Hint1 (histidine triad nucleotide binding protein 1)

Advanced Search (OLGA)

Gene: Hint1 (histidine triad nucleotide binding protein 1) Rattus norvegicus

Analyze

Symbol:

Hint1 (Ensembl: AABR07060778.1)

Name:

histidine triad nucleotide binding protein 1 (Ensembl:histidine triad nucleotide binding protein 1, pseudo 1)

RGD ID:

1593411

Description:

Predicted to enable adenosine 5'-monophosphoramidase activity and deSUMOylase activity. Predicted to be involved in several processes, including intrinsic apoptotic signaling pathway by p53 class mediator; positive regulation of calcium-mediated signaling; and protein desumoylation. Predicted to be located in cytosol; nucleoplasm; and plasma membrane. Predicted to be part of histone deacetylase complex. Predicted to be active in cytoplasm and nucleus. Human ortholog(s) of this gene implicated in Gamstorp-Wohlfart syndrome. Orthologous to human HINT1 (histidine triad nucleotide binding protein 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

17 kDa inhibitor of protein kinase C; adenosine 5'-monophosphoramidase; adenosine 5'-monophosphoramidase HINT1; desumoylating isopeptidase HINT1; histidine triad nucleotide-binding protein 1; LOC690660; Pkci; PKCI-1; Prkci; protein kinase C inhibitor 1; protein kinase C, iota; protein kinase C-interacting protein 1; similar to Histidine triad nucleotide-binding protein 1 (Adenosine 5-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Related Pseudogenes:

Hint1-ps1

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	39,490,225 - 39,493,970 (+)	NCBI		GRCr8
mRatBN7.2	10	38,989,516 - 38,993,259 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	92,100,973 - 92,101,568 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	43,678,169 - 43,681,916 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	43,168,260 - 43,172,007 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	38,671,971 - 38,675,718 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	40,208,236 - 40,211,981 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	40,208,223 - 40,211,975 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	39,980,504 - 39,984,249 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	40,271,895 - 40,275,640 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	38,327,662 - 38,331,407 (+)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

axonal neuropathy (ISO)

Charcot-Marie-Tooth disease (ISO)

familial adenomatous polyposis 1 (ISO)

Gamstorp-Wohlfart syndrome (ISO)

genetic disease (ISO)

Hereditary Neoplastic Syndromes (ISO)

Inherited Peripheral Neuropathy (ISO)

muscular disease (ISO)

Neurodevelopmental Disorders (ISO)

neuropathy (ISO)

peripheral nervous system disease (ISO)

schizophrenia (ISO)

systemic primary carnitine deficiency disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

4,4'-diaminodiphenylmethane (ISO)

4-hydroxynon-2-enal (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

actinomycin D (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

amphetamine (ISO)

aniline (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzene (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

decabromodiphenyl ether (EXP)

deoxynivalenol (ISO)

diethylstilbestrol (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

fenthion (ISO)

folic acid (ISO)

hydralazine (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

lovastatin (ISO)

Mecamylamine (ISO)

methimazole (EXP)

morphine (ISO)

nicotine (ISO)

Nutlin-3 (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

pyrogallol (ISO)

rotenone (ISO)

sarin (EXP)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sulfadimethoxine (EXP)

sulfasalazine (ISO)

sulindac sulfone (ISO)

tamoxifen (ISO)

tanespimycin (ISO)

tetrachloromethane (ISO)

theophylline (ISO)

thiram (ISO)

triphenyl phosphate (ISO)

tris(2-butoxyethyl) phosphate (ISO)

tungsten (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vincristine (ISO)

warfarin (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

intrinsic apoptotic signaling pathway by p53 class mediator (ISO,ISS)

positive regulation of calcium-mediated signaling (ISO)

protein desumoylation (ISO,ISS)

proteolysis (IEA)

purine ribonucleotide catabolic process (IBA,ISO,ISS)

regulation of DNA-templated transcription (ISO,ISS)

Cellular Component

cytoplasm (IBA,ISO,ISS)

cytosol (ISO)

histone deacetylase complex (ISO,ISS)

nucleoplasm (ISO)

nucleus (IBA,ISO,ISS)

plasma membrane (ISO)

Molecular Function

adenosine 5'-monophosphoramidase activity (ISO,ISS)

deSUMOylase activity (ISO,ISS)

hydrolase activity (IBA,ISO,ISS)

nucleotide binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9770345	PMID:12477932	PMID:16835243	PMID:19056867	PMID:20458337	PMID:23376485	PMID:23576580	PMID:32357304

Genomics

Comparative Map Data

Hint1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	39,490,225 - 39,493,970 (+)	NCBI		GRCr8
mRatBN7.2	10	38,989,516 - 38,993,259 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	92,100,973 - 92,101,568 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	43,678,169 - 43,681,916 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	43,168,260 - 43,172,007 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	38,671,971 - 38,675,718 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	40,208,236 - 40,211,981 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	40,208,223 - 40,211,975 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	39,980,504 - 39,984,249 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	40,271,895 - 40,275,640 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	38,327,662 - 38,331,407 (+)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

HINT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	131,159,027 - 131,165,256 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	131,155,383 - 131,224,468 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	130,494,720 - 130,500,949 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	130,522,776 - 130,528,935 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	5	126,625,253 - 126,631,412 (-)	NCBI		Celera
Cytogenetic Map	5	q23.3	NCBI
HuRef	5	125,686,002 - 125,692,067 (-)	NCBI		HuRef
CHM1_1	5	129,927,969 - 129,934,034 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	131,678,018 - 131,684,247 (-)	NCBI		T2T-CHM13v2.0

Hint1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	54,757,209 - 54,761,332 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	54,757,209 - 54,761,327 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	54,866,383 - 54,870,506 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	54,866,383 - 54,870,501 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	54,679,940 - 54,683,998 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	54,709,861 - 54,713,919 (+)	NCBI		MGSCv36	mm8
Celera	11	59,453,774 - 59,457,833 (+)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	32.13	NCBI

Hint1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	2,674,109 - 2,678,528 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	2,673,950 - 2,678,528 (-)	NCBI	ChiLan1.0	ChiLan1.0

HINT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	126,483,128 - 126,489,392 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	124,622,692 - 124,628,778 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	126,587,934 - 126,594,032 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	132,755,766 - 132,761,823 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	132,755,766 - 132,761,823 (-)	Ensembl	panpan1.1		panPan2

HINT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	19,551,057 - 19,555,390 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	18,349,051 - 18,353,388 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	20,329,881 - 20,334,193 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	20,329,885 - 20,334,199 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	19,058,222 - 19,062,564 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	18,904,366 - 18,908,698 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	19,503,840 - 19,508,157 (-)	NCBI		UU_Cfam_GSD_1.0

Hint1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	116,840,774 - 116,846,653 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936647	3,843,544 - 3,849,428 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HINT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	133,467,151 - 133,475,454 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	133,469,765 - 133,475,813 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	138,701,204 - 138,705,746 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HINT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	34,019,009 - 34,025,006 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	34,014,501 - 34,025,323 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	43,941,290 - 43,947,437 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hint1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	40,896,588 - 40,902,828 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	40,896,566 - 40,902,835 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hint1
21 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	9
Count of miRNA genes:	9
Interacting mature miRNAs:	9
Transcripts:	ENSRNOT00000000772
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
61332	Eau3	Experimental allergic uveoretinitis QTL 3		0.004	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	34490559	45579777	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35392267	51793994	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

Markers in Region

RH137065

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	10	q22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

appendage

High

Medium

141

227

147

250

114

145

Low

Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC168732	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U09407	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000772 ⟹ ENSRNOP00000000772

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	10	40,208,223 - 40,211,975 (+)	Ensembl

RefSeq Acc Id:

NM_001109607 ⟹ NP_001103077

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	39,490,225 - 39,493,970 (+)	NCBI
mRatBN7.2	10	38,989,516 - 38,993,259 (+)	NCBI
Rnor_6.0	10	40,208,236 - 40,211,981 (+)	NCBI
Rnor_5.0	10	39,980,504 - 39,984,249 (+)	NCBI
RGSC_v3.4	10	40,271,895 - 40,275,640 (+)	RGD
Celera	10	38,327,662 - 38,331,407 (+)	RGD

Sequence:

show sequence

TCTCGCGGTTCCTCTCCCCACCGTGGCCGCGGCGCGGGAAGGACAGCGACCGGCCGCGATGGCT
GACGAGATTGCCAAGGCTCAAGTGGCCCAGCCCGGTGGCGACACGATCTTCGGCAAGATCATCC
GCAAAGAAATCCCGGCCAAGATCATTTTCGAGGACGATCGGTGTCTTGCTTTTCATGACATTTC
CCCTCAAGCACCAACACACTTTCTGGTGATACCCAAGAAGCACATATCCCAGATTTCTGTGGCA
GATGATGATGATGAAAGTCTTCTAGGACATTTAATGATTGTTGGCAAGAAATGTGCTGCGGATC
TGGGCCTGAAGCGCGGGTATCGGATGGTGGTGAATGAAGGTGCAGACGGGGGGCAGTCTGTCTA
TCATATTCACCTCCACGTCCTTGGAGGTCGGCAGATGAACTGGCCTCCTGGTTAAGCAGGTTGG
GGATAAGTATCCTTCTCTAGGTAGTTGGCAAGCTCCAGTAATTTCAATGGCACACATAGTTTTG
CCTGTGTATGGAGAGATTGAAGAGATCATTTAAAATTCTGTGCCTAATAAAAGATATTGTTGCA
CATCTCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001103077	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA18398	(Get FASTA)	NCBI Sequence Viewer
	AAI68732	(Get FASTA)	NCBI Sequence Viewer
	EDM04446	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000007437.1
	ENSRNOP00055041475
	ENSRNOP00060039880
	ENSRNOP00065006791
GenBank Protein	P62959	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001103077 ⟸ NM_001109607
- UniProtKB:	B5DEM9 (UniProtKB/Swiss-Prot), P62959 (UniProtKB/Swiss-Prot), D4A269 (UniProtKB/TrEMBL)
- Sequence:	show sequence MADEIAKAQVAQPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQIS VADDDDESLLGHLMIVGKKCAADLGLKRGYRMVVNEGADGGQSVYHIHLHVLGGRQMNWPPG hide sequence

Ensembl Acc Id:

ENSRNOP00000000772 ⟸ ENSRNOT00000000772

Protein Domains

HIT

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A269-F1-model_v2	AlphaFold	D4A269	1-126	view protein structure
AF-P62959-F1-model_v2	AlphaFold	P62959	1-126	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697191

Promoter ID:

EPDNEW_R7716

Type:

initiation region

Name:

Hint1_1

Description:

histidine triad nucleotide binding protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	40,208,223 - 40,208,283	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1593411	AgrOrtholog
BioCyc Gene	G2FUF-25098	BioCyc
Ensembl Genes	ENSRNOG00000000622	Ensembl
	ENSRNOG00000005630	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00055029100	UniProtKB/Swiss-Prot
	ENSRNOG00060027623	UniProtKB/Swiss-Prot
	ENSRNOG00065006211	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000007437.3	UniProtKB/TrEMBL
	ENSRNOT00055050389	UniProtKB/Swiss-Prot
	ENSRNOT00060047936	UniProtKB/Swiss-Prot
	ENSRNOT00065009476	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.428.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Histidine_triad_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Histidine_triad_HIT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HIT-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HIT-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:690660	UniProtKB/Swiss-Prot
NCBI Gene	690660	ENTREZGENE
PANTHER	HISTIDINE TRIAD NUCLEOTIDE-BINDING PROTEIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR23089	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	HIT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Hint1	PhenoGen
PRINTS	HISTRIAD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	HIT_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	HIT_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000000622	RatGTEx
	ENSRNOG00000005630	RatGTEx
	ENSRNOG00055029100	RatGTEx
	ENSRNOG00060027623	RatGTEx
	ENSRNOG00065006211	RatGTEx
Superfamily-SCOP	SSF54197	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	B5DEM9	ENTREZGENE
	D4A269	ENTREZGENE, UniProtKB/TrEMBL
	HINT1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	B5DEM9	UniProtKB/Swiss-Prot
	P16436	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-17	Hint1	histidine triad nucleotide binding protein 1	LOC690660	similar to Histidine triad nucleotide-binding protein 1 (Adenosine 5-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC690660	similar to Histidine triad nucleotide-binding protein 1 (Adenosine 5-monophosphoramidase) (Protein kinase C inhibitor 1) (Protein kinase C-interacting protein 1) (PKCI-1)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM