Symbol:
Ppp1r3d
Name:
protein phosphatase 1, regulatory subunit 3D
RGD ID:
1622963
MGI Page
MGI
Description:
Predicted to enable glycogen binding activity and protein phosphatase 1 binding activity. Predicted to contribute to phosphoprotein phosphatase activity. Predicted to be involved in regulation of glycogen biosynthetic process and regulation of glycogen catabolic process. Predicted to be located in glycogen granule. Predicted to be part of protein phosphatase type 1 complex. Orthologous to human PPP1R3D (protein phosphatase 1 regulatory subunit 3D).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
2610024M03Rik; Gm359; protein phosphatase 1 regulatory subunit 3D
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PPP1R3D (protein phosphatase 1 regulatory subunit 3D) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Rattus norvegicus (Norway rat):
Ppp1r3d (protein phosphatase 1, regulatory subunit 3D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ppp1r3d (protein phosphatase 1 regulatory subunit 3D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PPP1R3D (protein phosphatase 1 regulatory subunit 3D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PPP1R3D (protein phosphatase 1 regulatory subunit 3D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ppp1r3d (protein phosphatase 1 regulatory subunit 3D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PPP1R3D (protein phosphatase 1 regulatory subunit 3D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PPP1R3D (protein phosphatase 1 regulatory subunit 3D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ppp1r3d (protein phosphatase 1 regulatory subunit 3D) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PPP1R3D (protein phosphatase 1 regulatory subunit 3D)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Rattus norvegicus (Norway rat):
Ppp1r3d (protein phosphatase 1, regulatory subunit 3D)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ppp1r3da (protein phosphatase 1, regulatory subunit 3Da)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Danio rerio (zebrafish):
ppp1r3db (protein phosphatase 1, regulatory subunit 3Db)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Saccharomyces cerevisiae (baker's yeast):
GAC1
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PANTHER)
Caenorhabditis elegans (roundworm):
CC8.2
Alliance
DIOPT (OMA|OrthoFinder|PANTHER)
Drosophila melanogaster (fruit fly):
Gbs-76A
Alliance
DIOPT (OrthoFinder|OrthoInspector|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
GIP2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Saccharomyces cerevisiae (baker's yeast):
PIG2
Alliance
DIOPT (Ensembl Compara|OrthoFinder|OrthoInspector|PANTHER)
Xenopus tropicalis (tropical clawed frog):
ppp1r3d
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 178,052,999 - 178,056,256 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 178,052,999 - 178,056,265 (-) Ensembl GRCm39 Ensembl GRCm38 2 178,411,206 - 178,414,463 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 178,411,206 - 178,414,472 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 178,145,911 - 178,149,177 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 178,340,614 - 178,343,929 (-) NCBI MGSCv36 mm8 Celera 2 182,497,614 - 182,500,880 (-) NCBI Celera Cytogenetic Map 2 H4 NCBI cM Map 2 99.91 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - KEGG (archival)
Ppp1r3d Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 178,052,999 - 178,056,256 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 178,052,999 - 178,056,265 (-) Ensembl GRCm39 Ensembl GRCm38 2 178,411,206 - 178,414,463 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 178,411,206 - 178,414,472 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 178,145,911 - 178,149,177 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 178,340,614 - 178,343,929 (-) NCBI MGSCv36 mm8 Celera 2 182,497,614 - 182,500,880 (-) NCBI Celera Cytogenetic Map 2 H4 NCBI cM Map 2 99.91 NCBI
PPP1R3D Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 20 59,936,663 - 59,940,305 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 20 59,936,663 - 59,940,305 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 20 58,511,718 - 58,515,360 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 20 57,945,282 - 57,948,747 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 20 57,945,282 - 57,948,747 NCBI Celera 20 55,252,565 - 55,256,030 (-) NCBI Celera Cytogenetic Map 20 q13.33 NCBI HuRef 20 55,299,100 - 55,302,565 (-) NCBI HuRef CHM1_1 20 58,412,949 - 58,416,414 (-) NCBI CHM1_1 T2T-CHM13v2.0 20 61,720,935 - 61,724,577 (-) NCBI T2T-CHM13v2.0
Ppp1r3d Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 3 185,880,087 - 185,883,158 (-) NCBI GRCr8 mRatBN7.2 3 165,502,384 - 165,505,455 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 3 165,502,384 - 165,505,455 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 3 169,876,489 - 169,879,560 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 3 178,835,577 - 178,838,648 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 3 175,501,947 - 175,505,018 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 3 173,950,613 - 173,953,684 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 3 173,950,613 - 173,953,684 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 3 183,137,515 - 183,140,586 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 3 167,505,678 - 167,508,749 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 3 167,056,456 - 167,059,527 (+) NCBI Celera Cytogenetic Map 3 q43 NCBI
Ppp1r3d Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 NW_004955528 3,804,557 - 3,807,309 (+) NCBI ChiLan1.0 ChiLan1.0
PPP1R3D Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 21 65,705,083 - 65,708,325 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 20 65,698,203 - 65,701,298 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 20 56,292,457 - 56,295,977 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 20 57,644,184 - 57,647,585 (-) NCBI panpan1.1 PanPan1.1 panPan2
PPP1R3D Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 24 44,550,028 - 44,551,556 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 24 44,550,320 - 44,551,219 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 24 43,794,436 - 43,795,617 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 24 45,416,651 - 45,417,832 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 24 45,416,933 - 45,417,832 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 24 44,518,184 - 44,519,364 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 24 44,637,780 - 44,638,960 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 24 45,297,767 - 45,298,948 (-) NCBI UU_Cfam_GSD_1.0
Ppp1r3d Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024408640 192,897,627 - 192,900,141 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936514 8,352,513 - 8,353,409 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936514 8,350,275 - 8,353,782 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PPP1R3D Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 17 59,964,585 - 59,967,113 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 17 59,963,560 - 59,967,143 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 17 67,406,676 - 67,409,825 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PPP1R3D Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 2 4,207,963 - 4,211,630 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 2 4,208,351 - 4,209,250 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666050 52,250,088 - 52,253,648 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ppp1r3d
.
Predicted Target Of
Count of predictions: 824 Count of miRNA genes: 475 Interacting mature miRNAs: 570 Transcripts: ENSMUST00000058678 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300688 Nidd2k_m Nidd2 on KK-A (mouse) Not determined 2 158078337 178442452 Mouse 1301783 Bhr1_m bronchial hyperresponsiveness 1 (mouse) Not determined 2 142593476 178442452 Mouse 12790983 Bwq12_m body weight QTL 12 (mouse) 2 148238204 181755017 Mouse 11038701 Ltpr2e_m Leishmania tropica response 2e (mouse) 2 150212221 181755017 Mouse 1301019 Bmd6_m bone mineral density 6 (mouse) Not determined 2 151778297 181755017 Mouse 4142450 Lmr16_m leishmaniasis resistance 16 (mouse) Not determined 2 150212221 181755017 Mouse 1301085 Lrnx10_m learning-contextual 10 (mouse) Not determined 2 150212221 181755017 Mouse 1300867 Lore2_m loss of righting induced by ethanol 2 (mouse) Not determined 2 144515861 180896594 Mouse 1558917 Gct8_m granulosa cell tumorigenesis 8 (mouse) Not determined 2 149236907 181755017 Mouse 1300806 Aod4_m autoimmune ovarian dysgenesis 4 (mouse) Not determined 2 145228719 179228841 Mouse 1300676 Prdt2_m prion disease incubation time 2 (mouse) Not determined 2 164515154 181755017 Mouse 1558991 Tailq4_m tail length QTL 4 (mouse) Not determined 2 162736926 178442452 Mouse 14747002 Mancz3_m mandible centroid size 3 (mouse) 2 152329820 181755017 Mouse 1300751 Bdt1_m bone density traits 1 (mouse) Not determined 2 149988902 181755017 Mouse 1300622 Cfld1_m cystic fibrosis lung disease 1 (mouse) Not determined 2 155823920 181755017 Mouse 12910811 Pwbwq3_m pre-weaning body weight QTL 3 (mouse) 2 169794802 178920791 Mouse 1302003 Sluc17_m susceptibility to lung cancer 17 (mouse) Not determined 2 162433493 181755017 Mouse 12738409 Lfibq1_m liver fibrosis QTL 1 (mouse) 2 167716420 179207088 Mouse 1302013 Tbbmd3_m total body bone mineral density 3 (mouse) Not determined 2 145196949 179197085 Mouse 5491196 Mobq6_m multigenic obesity QTL 6 (mouse) Not determined 2 85724269 180896594 Mouse 1357435 Epfq2_m epididymal fat pad weight QTL 2 (mouse) Not determined 2 162736926 178442452 Mouse 1357537 Lith12_m lithogenic gene 12 (mouse) Not determined 2 156196464 181755017 Mouse 1301348 Alcp5_m alcohol preference locus 5 (mouse) Not determined 2 163486407 181755017 Mouse 1301865 Hdlq19_m HDL QTL 19 (mouse) Not determined 2 145518775 179518926 Mouse 4142211 Nilac3_m nicotine induced locomotor activity 3 (mouse) Not determined 2 148664893 181755017 Mouse 1301677 Alcp6_m alcohol preference locus 6 (mouse) Not determined 2 163486407 181755017 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000058678 ⟹ ENSMUSP00000061402
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 2 178,052,999 - 178,056,265 (-) Ensembl GRCm38.p6 Ensembl 2 178,411,206 - 178,414,472 (-) Ensembl
RefSeq Acc Id:
NM_001085501 ⟹ NP_001078970
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 2 178,052,999 - 178,056,256 (-) NCBI GRCm38 2 178,411,206 - 178,414,463 (-) NCBI MGSCv37 2 178,145,911 - 178,149,177 (-) RGD Celera 2 182,497,614 - 182,500,871 (-) NCBI cM Map 2 ENTREZGENE
Sequence:
AGCGTCTGGGCGGCGGGGTTGCTGGCCTTCCCGTAAGAGCTCAGAGGAAGGAGAGAAGCGGCCGACACCGTGCAGGGCGCTACGCCCCGGGAAGCCGCCTTGGATAGCGCCACCCGCTGCTCGAGGCT
hide sequence
RefSeq Acc Id:
NP_001078970 ⟸ NM_001085501
- UniProtKB:
A2AJW4 (UniProtKB/TrEMBL)
- Sequence:
MSKGSGSAPLPSTPGSRKLVPRSLSCLSDMDRRPCRPPGCDPRLRPIIQRRSRSLPTSPERRAKAAGAPGAACGAGCNRQVRVRFADALGLELAQVKVFNAGDDPSVPLHVLSRLAINSDLCCSSQDL
hide sequence
Ensembl Acc Id:
ENSMUSP00000061402 ⟸ ENSMUST00000058678
RGD ID: 6832369 Promoter ID: MM_KWN:33488 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day4, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Lung, MEF_B4 Transcripts: NM_001085501, OTTMUST00000039325, OTTMUST00000039326 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 2 178,145,411 - 178,149,507 (+) MPROMDB
RGD ID: 6880018 Promoter ID: EPDNEW_M3460 Type: initiation region Name: Ppp1r3d_1 Description: Mus musculus protein phosphatase 1, regulatory subunit 3D , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 2 178,414,474 - 178,414,534 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-26
Ppp1r3d
protein phosphatase 1, regulatory subunit 3D
2610024M03Rik
RIKEN cDNA 2610024M03 gene
Symbol and/or name updated
27372883 PROVISIONAL
2024-08-21
2610024M03Rik
RIKEN cDNA 2610024M03 gene
Ppp1r3d
protein phosphatase 1, regulatory subunit 3D
Symbol and/or name change
5135510 APPROVED
