Advanced Search (OLGA)

Gene: Ngrn (neugrin, neurite outgrowth associated) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Ngrn

Name:

neugrin, neurite outgrowth associated

RGD ID:

1583734

Description:

Predicted to enable rRNA binding activity. Predicted to be involved in mitochondrial ribosome assembly and positive regulation of mitochondrial translation. Predicted to be located in several cellular components, including mitochondrion; mitotic spindle; and nuclear body. Predicted to be active in nucleus. Orthologous to human NGRN (neugrin, neurite outgrowth associated); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

mesenchymal stem cell protein DSC92; MGC124865; neugrin; neurite outgrowth-associated protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	143,622,494 - 143,628,609 (+)	NCBI		GRCr8
mRatBN7.2	1	134,213,235 - 134,219,348 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	134,213,456 - 134,219,339 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	142,122,311 - 142,128,189 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	149,291,711 - 149,297,589 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	142,209,634 - 142,215,511 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	142,050,458 - 142,056,336 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	142,050,458 - 142,056,336 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	143,003,300 - 143,009,179 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	136,075,434 - 136,081,313 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	126,273,533 - 126,279,381 (+)	NCBI		Celera
Cytogenetic Map	1	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ngrn	Rat	Bloom syndrome		ISO	NGRN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Bloom syndrome	ClinVar	PMID:17407155 and PMID:28492532
Ngrn	Rat	colorectal cancer		ISO	NGRN (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial colorectal cancer	ClinVar	PMID:28492532
Ngrn	Rat	D-2-hydroxyglutaric aciduria 2		ISO	NGRN (Homo sapiens)	8554872	ClinVar Annotator: match by term: D-2-hydroxyglutaric aciduria 2	ClinVar	PMID:17407155 and PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ngrn	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	NGRN (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of NGRN mRNA	CTD	PMID:22079256
Ngrn	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Ngrn (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of NGRN mRNA	CTD	PMID:22206623
Ngrn	Rat	1,2-dimethylhydrazine	increases expression	ISO	Ngrn (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in increased expression of NGRN mRNA	CTD	PMID:22206623
Ngrn	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Ngrn (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of NGRN mRNA	CTD	PMID:24680724
Ngrn	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of NGRN mRNA	CTD	PMID:33387578
Ngrn	Rat	2,3,7,8-Tetrachlorodibenzofuran	increases expression	EXP		6480464	2 more ...	CTD	PMID:32109520
Ngrn	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of NGRN mRNA	CTD	PMID:21346803
Ngrn	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of NGRN mRNA	CTD	PMID:21346803
Ngrn	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	NGRN (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of NGRN mRNA	CTD	PMID:28628672
Ngrn	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of NGRN mRNA	CTD	PMID:30047161
Ngrn	Rat	aflatoxin B1	increases expression	ISO	NGRN (Homo sapiens)	6480464	Aflatoxin B1 results in increased expression of NGRN mRNA	CTD	PMID:27153756
Ngrn	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of NGRN mRNA	CTD	PMID:30047161
Ngrn	Rat	aristolochic acid A	increases expression	ISO	NGRN (Homo sapiens)	6480464	aristolochic acid I results in increased expression of NGRN mRNA	CTD	PMID:33212167
Ngrn	Rat	Aroclor 1254	decreases expression	ISO	Ngrn (Mus musculus)	6480464	Chlorodiphenyl (54% Chlorine) results in decreased expression of NGRN mRNA	CTD	PMID:23650126
Ngrn	Rat	arsenous acid	increases expression	ISO	NGRN (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of NGRN mRNA	CTD	PMID:20458559
Ngrn	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of NGRN mRNA	CTD	PMID:25181051 more ...
Ngrn	Rat	bisphenol A	increases expression	ISO	Ngrn (Mus musculus)	6480464	bisphenol A results in increased expression of NGRN mRNA	CTD	PMID:33221593
Ngrn	Rat	bisphenol A	affects expression	ISO	NGRN (Homo sapiens)	6480464	bisphenol A affects the expression of NGRN mRNA	CTD	PMID:30903817
Ngrn	Rat	bisphenol F	multiple interactions	ISO	NGRN (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of NGRN mRNA	CTD	PMID:28628672
Ngrn	Rat	cadmium atom	multiple interactions	ISO	NGRN (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of NGRN mRNA	CTD	PMID:35301059
Ngrn	Rat	cadmium dichloride	multiple interactions	ISO	NGRN (Homo sapiens)	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of NGRN mRNA	CTD	PMID:35301059
Ngrn	Rat	carbon nanotube	decreases expression	ISO	Ngrn (Mus musculus)	6480464	Nanotubes more ...	CTD	PMID:25554681
Ngrn	Rat	CGP 52608	multiple interactions	ISO	NGRN (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to NGRN gene]	CTD	PMID:28238834
Ngrn	Rat	crocidolite asbestos	increases expression	ISO	Ngrn (Mus musculus)	6480464	Asbestos and Crocidolite results in increased expression of NGRN mRNA	CTD	PMID:19446018
Ngrn	Rat	cyclosporin A	increases expression	ISO	NGRN (Homo sapiens)	6480464	Cyclosporine results in increased expression of NGRN mRNA	CTD	PMID:20106945 and PMID:25562108
Ngrn	Rat	dexamethasone	multiple interactions	ISO	NGRN (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of NGRN mRNA	CTD	PMID:28628672
Ngrn	Rat	diarsenic trioxide	increases expression	ISO	NGRN (Homo sapiens)	6480464	Arsenic Trioxide results in increased expression of NGRN mRNA	CTD	PMID:20458559
Ngrn	Rat	Dibutyl phosphate	affects expression	ISO	NGRN (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of NGRN mRNA	CTD	PMID:37042841
Ngrn	Rat	disodium selenite	increases expression	ISO	NGRN (Homo sapiens)	6480464	Sodium Selenite results in increased expression of NGRN mRNA	CTD	PMID:18175754
Ngrn	Rat	endosulfan	increases expression	EXP		6480464	Endosulfan results in increased expression of NGRN mRNA	CTD	PMID:29391264
Ngrn	Rat	ethanol	increases expression	ISO	Ngrn (Mus musculus)	6480464	Ethanol results in increased expression of NGRN mRNA	CTD	PMID:30319688
Ngrn	Rat	folic acid	multiple interactions	ISO	Ngrn (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of NGRN mRNA	CTD	PMID:22206623
Ngrn	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of NGRN mRNA	CTD	PMID:22061828
