expression of DEPP1 mRNA CTD PMID:30012374 Depp1 Mouse trametinib multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of DEPP1 mRNA CTD PMID:36139627 Depp1 Mouse triphenyl phosphate decreases expression ISO Depp1 (Rattus norvegicus) 6480464 triphenyl phosphate results in decreased expression of DEPP1 mRNA CTD PMID:30589522 Depp1 Mouse triphenyl phosphate affects expression ISO DEPP1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of DEPP1 mRNA CTD PMID:37042841 Depp1 Mouse Triptolide decreases expression EXP 6480464 triptolide results in decreased expression of DEPP1 mRNA CTD PMID:32835833 Depp1 Mouse troglitazone multiple interactions ISO DEPP1 (Homo sapiens) 6480464 [troglitazone co-treated with tert-Butylhydroperoxide] results in increased expression of DEPP1 mRNA and troglitazone inhibits the reaction [tert-Butylhydroperoxide results in increased expression of DEPP1 mRNA] CTD PMID:20847119 Depp1 Mouse troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of DEPP1 mRNA CTD PMID:28973697 Depp1 Mouse urethane increases expression ISO DEPP1 (Homo sapiens) 6480464 Urethane results in increased expression of DEPP1 mRNA CTD PMID:28818685 Depp1 Mouse valproic acid increases expression ISO DEPP1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of DEPP1 mRNA CTD PMID:17175557 and PMID:28001369 Depp1 Mouse valproic acid decreases expression ISO DEPP1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of DEPP1 mRNA CTD PMID:29154799 Depp1 Mouse zimeldine increases expression ISO DEPP1 (Homo sapiens) 6480464 Zimeldine results in increased expression of DEPP1 mRNA CTD PMID:15342952 and PMID:17175557 Depp1 Mouse zinc atom multiple interactions EXP 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of DEPP1 mRNA CTD PMID:33549593 Depp1 Mouse zinc(0) multiple interactions EXP 6480464 [Methionine co-treated with Choline co-treated with Folic Acid co-treated with Betaine co-treated with Vitamin B 12 co-treated with Zinc] results in decreased expression of DEPP1 mRNA CTD PMID:33549593 Depp1 Mouse zoledronic acid increases expression ISO DEPP1 (Homo sapiens) 6480464 zoledronic acid results in increased expression of DEPP1 mRNA CTD PMID:24714768
(+)-schisandrin B (ISO) 1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (ISO) 1-naphthyl isothiocyanate (ISO) 17beta-estradiol (ISO) 2,2',4,4'-Tetrabromodiphenyl ether (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP) 2-hydroxypropanoic acid (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (EXP,ISO) 4-hydroxyphenyl retinamide (EXP,ISO) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP,ISO) acetamide (ISO) acrylamide (EXP,ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (EXP) all-trans-retinoic acid (ISO) amiodarone (ISO) amitriptyline (ISO) Archazolid B (ISO) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-naphthoflavone (ISO) bexarotene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (ISO) bisphenol F (EXP,ISO) bromobenzene (ISO) butanal (ISO) cadmium dichloride (ISO) calcitriol (ISO) capsaicin (ISO) chlordecone (EXP) chlorpromazine (ISO) chlorpyrifos (EXP) choline (EXP) cisplatin (ISO) clomipramine (ISO) clozapine (ISO) copper atom (ISO) copper(0) (ISO) copper(II) chloride (ISO) cyanocob(III)alamin (EXP) cyclosporin A (ISO) cypermethrin (EXP) D-glucose (EXP) dexamethasone (ISO) dextran sulfate (EXP) diazinon (ISO) dicrotophos (ISO) diiodine (EXP) dimethyl sulfoxide (ISO) dinophysistoxin 1 (ISO) diquat (EXP) dorsomorphin (ISO) doxepin (ISO) endosulfan (ISO) epoxiconazole (EXP) erythromycin A (ISO) flecainide (ISO) fluoxetine (ISO) folic acid (EXP) formaldehyde (ISO) fructose (EXP) fulvestrant (ISO) glucose (EXP) glycidol (EXP) glycine betaine (EXP) haloperidol (ISO) herbicide (EXP) hydrogen cyanide (EXP) imipramine (ISO) indometacin (ISO) inulin (EXP) isoniazide (ISO) ketoconazole (ISO) L-methionine (EXP) lead diacetate (ISO) lipopolysaccharide (ISO) manganese(II) chloride (ISO) medroxyprogesterone acetate (ISO) methamphetamine (EXP) mifepristone (ISO) nickel sulfate (ISO) nitrofen (ISO) ofloxacin (ISO) p-anisidine (ISO) paracetamol (ISO) pentamidine (ISO) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (ISO) perhexiline (ISO) phenobarbital (ISO) phenylmercury acetate (ISO) pioglitazone (ISO) potassium cyanide (EXP) progesterone (ISO) quercetin (ISO) quinidine (ISO) quinolin-8-ol (ISO) rac-lactic acid (ISO) raloxifene (ISO) rotenone (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) SB 431542 (ISO) sertraline (ISO) silicon dioxide (ISO) silver atom (ISO) silver(0) (ISO) sotalol (ISO) sotorasib (ISO) sunitinib (ISO) tamoxifen (ISO) temozolomide (ISO) tert-butyl hydroperoxide (ISO) testosterone (EXP,ISO) tetrachloromethane (EXP,ISO) tetracycline (ISO) thioacetamide (ISO) thioridazine (ISO) thiram (ISO) titanium dioxide (ISO) trametinib (ISO) triphenyl phosphate (ISO) Triptolide (EXP) troglitazone (EXP,ISO) urethane (ISO) valproic acid (ISO) zimeldine (ISO) zinc atom (EXP) zinc(0) (EXP) zoledronic acid (ISO)
Depp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 6 116,627,645 - 116,629,808 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 6 116,627,570 - 116,629,755 (+) Ensembl GRCm39 Ensembl GRCm38 6 116,650,684 - 116,652,847 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 6 116,650,609 - 116,652,794 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 6 116,600,702 - 116,602,865 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 6 116,616,318 - 116,618,413 (+) NCBI MGSCv36 mm8 Celera 6 118,491,933 - 118,494,097 (+) NCBI Celera Cytogenetic Map 6 E3 NCBI cM Map 6 53.83 NCBI
DEPP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 44,976,128 - 44,978,809 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 44,970,981 - 44,978,809 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 45,471,576 - 45,474,257 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 44,791,715 - 44,794,336 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 44,791,716 - 44,794,263 NCBI Celera 10 41,474,883 - 41,477,504 (-) NCBI Celera Cytogenetic Map 10 q11.21 NCBI HuRef 10 41,996,250 - 41,998,871 (-) NCBI HuRef CHM1_1 10 45,510,686 - 45,513,307 (-) NCBI CHM1_1 T2T-CHM13v2.0 10 45,857,092 - 45,859,773 (-) NCBI T2T-CHM13v2.0
Depp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 4 151,583,105 - 151,585,455 (+) NCBI GRCr8 mRatBN7.2 4 149,910,794 - 149,913,013 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 4 149,910,779 - 149,914,542 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 4 156,152,814 - 156,154,892 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 4 151,936,856 - 151,938,934 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 4 150,559,748 - 150,561,826 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 4 148,780,330 - 148,784,566 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 4 148,782,479 - 148,784,562 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 4 214,721,136 - 214,723,301 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 4 153,000,782 - 153,002,562 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 4 138,786,484 - 138,788,568 (+) NCBI Celera Cytogenetic Map 4 q42 NCBI
Depp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955546 2,291,829 - 2,293,375 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955546 2,291,829 - 2,293,375 (-) NCBI ChiLan1.0 ChiLan1.0
DEPP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 57,712,084 - 57,713,637 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 57,717,413 - 57,718,929 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 41,970,914 - 41,973,518 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 45,150,510 - 45,153,157 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 45,151,636 - 45,152,280 (-) Ensembl panpan1.1 panPan2
DEPP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 28 2,463,770 - 2,465,240 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 28 2,464,584 - 2,465,210 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 28 2,699,175 - 2,700,647 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 28 2,642,640 - 2,644,112 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 28 2,643,452 - 2,644,078 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 28 2,441,206 - 2,442,678 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 28 2,478,478 - 2,479,950 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 28 2,609,647 - 2,611,119 (+) NCBI UU_Cfam_GSD_1.0
Depp1 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024407213 82,041,955 - 82,043,912 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936617 4,740,103 - 4,740,741 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936617 4,740,073 - 4,743,610 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DEPP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 14 91,114,441 - 91,122,191 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 14 91,118,332 - 91,120,242 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 14 99,353,238 - 99,354,838 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DEPP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 40,602,193 - 40,603,791 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 40,602,223 - 40,602,861 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666056 45,800,538 - 45,802,078 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Depp1
.
Predicted Target Of
Count of predictions: 348 Count of miRNA genes: 156 Interacting mature miRNAs: 168 Transcripts: ENSMUST00000067354, ENSMUST00000178241 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
10043864 T2dm4sa_m type 2 diabetes mellitus 4 in SMXA RI mice (mouse) Not determined 6 83690851 146954059 Mouse 11252138 Clas1_m carcinogen-induced lung adenoma susceptibility 1 (mouse) 6 112246918 146954059 Mouse 8552704 Cia43_m collagen induced arthritis QTL 43 (mouse) Not determined 6 114159241 119737532 Mouse 1300887 Pabr1_m plasma apolipoprotein B (human) regulator 1 (mouse) Not determined 6 103754405 136400690 Mouse 1301915 Chab3_m cholesterol absorption 3 (mouse) Not determined 6 98908709 132916997 Mouse 1301083 Bhr5_m bronchial hyperresponsiveness 5 (mouse) Not determined 6 115694477 132578150 Mouse 1301658 Radpf3_m radiation pulmonary fibrosis 3 (mouse) Not determined 6 115219814 146330736 Mouse 10043923 Bhr7_m bronchial hyperresponsiveness 7 (mouse) Not determined 6 98219814 132219938 Mouse 4141940 W6q5_m weight 6 weeks QTL 5 (mouse) Not determined 96632912 146535124 Mouse 4140980 Mvwf2_m modifier of von Willebrand factor 2 (mouse) Not determined 114345693 145601739 Mouse 4142259 Tabw2_m tally ho associated body weight 2 (mouse) Not determined 46912919 136400690 Mouse 25314319 Histh6_m histamine hypersensitivity 6 (mouse) 6 48696934 125336963 Mouse 4141295 Rua_m raffinose acetate tasting (mouse) Not determined 115546805 149549364 Mouse 25314320 Histh5_m histamine hypersensitivity 5 (mouse) 6 48696934 148351498 Mouse 1301509 Sluc3_m susceptibility to lung cancer 3 (mouse) Not determined 6 104480321 127019938 Mouse 1301962 Eila2_m ethanol induced locomotor activity 2 (mouse) Not determined 6 48703490 125333748 Mouse 1301262 Gasa3_m gastritis type A susceptibility locus 3 (mouse) Not determined 6 88982366 122982564 Mouse 1301518 Bbaa5_m B.burgdorferi-associated arthritis 5 (mouse) Not determined 6 98483798 145881170 Mouse 11353842 Bmiq4_m body mass index QTL 4 (mouse) 6 92584287 146330736 Mouse 1302131 Bmd8_m bone mineral density 8 (mouse) Not determined 6 99132089 133132228 Mouse 10412157 Fl1n_m fatty liver 1 in NSY (mouse) Not determined 6 45290993 128811995 Mouse 11251720 Ewc4_m ethanol withdrawal and consumption 4 (mouse) 6 84099474 118099474 Mouse 1301744 Hdlq11_m HDL QTL 11 (mouse) Not determined 6 87480321 121480516 Mouse 25440480 Moaq2_m modifier of alien QTL 2 (mouse) 6 3050001 117476961 Mouse 26884414 Bzwq12_m bi-zygomatic width QTL 12, 16 week (mouse) 6 3400000 139076998 Mouse 1357555 Tesq2_m testis weight QTL 2 (mouse) Not determined 6 96632912 146535124 Mouse 10043891 Tilss4_m TNF-induced lethal shock susceptibility 3 (mouse) Not determined 6 112246918 125333748 Mouse 1301244 Ichs_m immediate cutaneous hypersensitivity QTL (mouse) Not determined 6 90772571 124772807 Mouse 4142416 Egq11_m early growth QTL 11 (mouse) Not determined 96632912 146535124 Mouse 1301923 Lith6_m lithogenic gene 6 (mouse) Not determined 6 98694477 132694676 Mouse 10412207 Cypr5_m cytokine production 5 (mouse) Not determined 6 110815180 144815323 Mouse 1300704 Cia3_m collagen induced arthritis QTL 3 (mouse) Not determined 6 96324286 130324483 Mouse 13463481 Mcvq14_m mean corpuscular volume QTL 14 (mouse) 6 111142448 145142541 Mouse 1301927 Etohcta6_m ethanol conditioned taste aversion 6 (mouse) Not determined 6 115578005 149578150 Mouse 4141194 Cyx_m cycloheximide tasting (mouse) Not determined 115546805 149549364 Mouse 1357806 Aaj3_m anxiety in A/J 3 (mouse) Not determined 6 104480321 136400690 Mouse 13506930 Recrq9_m recombination rate in male meiosis QTL 9 (mouse) 6 73476983 134676963 Mouse 4141699 Ibdq2_m inflammatory bowel disease QTL 2 (mouse) Not determined 105982366 120894102 Mouse 4141889 Qui_m quinine sensitivity, taste (mouse) Not determined 115546805 149549364 Mouse 4141376 Dbm1_m diabetes modifier 1 (mouse) Not determined 6 78606487 121092347 Mouse 1301292 Cfbw2_m cystic fibrosis body weight 2 (mouse) Not determined 6 94981612 128981699 Mouse 11040599 Lmr4b_m leishmaniasis resistance 4b (mouse) 6 96324286 130324483 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000067354 ⟹ ENSMUSP00000070203
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 116,627,570 - 116,629,755 (+) Ensembl GRCm38.p6 Ensembl 6 116,650,609 - 116,652,794 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000178241 ⟹ ENSMUSP00000136165
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 116,627,589 - 116,629,755 (+) Ensembl GRCm38.p6 Ensembl 6 116,650,628 - 116,652,794 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000204555 ⟹ ENSMUSP00000145125
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 6 116,627,657 - 116,628,870 (+) Ensembl GRCm38.p6 Ensembl 6 116,650,696 - 116,651,909 (+) Ensembl
RefSeq Acc Id:
NM_001166580 ⟹ NP_001160052
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 116,627,645 - 116,629,808 (+) NCBI GRCm38 6 116,650,684 - 116,652,847 (+) ENTREZGENE MGSCv37 6 116,600,702 - 116,602,865 (+) RGD Celera 6 118,491,933 - 118,494,097 (+) RGD cM Map 6 ENTREZGENE
Sequence:
AGACCGCACAGGGGAAGAAACCACAGCACATCGTCCTGACTGTCCTCTTCCCAGGGACCAAGAGCTAGAGACCCGGCTGTGACTGCCCGCCTCTGGGGCTTCCTTTAGAGGAGACAGTCTTTACCCAT
hide sequence
RefSeq Acc Id:
NM_145980 ⟹ NP_666092
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 6 116,627,645 - 116,629,808 (+) NCBI GRCm38 6 116,650,684 - 116,652,847 (+) ENTREZGENE MGSCv37 6 116,600,702 - 116,602,865 (+) RGD Celera 6 118,491,933 - 118,494,097 (+) RGD cM Map 6 ENTREZGENE
Sequence:
AGACCGCACAGGGGAAGAAACCACAGCACATCGTCCTGACTGTCCTCTTCCCAGGGACCAAGAG
hide sequence
RefSeq Acc Id:
NP_666092 ⟸ NM_145980
- UniProtKB:
Q8K2F3 (UniProtKB/Swiss-Prot), Q8BU66 (UniProtKB/Swiss-Prot)
- Sequence:
MRSRLLLPVPHLPTIREMSEELSHGAAGQEPPASPSLDDYVRCICQLAQPTSVLDKVTAQSRPNRPSRPAWTREKRRQAESPGDSSLCVSSLQPTLPSPGTDNPLDWLFGKSQGEQADGRGRPNRTGS
hide sequence
RefSeq Acc Id:
NP_001160052 ⟸ NM_001166580
- UniProtKB:
Q8BU66 (UniProtKB/Swiss-Prot), Q8K2F3 (UniProtKB/Swiss-Prot)
- Sequence:
MRSRLLLPVPHLPTIREMSEELSHGAAGQEPPASPSLDDYVRCICQLAQPTSVLDKVTAQSRPNRPSRPAWTREKRRQAESPGDSSLCVSSLQPTLPSPGTDNPLDWLFGKSQGEQADGRGRPNRTGS
hide sequence
Ensembl Acc Id:
ENSMUSP00000136165 ⟸ ENSMUST00000178241
Ensembl Acc Id:
ENSMUSP00000145125 ⟸ ENSMUST00000204555
Ensembl Acc Id:
ENSMUSP00000070203 ⟸ ENSMUST00000067354
RGD ID: 6838768 Promoter ID: MM_KWN:47305 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Kidney, Liver, Lung Transcripts: NM_001166580, NM_145980 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 6 116,599,946 - 116,600,797 (+) MPROMDB
RGD ID: 6847974 Promoter ID: MM_ACW:42463 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Liver, Lung Transcripts: 8430408G22RIK.BSEP07-UNSPLICED Position: Mouse Assembly Chr Position (strand) Source MGSCv36 6 116,601,681 - 116,602,181 (+) MPROMDB
RGD ID: 6890768 Promoter ID: EPDNEW_M8835 Type: multiple initiation site Name: 8430408G22Rik_1 Description: Mus musculus RIKEN cDNA 8430408G22 gene , transcript variant2, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 6 116,650,684 - 116,650,744 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-21
Depp1
DEPP1 autophagy regulator
8430408G22Rik
RIKEN cDNA 8430408G22 gene
Symbol and/or name change
5135510 APPROVED
2024-08-21
8430408G22Rik
RIKEN cDNA 8430408G22 gene
Depp1
DEPP1 autophagy regulator
Symbol and/or name change
5135510 APPROVED
2018-05-29
Depp1
DEPP1 autophagy regulator
8430408G22Rik
RIKEN cDNA 8430408G22 gene
Symbol and/or name change
5135510 APPROVED
