Symbol:
Mrpl12
Name:
mitochondrial ribosomal protein L12
RGD ID:
1588559
Description:
Predicted to enable mRNA binding activity. Predicted to be a structural constituent of ribosome. Predicted to be involved in mitochondrial transcription; positive regulation of DNA-templated transcription; and translation. Predicted to be located in mitochondrial matrix. Predicted to be part of mitochondrial large ribosomal subunit. Human ortholog(s) of this gene implicated in combined oxidative phosphorylation deficiency 45. Orthologous to human MRPL12 (mitochondrial ribosomal protein L12); INTERACTS WITH 17beta-estradiol; 2,4,6-trinitrotoluene; 2,4-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
39S ribosomal protein L12, mitochondrial; large ribosomal subunit protein bL12m; Mrpl12_mapped; ribosomal protein, mitochondrial, L12; ribosomal protein, mitochondrial, L12 (mapped); Rpm12
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 106,256,746 - 106,261,249 (+) NCBI GRCr8 mRatBN7.2 10 105,758,410 - 105,762,913 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 105,758,410 - 105,762,913 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 110,862,572 - 110,867,073 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 110,325,603 - 110,330,104 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 105,678,867 - 105,683,370 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 109,658,032 - 109,662,535 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 109,658,032 - 109,662,535 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 109,251,300 - 109,255,803 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 109,870,160 - 109,874,664 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 104,302,342 - 104,306,842 (+) NCBI Celera Cytogenetic Map 10 q32.3 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Mrpl12 Rat 1,2-dimethylhydrazine increases expression ISO Mrpl12 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of MRPL12 mRNA CTD PMID:22206623 Mrpl12 Rat 1,2-dimethylhydrazine multiple interactions ISO Mrpl12 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of MRPL12 mRNA] CTD PMID:22206623 Mrpl12 Rat 17alpha-ethynylestradiol increases expression ISO Mrpl12 (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of MRPL12 mRNA CTD PMID:17942748 Mrpl12 Rat 17alpha-ethynylestradiol multiple interactions ISO Mrpl12 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MRPL12 mRNA CTD PMID:17942748 Mrpl12 Rat 17beta-estradiol affects expression ISO Mrpl12 (Mus musculus) 6480464 Estradiol affects the expression of MRPL12 mRNA CTD PMID:15598610 Mrpl12 Rat 17beta-estradiol decreases expression EXP 6480464 Estradiol results in decreased expression of MRPL12 mRNA CTD PMID:32145629 Mrpl12 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Mrpl12 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of MRPL12 mRNA and Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to MRPL12 promoter] CTD PMID:17942748 and PMID:19654925 Mrpl12 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Mrpl12 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of MRPL12 mRNA CTD PMID:21570461 Mrpl12 Rat 2,4,6-trinitrotoluene affects expression EXP 6480464 Trinitrotoluene affects the expression of MRPL12 mRNA CTD PMID:21346803 Mrpl12 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of MRPL12 mRNA CTD PMID:21346803 Mrpl12 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of MRPL12 mRNA CTD PMID:21346803 Mrpl12 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of MRPL12 protein CTD PMID:34915118 Mrpl12 Rat 4,4'-sulfonyldiphenol increases expression ISO Mrpl12 (Mus musculus) 6480464 bisphenol S results in increased expression of MRPL12 mRNA CTD PMID:39298647 Mrpl12 Rat 4,4'-sulfonyldiphenol affects expression ISO MRPL12 (Homo sapiens) 6480464 bisphenol S affects the expression of MRPL12 protein CTD PMID:31945527 Mrpl12 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of MRPL12 mRNA CTD PMID:21346803 Mrpl12 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of MRPL12 mRNA CTD PMID:30047161 Mrpl12 Rat acrylamide decreases expression ISO MRPL12 (Homo sapiens) 6480464 Acrylamide results in decreased expression of MRPL12 mRNA CTD PMID:32763439 Mrpl12 Rat aflatoxin B1 decreases methylation ISO MRPL12 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of MRPL12 gene CTD PMID:27153756 Mrpl12 Rat aflatoxin B1 multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [Aflatoxin B1 co-treated with aflatoxin B2 co-treated with aflatoxin G1 co-treated with aflatoxin G2] results in decreased expression of MRPL12 mRNA and [Plant Extracts co-treated with Aflatoxin B1 co-treated with aflatoxin B2 co-treated with aflatoxin G1 co-treated with aflatoxin G2] results in decreased expression of MRPL12 mRNA CTD PMID:31904472 Mrpl12 Rat Aflatoxin B2 alpha multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [Aflatoxin B1 co-treated with aflatoxin B2 co-treated with aflatoxin G1 co-treated with aflatoxin G2] results in decreased expression of MRPL12 mRNA and [Plant Extracts co-treated with Aflatoxin B1 co-treated with aflatoxin B2 co-treated with aflatoxin G1 co-treated with aflatoxin G2] results in decreased expression of MRPL12 mRNA CTD PMID:31904472 Mrpl12 Rat Aflatoxin G1 multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [Aflatoxin B1 co-treated with aflatoxin B2 co-treated with aflatoxin G1 co-treated with aflatoxin G2] results in decreased expression of MRPL12 mRNA and [Plant Extracts co-treated with Aflatoxin B1 co-treated with aflatoxin B2 co-treated with aflatoxin G1 co-treated with aflatoxin G2] results in decreased expression of MRPL12 mRNA CTD PMID:31904472 Mrpl12 Rat Aflatoxin G2 multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [Aflatoxin B1 co-treated with aflatoxin B2 co-treated with aflatoxin G1 co-treated with aflatoxin G2] results in decreased expression of MRPL12 mRNA and [Plant Extracts co-treated with Aflatoxin B1 co-treated with aflatoxin B2 co-treated with aflatoxin G1 co-treated with aflatoxin G2] results in decreased expression of MRPL12 mRNA CTD PMID:31904472 Mrpl12 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of MRPL12 mRNA CTD PMID:30047161 Mrpl12 Rat arsane multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPL12 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MRPL12 mRNA CTD PMID:39836092 Mrpl12 Rat arsenic atom multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPL12 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MRPL12 mRNA CTD PMID:39836092 Mrpl12 Rat atrazine increases expression ISO MRPL12 (Homo sapiens) 6480464 Atrazine results in increased expression of MRPL12 mRNA CTD PMID:22378314 Mrpl12 Rat beauvericin multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in decreased expression of MRPL12 mRNA CTD PMID:31100301 Mrpl12 Rat beauvericin decreases expression ISO MRPL12 (Homo sapiens) 6480464 beauvericin results in decreased expression of MRPL12 mRNA CTD PMID:29203277 Mrpl12 Rat benzo[a]pyrene decreases expression ISO MRPL12 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of MRPL12 protein CTD PMID:33278487 Mrpl12 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MRPL12 mRNA CTD PMID:25181051 more ... Mrpl12 Rat bisphenol A increases expression ISO MRPL12 (Homo sapiens) 6480464 bisphenol A results in increased expression of MRPL12 protein CTD PMID:37567409 Mrpl12 Rat bisphenol A decreases expression ISO Mrpl12 (Mus musculus) 6480464 bisphenol A results in decreased expression of MRPL12 mRNA CTD PMID:35598803 Mrpl12 Rat bisphenol A increases expression ISO Mrpl12 (Mus musculus) 6480464 bisphenol A results in increased expression of MRPL12 mRNA CTD PMID:38074096 Mrpl12 Rat carbon nanotube increases expression ISO Mrpl12 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of MRPL12 mRNA CTD PMID:25554681 Mrpl12 Rat cobalt dichloride decreases expression ISO MRPL12 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of MRPL12 mRNA CTD PMID:19376846 Mrpl12 Rat copper atom multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of MRPL12 mRNA CTD PMID:20971185 Mrpl12 Rat copper(0) multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [NSC 689534 binds to Copper] which results in decreased expression of MRPL12 mRNA CTD PMID:20971185 Mrpl12 Rat copper(II) sulfate decreases expression ISO MRPL12 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of MRPL12 mRNA CTD PMID:19549813 Mrpl12 Rat DDE increases expression ISO MRPL12 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of MRPL12 mRNA CTD PMID:38568856 Mrpl12 Rat Dibutyl phosphate affects expression ISO MRPL12 (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of MRPL12 mRNA CTD PMID:37042841 Mrpl12 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of MRPL12 mRNA CTD PMID:21266533 Mrpl12 Rat dibutyl phthalate decreases expression ISO Mrpl12 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of MRPL12 mRNA CTD PMID:17361019 and PMID:21266533 Mrpl12 Rat dioxygen multiple interactions ISO Mrpl12 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of MRPL12 mRNA CTD PMID:30529165 Mrpl12 Rat disodium selenite increases expression ISO MRPL12 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of MRPL12 mRNA CTD PMID:18175754 Mrpl12 Rat doxorubicin affects expression ISO MRPL12 (Homo sapiens) 6480464 Doxorubicin affects the expression of MRPL12 protein CTD PMID:29385562 Mrpl12 Rat elemental selenium increases expression ISO MRPL12 (Homo sapiens) 6480464 Selenium results in increased expression of MRPL12 mRNA CTD PMID:19244175 Mrpl12 Rat enniatin multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [beauvericin co-treated with enniatins] results in decreased expression of MRPL12 mRNA and [Plant Extracts co-treated with enniatins] results in decreased expression of MRPL12 mRNA CTD PMID:31100301 and PMID:31904472 Mrpl12 Rat ethyl methanesulfonate decreases expression ISO MRPL12 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of MRPL12 mRNA CTD PMID:23649840 Mrpl12 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of MRPL12 mRNA CTD PMID:24136188 Mrpl12 Rat fipronil decreases expression EXP 6480464 fipronil results in decreased expression of MRPL12 mRNA CTD PMID:23962444 and PMID:34044035 Mrpl12 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of MRPL12 mRNA CTD PMID:24136188 Mrpl12 Rat folic acid multiple interactions ISO Mrpl12 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of MRPL12 mRNA] CTD PMID:22206623 Mrpl12 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of MRPL12 mRNA CTD PMID:22061828 Mrpl12 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of MRPL12 mRNA CTD PMID:33387578 Mrpl12 Rat glafenine increases expression EXP 6480464 Glafenine results in increased expression of MRPL12 mRNA CTD PMID:24136188 Mrpl12 Rat hydrogen peroxide affects expression ISO MRPL12 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of MRPL12 mRNA CTD PMID:21179406 Mrpl12 Rat indometacin decreases expression EXP 6480464 Indomethacin results in decreased expression of MRPL12 mRNA CTD PMID:36868495 Mrpl12 Rat ivermectin decreases expression ISO MRPL12 (Homo sapiens) 6480464 Ivermectin results in decreased expression of MRPL12 protein CTD PMID:32959892 Mrpl12 Rat lipopolysaccharide multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of MRPL12 mRNA CTD PMID:31059760 Mrpl12 Rat manganese atom multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPL12 mRNA CTD PMID:39836092 Mrpl12 Rat manganese(0) multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPL12 mRNA CTD PMID:39836092 Mrpl12 Rat manganese(II) chloride multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPL12 mRNA CTD PMID:39836092 Mrpl12 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of MRPL12 mRNA CTD PMID:19149911 Mrpl12 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of MRPL12 mRNA CTD PMID:30047161 Mrpl12 Rat methyl methanesulfonate decreases expression ISO MRPL12 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of MRPL12 mRNA CTD PMID:23649840 Mrpl12 Rat N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine decreases expression ISO MRPL12 (Homo sapiens) 6480464 N more ... CTD PMID:19013360 Mrpl12 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of MRPL12 mRNA CTD PMID:19041683 Mrpl12 Rat nickel sulfate increases expression ISO MRPL12 (Homo sapiens) 6480464 nickel sulfate results in increased expression of MRPL12 mRNA CTD PMID:18651567 Mrpl12 Rat nimesulide increases expression EXP 6480464 nimesulide results in increased expression of MRPL12 mRNA CTD PMID:24136188 Mrpl12 Rat nitrates multiple interactions ISO Mrpl12 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of MRPL12 mRNA CTD PMID:35964746 Mrpl12 Rat ozone multiple interactions ISO Mrpl12 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of MRPL12 mRNA CTD PMID:34911549 Mrpl12 Rat paracetamol affects expression ISO Mrpl12 (Mus musculus) 6480464 Acetaminophen affects the expression of MRPL12 mRNA CTD PMID:17562736 Mrpl12 Rat paracetamol multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [Acetaminophen co-treated with Lipopolysaccharides] results in decreased expression of MRPL12 mRNA CTD PMID:31059760 Mrpl12 Rat paracetamol decreases expression ISO MRPL12 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of MRPL12 mRNA CTD PMID:25704631 and PMID:31059760 Mrpl12 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of MRPL12 mRNA CTD PMID:32680482 Mrpl12 Rat pregnenolone 16alpha-carbonitrile increases expression EXP 6480464 Pregnenolone Carbonitrile results in increased expression of MRPL12 mRNA CTD PMID:30047161 Mrpl12 Rat pyrimidifen increases expression ISO MRPL12 (Homo sapiens) 6480464 pyrimidifen results in increased expression of MRPL12 mRNA CTD PMID:33512557 Mrpl12 Rat quercitrin decreases expression ISO MRPL12 (Homo sapiens) 6480464 quercitrin results in decreased expression of MRPL12 mRNA CTD PMID:25193878 Mrpl12 Rat resveratrol increases expression ISO Mrpl12 (Mus musculus) 6480464 resveratrol results in increased expression of MRPL12 mRNA CTD PMID:22610192 Mrpl12 Rat SB 431542 multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of MRPL12 protein CTD PMID:37664457 Mrpl12 Rat selenium atom increases expression ISO MRPL12 (Homo sapiens) 6480464 Selenium results in increased expression of MRPL12 mRNA CTD PMID:19244175 Mrpl12 Rat silicon dioxide increases expression ISO MRPL12 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of MRPL12 mRNA CTD PMID:25895662 Mrpl12 Rat sodium arsenite decreases expression ISO MRPL12 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of MRPL12 mRNA CTD PMID:25879800 more ... Mrpl12 Rat sodium arsenite multiple interactions ISO MRPL12 (Homo sapiens) 6480464 [[sodium arsenite results in increased abundance of Arsenic] co-treated with [manganese chloride results in increased abundance of Manganese]] results in increased expression of MRPL12 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in increased expression of MRPL12 mRNA CTD PMID:39836092 Mrpl12 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of MRPL12 mRNA CTD PMID:22561333 and PMID:25993096 Mrpl12 Rat sulfadimethoxine increases expression EXP 6480464 Sulfadimethoxine results in increased expression of MRPL12 mRNA CTD PMID:30047161 Mrpl12 Rat tetrachloromethane decreases expression ISO Mrpl12 (Mus musculus) 6480464 Carbon Tetrachloride results in decreased expression of MRPL12 mRNA CTD PMID:31919559 Mrpl12 Rat thapsigargin decreases expression ISO MRPL12 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of MRPL12 mRNA CTD PMID:22378314 Mrpl12 Rat thiram decreases expression ISO MRPL12 (Homo sapiens) 6480464 Thiram results in decreased expression of MRPL12 mRNA CTD PMID:38568856 Mrpl12 Rat titanium dioxide decreases methylation ISO Mrpl12 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of MRPL12 promoter CTD PMID:35295148 Mrpl12 Rat trichostatin A affects expression ISO MRPL12 (Homo sapiens) 6480464 trichostatin A affects the expression of MRPL12 mRNA CTD PMID:28542535 Mrpl12 Rat trovafloxacin decreases expression EXP 6480464 trovafloxacin results in decreased expression of MRPL12 mRNA CTD PMID:24136188 Mrpl12 Rat tunicamycin decreases expression ISO MRPL12 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of MRPL12 mRNA CTD PMID:22378314 Mrpl12 Rat urethane decreases expression ISO MRPL12 (Homo sapiens) 6480464 Urethane results in decreased expression of MRPL12 mRNA CTD PMID:28818685 Mrpl12 Rat valproic acid increases methylation ISO MRPL12 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of MRPL12 gene CTD PMID:29154799 Mrpl12 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of MRPL12 mRNA CTD PMID:23034163 Mrpl12 Rat vitamin E increases expression ISO MRPL12 (Homo sapiens) 6480464 Vitamin E results in increased expression of MRPL12 mRNA CTD PMID:19244175 Mrpl12 Rat zinc sulfate increases expression ISO MRPL12 (Homo sapiens) 6480464 Zinc Sulfate results in increased expression of MRPL12 mRNA CTD PMID:19013360
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-trinitrotoluene (EXP) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-amino-2,6-dinitrotoluene (EXP) 6-propyl-2-thiouracil (EXP) acrylamide (ISO) aflatoxin B1 (ISO) Aflatoxin B2 alpha (ISO) Aflatoxin G1 (ISO) Aflatoxin G2 (ISO) amitrole (EXP) arsane (ISO) arsenic atom (ISO) atrazine (ISO) beauvericin (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) carbon nanotube (ISO) cobalt dichloride (ISO) copper atom (ISO) copper(0) (ISO) copper(II) sulfate (ISO) DDE (ISO) Dibutyl phosphate (ISO) dibutyl phthalate (EXP,ISO) dioxygen (ISO) disodium selenite (ISO) doxorubicin (ISO) elemental selenium (ISO) enniatin (ISO) ethyl methanesulfonate (ISO) finasteride (EXP) fipronil (EXP) flutamide (EXP) folic acid (ISO) gentamycin (EXP) glafenine (EXP) hydrogen peroxide (ISO) indometacin (EXP) ivermectin (ISO) lipopolysaccharide (ISO) manganese atom (ISO) manganese(0) (ISO) manganese(II) chloride (ISO) methamphetamine (EXP) methimazole (EXP) methyl methanesulfonate (ISO) N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO) N-nitrosodiethylamine (EXP) nickel sulfate (ISO) nimesulide (EXP) nitrates (ISO) ozone (ISO) paracetamol (ISO) paraquat (EXP) pregnenolone 16alpha-carbonitrile (EXP) pyrimidifen (ISO) quercitrin (ISO) resveratrol (ISO) SB 431542 (ISO) selenium atom (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sodium dichromate (EXP) sulfadimethoxine (EXP) tetrachloromethane (ISO) thapsigargin (ISO) thiram (ISO) titanium dioxide (ISO) trichostatin A (ISO) trovafloxacin (EXP) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP) vitamin E (ISO) zinc sulfate (ISO)
Mrpl12 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 10 106,256,746 - 106,261,249 (+) NCBI GRCr8 mRatBN7.2 10 105,758,410 - 105,762,913 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 10 105,758,410 - 105,762,913 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 10 110,862,572 - 110,867,073 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 10 110,325,603 - 110,330,104 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 10 105,678,867 - 105,683,370 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 10 109,658,032 - 109,662,535 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 10 109,658,032 - 109,662,535 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 10 109,251,300 - 109,255,803 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 10 109,870,160 - 109,874,664 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 10 104,302,342 - 104,306,842 (+) NCBI Celera Cytogenetic Map 10 q32.3 NCBI
MRPL12 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 17 81,703,367 - 81,707,517 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 17 81,703,367 - 81,707,517 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 17 79,670,397 - 79,674,547 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 17 77,280,812 - 77,284,953 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 17 77,280,811 - 77,284,953 NCBI Celera 17 76,315,553 - 76,319,694 (+) NCBI Celera Cytogenetic Map 17 q25.3 NCBI HuRef 17 75,116,299 - 75,120,450 (+) NCBI HuRef CHM1_1 17 79,756,619 - 79,760,775 (+) NCBI CHM1_1 T2T-CHM13v2.0 17 82,620,267 - 82,624,415 (+) NCBI T2T-CHM13v2.0
Mrpl12 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 11 120,375,463 - 120,379,580 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 11 120,375,439 - 120,379,891 (+) Ensembl GRCm39 Ensembl GRCm38 11 120,484,637 - 120,488,754 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 11 120,484,613 - 120,489,065 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 11 120,345,983 - 120,350,068 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 11 120,300,759 - 120,304,844 (+) NCBI MGSCv36 mm8 Celera 11 132,220,001 - 132,224,086 (+) NCBI Celera Cytogenetic Map 11 E2 NCBI cM Map 11 84.18 NCBI
Mrpl12 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955506 1,398,445 - 1,404,409 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955506 1,400,439 - 1,404,409 (-) NCBI ChiLan1.0 ChiLan1.0
MRPL12 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 19 98,293,308 - 98,297,555 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 17 103,193,727 - 103,197,951 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 17 76,162,710 - 76,166,862 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 17 81,863,522 - 81,867,734 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 17 81,863,518 - 81,867,734 (+) Ensembl panpan1.1 panPan2
MRPL12 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 9 493,536 - 498,154 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 9 1,095,712 - 1,100,406 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 9 1,087,000 - 1,091,703 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 9 1,085,859 - 1,091,645 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 9 1,111,962 - 1,116,653 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 9 1,238,549 - 1,243,249 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 9 1,317,578 - 1,322,281 (-) NCBI UU_Cfam_GSD_1.0
Mrpl12 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405602 1,105,214 - 1,110,096 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936594 5,301,866 - 5,305,362 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936594 5,301,846 - 5,305,362 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
MRPL12
MRPL12 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 16 73,633,786 - 73,639,142 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 16 73,633,918 - 73,638,902 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666077 45,042,518 - 45,047,078 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Mrpl12
.
Predicted Target Of
Count of predictions: 163 Count of miRNA genes: 120 Interacting mature miRNAs: 133 Transcripts: ENSRNOT00000054965 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
7387312 Bw125 Body weight QTL 125 3 0.0047 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight (CMO:0000356) 10 64890616 107211142 Rat 12880384 Cm107 Cardiac mass QTL 107 0.001 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 90404397 107211142 Rat 12880385 Cm108 Cardiac mass QTL 108 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 90404397 107211142 Rat 1354641 Bvd2 Brain ventricular dilatation QTL 2 6.36 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 10 93223816 107057807 Rat 2317029 Aia19 Adjuvant induced arthritis QTL 19 2.98 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 10 66978955 107211142 Rat 2303589 Bw87 Body weight QTL 87 2 body mass (VT:0001259) body weight (CMO:0000012) 10 81285008 107211142 Rat 12880396 Am13 Aortic mass QTL 13 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 10 90404397 107211142 Rat 61449 Ciaa2 CIA Autoantibody QTL 2 7.1 blood autoantibody amount (VT:0003725) calculated serum anti-type 2 collagen antibody titer (CMO:0001279) 10 63221094 107211142 Rat 12880398 Kidm67 Kidney mass QTL 67 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 10 90404397 107211142 Rat 61387 Bp1 Blood pressure QTL 1 5.1 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 10 51770177 107211142 Rat 2317039 Aia6 Adjuvant induced arthritis QTL 6 4.31 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 10 66978955 107211142 Rat 12880395 Cm109 Cardiac mass QTL 109 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 10 90404397 107211142 Rat 1579915 Bp280 Blood pressure QTL 280 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90404397 107211142 Rat 61396 Bp9 Blood pressure QTL 9 4.8 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68420376 107211142 Rat 2298548 Neuinf7 Neuroinflammation QTL 7 3.4 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 10 72224939 107211142 Rat 1302404 Cia27 Collagen induced arthritis QTL 27 2.6 0.0045 joint integrity trait (VT:0010548) experimental arthritis severity measurement (CMO:0001459) 10 76452683 107211142 Rat 2317754 Glom25 Glomerulus QTL 25 3.5 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 10 82685200 107211142 Rat 634320 Niddm49 Non-insulin dependent diabetes mellitus QTL 49 4.41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 10 88539139 107211142 Rat 70171 Cari1 Carrageenan-induced inflammation QTL 1 4.9 0.0005 hypodermis integrity trait (VT:0010550) inflammatory exudate volume (CMO:0001429) 10 53797385 107211142 Rat 1331791 Cm31 Cardiac mass QTL 31 3.84606 heart mass (VT:0007028) heart wet weight (CMO:0000069) 10 29299504 107211142 Rat 10450498 Bp384 Blood pressure QTL 384 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 67750049 107211142 Rat 4889492 Pancm2 Pancreatic morphology QTL 2 3.2 pancreatic beta cell morphology trait (VT:0005217) ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814) 10 76748906 107211142 Rat 6893366 Bw106 Body weight QTL 106 0.3 0.47 body mass (VT:0001259) body weight (CMO:0000012) 10 70199100 107211142 Rat 10450493 Bp382 Blood pressure QTL 382 0.002 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 94759759 107211142 Rat 1578672 Bmd16 Bone mineral density QTL 16 6.2 femur mineral mass (VT:0010011) compact volumetric bone mineral density (CMO:0001730) 10 96703043 107057807 Rat 2313103 Bss80 Bone structure and strength QTL 80 2 0.0001 tibia strength trait (VT:1000284) tibia midshaft endosteal cross-sectional area (CMO:0001716) 10 62057807 107057807 Rat 2293646 Bss25 Bone structure and strength QTL 25 10.96 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 10 69738412 107211142 Rat 2300172 Bmd57 Bone mineral density QTL 57 9.8 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 10 69738412 107211142 Rat 70193 Mcs7 Mammary carcinoma susceptibility QTL 7 2.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 10 72224939 107211142 Rat 2313105 Bss79 Bone structure and strength QTL 79 1.8 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 10 62057807 107057807 Rat 61363 Oia3 Oil induced arthritis QTL 3 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87307617 107211142 Rat 2292438 Bp311 Blood pressure QTL 311 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 76246085 107211142 Rat 2316949 Gluco60 Glucose level QTL 60 3.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 10 14487011 107057807 Rat 2292436 Bp310 Blood pressure QTL 310 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 94759759 107211142 Rat 724530 Bp149 Blood pressure QTL 149 0.0001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 10 90627439 107211142 Rat 1300137 Bp186 Blood pressure QTL 186 3.57 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 10 90627439 107057807 Rat 631538 Oia5 Oil induced arthritis QTL 5 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 10 87055121 107211142 Rat 1642980 Bp300 Blood pressure QTL 300 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 10 68383129 107211142 Rat 2293663 Bss33 Bone structure and strength QTL 33 9.34 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 10 69738412 107211142 Rat 1578663 Bss18 Bone structure and strength QTL 18 3.6 femur width (VT:1000666) femoral neck width (CMO:0001695) 10 96703043 107057807 Rat
RH136692
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 105,763,147 - 105,763,222 (+) MAPPER mRatBN7.2 mRatBN7.2 10 105,763,147 - 105,763,267 (+) MAPPER mRatBN7.2 Rnor_6.0 10 109,662,770 - 109,662,889 NCBI Rnor6.0 Rnor_6.0 10 109,662,770 - 109,662,844 NCBI Rnor6.0 Rnor_5.0 10 109,256,038 - 109,256,157 UniSTS Rnor5.0 Rnor_5.0 10 109,256,038 - 109,256,112 UniSTS Rnor5.0 RGSC_v3.4 10 109,874,899 - 109,874,973 UniSTS RGSC3.4 RGSC_v3.4 10 109,874,899 - 109,875,018 UniSTS RGSC3.4 Celera 10 104,307,077 - 104,307,151 UniSTS Celera 10 104,307,077 - 104,307,196 UniSTS Cytogenetic Map 10 q32.3 UniSTS
RH141802
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 10 105,762,113 - 105,762,315 (+) MAPPER mRatBN7.2 Rnor_6.0 10 109,661,736 - 109,661,937 NCBI Rnor6.0 Rnor_5.0 10 109,255,004 - 109,255,205 UniSTS Rnor5.0 RGSC_v3.4 10 109,873,865 - 109,874,066 UniSTS RGSC3.4 Celera 10 104,306,043 - 104,306,244 UniSTS Cytogenetic Map 10 q32.3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000054965 ⟹ ENSRNOP00000051848
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 10 105,758,410 - 105,762,913 (+) Ensembl Rnor_6.0 Ensembl 10 109,658,032 - 109,662,535 (+) Ensembl
RefSeq Acc Id:
NM_001029900 ⟹ NP_001025071
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 10 106,256,746 - 106,261,249 (+) NCBI mRatBN7.2 10 105,758,410 - 105,762,913 (+) NCBI Rnor_6.0 10 109,658,032 - 109,662,535 (+) NCBI Rnor_5.0 10 109,251,300 - 109,255,803 (+) NCBI RGSC_v3.4 10 109,870,160 - 109,874,664 (+) RGD Celera 10 104,302,342 - 104,306,842 (+) RGD
Sequence:
ATGCCGCGGAGGGCTGCAGGAGAAAGCTCCGACCCAGTACTATTTCCGGGCCCAGACTGCGTCTGCGCGTCGCGCCGCCTAGTGCGTAATATCAGAAGCCAACCAAGTCGCCCTGGCCGCCAAGGCCT
hide sequence
RefSeq Acc Id:
NP_001025071 ⟸ NM_001029900
- UniProtKB:
D3ZXF9 (UniProtKB/TrEMBL)
- Sequence:
MPRRAAGESSDPVLFPGPDCVCASRRLVRNIRSQPSRPGRQGLVARAARPARLLPDRASLPLRAACDLPACGAMLPAAAAAASRLWGPRLGLGGSALRLVRQQMPGVCVARQLRSSSHRRSEALAGAP
hide sequence
Ensembl Acc Id:
ENSRNOP00000051848 ⟸ ENSRNOT00000054965
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-06
Mrpl12
mitochondrial ribosomal protein L12
Mrpl12
ribosomal protein, mitochondrial, L12
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2007-04-13
Mrpl12
ribosomal protein, mitochondrial, L12
Mrpl12_mapped
ribosomal protein, mitochondrial, L12 (mapped)
Data merged from RGD:621499
737654 APPROVED
2006-11-19
Mrpl12_mapped
ribosomal protein, mitochondrial, L12(mapped)
Mrpl12
ribosomal protein, mitochondrial, L12
Symbol set to symbol_mapped, name set to name (mapped)
1582166 APPROVED
2006-11-19
Mrpl12
ribosomal protein, mitochondrial, L12
Symbol and Name status set to provisional
70820 PROVISIONAL
2004-09-10
Mrpl12
ribosomal protein, mitochondrial, L12
Rpm12
Symbol and Name updated
1299863 APPROVED
2002-08-07
Rpm12
ribosomal protein, mitochondrial, L12
Symbol and Name status set to provisional
70820 PROVISIONAL