Ngrn	Rat	indometacin	multiple interactions	ISO	NGRN (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in decreased expression of NGRN mRNA	CTD	PMID:28628672
Ngrn	Rat	lead(0)	affects expression	ISO	NGRN (Homo sapiens)	6480464	Lead affects the expression of NGRN mRNA	CTD	PMID:28903495
Ngrn	Rat	methimazole	decreases expression	EXP		6480464	Methimazole results in decreased expression of NGRN mRNA	CTD	PMID:30047161
Ngrn	Rat	nitrates	multiple interactions	ISO	Ngrn (Mus musculus)	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of NGRN mRNA	CTD	PMID:35964746
Ngrn	Rat	paracetamol	affects expression	ISO	Ngrn (Mus musculus)	6480464	Acetaminophen affects the expression of NGRN mRNA	CTD	PMID:17562736
Ngrn	Rat	paracetamol	increases expression	ISO	NGRN (Homo sapiens)	6480464	Acetaminophen results in increased expression of NGRN mRNA	CTD	PMID:29067470
Ngrn	Rat	perfluorononanoic acid	increases expression	ISO	NGRN (Homo sapiens)	6480464	perfluoro-n-nonanoic acid results in increased expression of NGRN mRNA	CTD	PMID:32588087
Ngrn	Rat	picoxystrobin	decreases expression	ISO	NGRN (Homo sapiens)	6480464	picoxystrobin results in decreased expression of NGRN mRNA	CTD	PMID:33512557
Ngrn	Rat	pirinixic acid	decreases expression	ISO	Ngrn (Mus musculus)	6480464	pirinixic acid results in decreased expression of NGRN mRNA	CTD	PMID:18445702
Ngrn	Rat	potassium chromate	multiple interactions	ISO	NGRN (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of NGRN mRNA	CTD	PMID:22079256
Ngrn	Rat	potassium chromate	increases expression	ISO	NGRN (Homo sapiens)	6480464	potassium chromate(VI) results in increased expression of NGRN mRNA	CTD	PMID:22079256
Ngrn	Rat	resveratrol	multiple interactions	ISO	NGRN (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in increased expression of NGRN mRNA	CTD	PMID:23557933
Ngrn	Rat	rotenone	decreases expression	ISO	NGRN (Homo sapiens)	6480464	Rotenone results in decreased expression of NGRN mRNA	CTD	PMID:33512557
Ngrn	Rat	sarin	decreases expression	ISO	NGRN (Homo sapiens)	6480464	Sarin results in decreased expression of NGRN mRNA	CTD	PMID:19522546
Ngrn	Rat	Soman	decreases expression	EXP		6480464	Soman results in decreased expression of NGRN mRNA	CTD	PMID:19281266
Ngrn	Rat	sulfadimethoxine	decreases expression	EXP		6480464	Sulfadimethoxine results in decreased expression of NGRN mRNA	CTD	PMID:30047161
Ngrn	Rat	titanium dioxide	decreases methylation	ISO	Ngrn (Mus musculus)	6480464	titanium dioxide results in decreased methylation of NGRN gene	CTD	PMID:35295148
Ngrn	Rat	triphenyl phosphate	affects expression	ISO	NGRN (Homo sapiens)	6480464	triphenyl phosphate affects the expression of NGRN mRNA	CTD	PMID:37042841
Ngrn	Rat	valproic acid	decreases expression	ISO	NGRN (Homo sapiens)	6480464	Valproic Acid results in decreased expression of NGRN mRNA	CTD	PMID:23179753
Ngrn	Rat	valproic acid	decreases methylation	ISO	NGRN (Homo sapiens)	6480464	Valproic Acid results in decreased methylation of NGRN gene	CTD	PMID:29154799
Ngrn	Rat	valproic acid	affects expression	ISO	NGRN (Homo sapiens)	6480464	Valproic Acid affects the expression of NGRN mRNA	CTD	PMID:25979313
Ngrn	Rat	zinc atom	decreases expression	ISO	NGRN (Homo sapiens)	6480464	Zinc deficiency results in decreased expression of NGRN mRNA	CTD	PMID:22171008
Ngrn	Rat	zinc(0)	decreases expression	ISO	NGRN (Homo sapiens)	6480464	Zinc deficiency results in decreased expression of NGRN mRNA	CTD	PMID:22171008

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ngrn	Rat	cell differentiation	involved_in	IEA	UniProtKB-KW:KW-0221	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ngrn	Rat	mitochondrial ribosome assembly	involved_in	ISO	NGRN (Homo sapiens)	1624291	PMID:27667664	RGD	PMID:27667664
Ngrn	Rat	mitochondrial ribosome assembly	involved_in	ISS	UniProtKB:Q9NPE2	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ngrn	Rat	positive regulation of mitochondrial translation	involved_in	ISS	UniProtKB:Q9NPE2	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ngrn	Rat	positive regulation of mitochondrial translation	involved_in	ISO	NGRN (Homo sapiens)	1624291	PMID:27667664	RGD	PMID:27667664

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ngrn	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ngrn	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ngrn	Rat	intercellular bridge	located_in	ISO	NGRN (Homo sapiens) and UniProtKB:Q9NPE2-2	1624291		RGD	GO_REF:0000052
Ngrn	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ngrn	Rat	mitochondrial matrix	located_in	ISO	NGRN (Homo sapiens)	1624291	PMID:27974379	RGD	PMID:27974379
Ngrn	Rat	mitochondrial membrane	located_in	ISS	UniProtKB:Q9NPE2	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ngrn	Rat	mitochondrial membrane	located_in	IEA	UniProtKB-SubCell:SL-0171	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Ngrn	Rat	mitochondrial membrane	located_in	ISO	NGRN (Homo sapiens)	1624291	PMID:27667664	RGD	PMID:27667664
Ngrn	Rat	mitochondrion	located_in	ISO	NGRN (Homo sapiens) and UniProtKB:Q9NPE2-2	1624291		RGD	GO_REF:0000052
Ngrn	Rat	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ngrn	Rat	mitotic spindle	located_in	ISO	NGRN (Homo sapiens) and UniProtKB:Q9NPE2-2	1624291		RGD	GO_REF:0000052
Ngrn	Rat	nuclear body	located_in	ISO	NGRN (Homo sapiens) and UniProtKB:Q9NPE2-2	1624291		RGD	GO_REF:0000052
Ngrn	Rat	nucleoplasm	located_in	ISO	NGRN (Homo sapiens) and UniProtKB:Q9NPE2-2	1624291		RGD	GO_REF:0000052
Ngrn	Rat	nucleus	located_in	ISO	Ngrn (Mus musculus)	1624291	PMID:11118320	RGD	PMID:11118320
Ngrn	Rat	nucleus	located_in	IEA	UniProtKB:Q99KS2 and ensembl:ENSMUSP00000113444	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Ngrn	Rat	nucleus	located_in	IEA	UniProtKB-KW:KW-0539	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Ngrn	Rat	nucleus	is_active_in	IBA	MGI:1933212 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Ngrn	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Ngrn	Rat	protein binding	enables	ISO	NGRN (Homo sapiens)	1624291	UniProtKB:Q5VVQ6 more ...	RGD	PMID:32296183
Ngrn	Rat	rRNA binding	enables	ISS	UniProtKB:Q9NPE2	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Ngrn	Rat	rRNA binding	enables	ISO	NGRN (Homo sapiens)	1624291	PMID:27667664	RGD	PMID:27667664

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:8889548	PMID:11118320	PMID:12477932	PMID:15489334	PMID:22658674	PMID:22681889	PMID:27667664

Ngrn
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	143,622,494 - 143,628,609 (+)	NCBI		GRCr8
mRatBN7.2	1	134,213,235 - 134,219,348 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	134,213,456 - 134,219,339 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	142,122,311 - 142,128,189 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	149,291,711 - 149,297,589 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	142,209,634 - 142,215,511 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	142,050,458 - 142,056,336 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	142,050,458 - 142,056,336 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	143,003,300 - 143,009,179 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	136,075,434 - 136,081,313 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	1	126,273,533 - 126,279,381 (+)	NCBI		Celera
Cytogenetic Map	1	q31	NCBI

NGRN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	90,265,663 - 90,272,211 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	90,265,659 - 90,275,778 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	90,808,895 - 90,815,443 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	88,609,899 - 88,616,447 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	15	67,213,245 - 67,219,790 (+)	NCBI		Celera
Cytogenetic Map	15	q26.1	NCBI
HuRef	15	66,920,854 - 66,927,397 (+)	NCBI		HuRef
CHM1_1	15	90,650,643 - 90,657,205 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	88,021,653 - 88,028,202 (+)	NCBI		T2T-CHM13v2.0

Ngrn
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	79,910,963 - 79,915,126 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	79,910,963 - 79,915,122 (+)	Ensembl		GRCm39 Ensembl
GRCm38	7	80,261,215 - 80,265,378 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	80,261,215 - 80,265,374 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	87,406,101 - 87,410,264 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	80,134,733 - 80,138,887 (+)	NCBI		MGSCv36	mm8
Celera	7	77,663,761 - 77,666,523 (+)	NCBI		Celera
Cytogenetic Map	7	D2	NCBI
cM Map	7	45.58	NCBI

Ngrn
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	15,074,190 - 15,080,561 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955416	15,074,190 - 15,080,561 (-)	NCBI	ChiLan1.0	ChiLan1.0

NGRN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	79,813,130 - 79,819,815 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	83,512,681 - 83,519,255 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	68,954,039 - 68,960,612 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	88,156,107 - 88,162,659 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	88,156,109 - 88,162,659 (+)	Ensembl	panpan1.1		panPan2

NGRN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	53,209,206 - 53,214,629 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	53,209,250 - 53,214,120 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	55,847,012 - 55,852,432 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	53,625,248 - 53,630,664 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	53,625,265 - 53,630,659 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	53,145,332 - 53,150,753 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	53,356,459 - 53,361,865 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	53,696,948 - 53,702,369 (+)	NCBI		UU_Cfam_GSD_1.0

Ngrn
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	130,333,442 - 130,339,893 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936483	15,994,660 - 16,001,078 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936483	15,994,621 - 16,001,078 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NGRN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	55,827,375 - 55,835,459 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1 Ensembl	7	55,811,855 - 55,827,077 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	55,824,625 - 55,835,464 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

NGRN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	8,809,776 - 8,816,862 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	8,809,912 - 8,816,441 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	37,912,335 - 37,919,233 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ngrn
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624768	17,234,205 - 17,240,509 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624768	17,234,242 - 17,240,511 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Ngrn
13 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	35
Count of miRNA genes:	27
Interacting mature miRNAs:	30
Transcripts:	ENSRNOT00000018107
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	121767634	166767634	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	123350408	182418476	Rat
9590300	Scort16	Serum corticosterone level QTL 16	4.39	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	103111621	148111621	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	115585465	172949803	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
631570	Bp94	Blood pressure QTL 94		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123479780	142990467	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	117917486	196963478	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
61346	Rf2	Renal disease susceptibility QTL 2	3.7		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	99267916	144267916	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	90664883	143200202	Rat
2317833	Alcrsp19	Alcohol response QTL 19	12.4	0.001	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	131763437	159756369	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
1641897	Alcrsp1	Alcohol response QTL 1			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	92184926	137184926	Rat
9685799	Bp375	Blood pressure QTL 375			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121833674	166833674	Rat
9685802	Bp376	Blood pressure QTL 376			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	126540680	171540680	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat
61370	Mcs3	Mammary carcinoma susceptibility QTL 3	2.15		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	102268556	147268556	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	123350408	182418476	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	106047847	151047847	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
2303591	Gluco41	Glucose level QTL 41	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	102168504	147168504	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
2313060	Bss71	Bone structure and strength QTL 71	2.6	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	1	118944747	163944747	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
61399	Tcat1	Tongue tumor resistance QTL 1	3.3		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879)	1	99267916	144267916	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	92948896	144267916	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	168883176	Rat
8694370	Bw154	Body weight QTL 154	8.91	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	1	103111621	148111621	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
1354623	Rf46	Renal function QTL 46	3.8		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	1	102813953	151162766	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350408	181759564	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	123556856	196963478	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	123350408	182418476	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat

RH127385

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	134,219,037 - 134,219,237 (+)	MAPPER	mRatBN7.2
mRatBN7.2	15	71,453,689 - 71,453,882 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	79,001,396 - 79,001,588	NCBI	Rnor6.0
Rnor_6.0	1	142,056,026 - 142,056,225	NCBI	Rnor6.0
Rnor_5.0	15	82,544,164 - 82,544,356	UniSTS	Rnor5.0
Rnor_5.0	1	143,008,869 - 143,009,068	UniSTS	Rnor5.0
RGSC_v3.4	1	136,081,003 - 136,081,202	UniSTS	RGSC3.4
RGSC_v3.4	15	78,003,405 - 78,003,597	UniSTS	RGSC3.4
Celera	15	70,798,755 - 70,798,947	UniSTS
Celera	1	126,279,071 - 126,279,270	UniSTS
RH 3.4 Map	1	1068.9	UniSTS
Cytogenetic Map	15	q21	UniSTS
Cytogenetic Map	1	q31	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001033900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_028055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087627	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039087630	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005490669	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005490672	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA818112	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC114460	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC101926	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB544437	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB583418	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM062823	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214228	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018107 ⟹ ENSRNOP00000018107

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	134,213,456 - 134,219,339 (+)	Ensembl
Rnor_6.0 Ensembl	1	142,050,458 - 142,056,336 (+)	Ensembl

RefSeq Acc Id:

NM_001033900 ⟹ NP_001029072

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	143,622,731 - 143,628,609 (+)	NCBI
mRatBN7.2	1	134,213,470 - 134,219,348 (+)	NCBI
Rnor_6.0	1	142,050,458 - 142,056,336 (+)	NCBI
Rnor_5.0	1	143,003,300 - 143,009,179 (+)	NCBI
RGSC_v3.4	1	136,075,434 - 136,081,313 (+)	RGD
Celera	1	126,273,533 - 126,279,381 (+)	RGD

Sequence:

show sequence

TGCTTCCGGTGCTCTCCGGTCGCGAGCTGTAGATCACCTCCTCGCATCGCAATGGCGCTGTCTCTGAGCCTTTTCTTGGGCGGTCGTGTCCGCGCTGCTGTCGCTCGCTGTGGGTTTGCGTCCCAGGG
CGTGGCGGGTCCGGGTTCTATCAGCCGCGAGCCAGATCCCGATTCCGACTGGGAGCCGGAGGAGCGGGAACTCCAGGAAGTGGAGAGCGCTTTGAAACGACAGAAAAAAGCAATGCGATTCCAGAAAA
TTCGAAGGCAAATGGAGGCTCCAGGTGCCCCACCTAGAACACTGACATGGGAAGCCATGGAACAGATCCGGTATTTACATAAGGAATTTGCAGAGTCCTGGTCAGTTCCCAGGTTGGCAGAAGGCTTT
GATGTCAGCACTGATGTTATCCGAAGGGTTTTAAAAAGTAAGTTTATACCCACTTTAGAGCAGAAACTGAAGCAGGACCAAAAGGTCTTGAAAAAAGCGGGGATTACCCGAGTGGTTTGGCAGCTCCC
TGTTTCTGAAGATACGTTGAAGCCGCTCAGTGCAGGCCATCCTATGTCTGGCCCTCTGCTGATGCCAGGGGATGAAGTCTCCTCTAACAGTCAGACTCACAGCAGAGCTTTGAAAGTAAAGTCAAACG
CTCCCAGCGCAGAGGCACAGAAGAAACGGGAAGAAAAGAATAAAAGAATCCGAGTCTTGGCAGAAAGCCTGGTGCCTACCACCACAGCCTTGGGTCATCAGAGAGAGCTTCAGAAATACACCACCCAT
GACTCTGAGGCTGACAGGAGAGCCAACAATCATATATTACCAAGTGTGGAGAAGCTGGAAGAGTTGGAGGCTGGGGAGCCAGGTGACCAGAACTTCAGCAGCAAAGTAGTACAGAAGGGGCGTGAGTT
CTTTGACAGTAACGGAAACTTCCTCTACAGAATTTGAGCCTGGGCCTGGATTTTGGAAATGCCTAGACACAGCTGGACAAGTAGATTTGAAGCTGCCAGCATCGGGCAGCCATTGGCCACTTTGGAGT
AAGAGTCGATGAGGCCAGGATGAGGGTGGATGGCTTACTTATAGGTAGGTCAGACTTCCTGGAGTAAGCCCCATGGATCCCTGTGGATCTAAGGACTCATTCATCTTTGTTCCTTGGAGGTCTTTCTG
TTGAGAACAAGAATTCTAGGTATCCTGTCATGGATTTTTGTGATACCGTGTTGGGAGGAAGTTGAAAGCTTGCTCTTGACCTCTTTTCCTTTCTAATTCCTGAACACTATTCTTGCTCTGTCTAATCA
GTTGGTTTCCTTATGTGCAGAATAAAGTAAAATGGTGCGGTTTGATGCTTGGAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NR_028055

RefSeq Status:

VALIDATED

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	143,622,763 - 143,628,609 (+)	NCBI
mRatBN7.2	1	134,213,502 - 134,219,348 (+)	NCBI
Rnor_6.0	1	142,050,490 - 142,056,336 (+)	NCBI
Rnor_5.0	1	143,003,300 - 143,009,179 (+)	NCBI
RGSC_v3.4	1	136,075,434 - 136,081,313 (+)	RGD
Celera	1	126,273,565 - 126,279,381 (+)	NCBI

Sequence:

show sequence

ATCACCTCCTCGCATCGCAATGGCGCTGTCTCTGAGCCTTTTCTTGGGCGGTCGTGTCCGCGCTGCTGTCGCTCGCTGTGGGTTTGCGTCCCAGGGCGTGGCGGGTCCGGGTTCTATCAGCCGCGAGC
CAGATCCCGATTCCGACTGGGAGCCGGAGGAGCGGGAACTCCAGGAAGTGGAGAGGTACCTGCTTCTTGGCGGGCCCTCAGCCTGAAGCTAGACTTCGCGCCCTGTCGCTCCTTGCGGTACCGGGTAG
CTCCGGGCATCCGGCAGTCAGGTCCGCAGAGGCTCTAGTTTATTTTCAACCTTTGTCTAGGGCGCAGGGGGAAGTGGTCAGCTCCCTTGAGACCCCAGGTCCCGTTGCTTAGTGACGTGTTTCATCAC
CCGTTAGAGAGTTCGGCATGCTTAAACGCTCAGGTGGTTGTAGGTGTAGGATTTCTGGGGCGGTGTACACAGAGTGCTTTAACCTGGCAGACATGGCCGAGCTGCCTTAGCCGCTGACCAGAGCTGGG
CTCTCCAAGATTTAGTCCAAGACTTTTGGAAACACTCGTATTACTTCCACGCATGGCTTTTGCCATTGGTTCTTTCCCCCAGCGCTTTGAAACGACAGAAAAAAGCAATGCGATTCCAGAAAATTCGA
AGGCAAATGGAGGCTCCAGGTGCCCCACCTAGAACACTGACATGGGAAGCCATGGAACAGATCCGGTATTTACATAAGGAATTTGCAGAGTCCTGGTCAGTTCCCAGGTTGGCAGAAGGCTTTGATGT
CAGCACTGATGTTATCCGAAGGGTTTTAAAAAGTAAGTTTATACCCACTTTAGAGCAGAAACTGAAGCAGGACCAAAAGGTCTTGAAAAAAGCGGGGATTACCCGAGTGGTTTGGCAGCTCCCTGTTT
CTGAAGATACGTTGAAGCCGCTCAGTGCAGGCCATCCTATGTCTGGCCCTCTGCTGATGCCAGGGGATGAAGTCTCCTCTAACAGTCAGACTCACAGCAGAGCTTTGAAAGTAAAGTCAAACGCTCCC
AGCGCAGAGGCACAGAAGAAACGGGAAGAAAAGAATAAAAGAATCCGAGTCTTGGCAGAAAGCCTGGTGCCTACCACCACAGCCTTGGGTCATCAGAGAGAGCTTCAGAAATACACCACCCATGACTC
TGAGGCTGACAGGAGAGCCAACAATCATATATTACCAAGTGTGGAGAAGCTGGAAGAGTTGGAGGCTGGGGAGCCAGGTGACCAGAACTTCAGCAGCAAAGTAGTACAGAAGGGGCGTGAGTTCTTTG
ACAGTAACGGAAACTTCCTCTACAGAATTTGAGCCTGGGCCTGGATTTTGGAAATGCCTAGACACAGCTGGACAAGTAGATTTGAAGCTGCCAGCATCGGGCAGCCATTGGCCACTTTGGAGTAAGAG
TCGATGAGGCCAGGATGAGGGTGGATGGCTTACTTATAGGTAGGTCAGACTTCCTGGAGTAAGCCCCATGGATCCCTGTGGATCTAAGGACTCATTCATCTTTGTTCCTTGGAGGTCTTTCTGTTGAG
AACAAGAATTCTAGGTATCCTGTCATGGATTTTTGTGATACCGTGTTGGGAGGAAGTTGAAAGCTTGCTCTTGACCTCTTTTCCTTTCTAATTCCTGAACACTATTCTTGCTCTGTCTAATCAGTTGG
TTTCCTTATGTGCAGAATAAAGTAAAATGGTGCGGTTTGATGCTTGGAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039087627 ⟹ XP_038943555

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	143,622,494 - 143,628,600 (+)	NCBI
mRatBN7.2	1	134,213,235 - 134,218,484 (+)	NCBI

RefSeq Acc Id:

XM_039087630 ⟹ XP_038943558

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	143,622,494 - 143,627,727 (+)	NCBI
mRatBN7.2	1	134,213,235 - 134,218,482 (+)	NCBI

RefSeq Acc Id:

XR_005490669

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	143,622,494 - 143,627,727 (+)	NCBI
mRatBN7.2	1	134,213,235 - 134,218,482 (+)	NCBI

RefSeq Acc Id:

XR_005490672

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	143,622,494 - 143,627,727 (+)	NCBI
mRatBN7.2	1	134,213,235 - 134,218,484 (+)	NCBI


Protein RefSeqs	NP_001029072	(Get FASTA)	NCBI Sequence Viewer
	XP_038943555	(Get FASTA)	NCBI Sequence Viewer
	XP_038943558	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI01927	(Get FASTA)	NCBI Sequence Viewer
	EDM08619	(Get FASTA)	NCBI Sequence Viewer
	EDM08620	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018107
	ENSRNOP00000018107.3
GenBank Protein	Q3T1H2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001029072 ⟸ NM_001033900
- Peptide Label:	precursor
- UniProtKB:	Q3T1H2 (UniProtKB/Swiss-Prot), A6JC92 (UniProtKB/TrEMBL)
- Sequence:	show sequence MALSLSLFLGGRVRAAVARCGFASQGVAGPGSISREPDPDSDWEPEERELQEVESALKRQKKAMRFQKIRRQMEAPGAPPRTLTWEAMEQIRYLHKEFAESWSVPRLAEGFDVSTDVIRRVLKSKFIP TLEQKLKQDQKVLKKAGITRVVWQLPVSEDTLKPLSAGHPMSGPLLMPGDEVSSNSQTHSRALKVKSNAPSAEAQKKREEKNKRIRVLAESLVPTTTALGHQRELQKYTTHDSEADRRANNHILPSVE KLEELEAGEPGDQNFSSKVVQKGREFFDSNGNFLYRI hide sequence

Ensembl Acc Id:

ENSRNOP00000018107 ⟸ ENSRNOT00000018107

RefSeq Acc Id:	XP_038943555 ⟸ XM_039087627
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038943558 ⟸ XM_039087630
- Peptide Label:	isoform X2

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q3T1H2-F1-model_v2	AlphaFold	Q3T1H2	1-293	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13690141

Promoter ID:

EPDNEW_R664

Type:

initiation region

Name:

Ngrn_1

Description:

neugrin, neurite outgrowth associated

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	142,050,488 - 142,050,548	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-58745	BioCyc
Ensembl Genes	ENSRNOG00000013553	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000018107	ENTREZGENE
	ENSRNOT00000018107.6	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7939318	IMAGE-MGC_LOAD
InterPro	NGRN/Rrg9	UniProtKB/Swiss-Prot
KEGG Report	rno:499191	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124865	IMAGE-MGC_LOAD
NCBI Gene	499191	ENTREZGENE
PANTHER	NEUGRIN	UniProtKB/Swiss-Prot
	PTHR13475	UniProtKB/Swiss-Prot
Pfam	Neugrin	UniProtKB/Swiss-Prot
PhenoGen	Ngrn	PhenoGen
RatGTEx	ENSRNOG00000013553	RatGTEx
UniProt	A6JC92	ENTREZGENE, UniProtKB/TrEMBL
	A6JC93_RAT	UniProtKB/TrEMBL
	NGRN_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-05-15	Ngrn	neugrin, neurite outgrowth associated	Ngrn	mesenchymal stem cell protein DSC92	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	Ngrn	mesenchymal stem cell protein DSC92			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar