Slc47a2 (solute carrier family 47 member 2)

Advanced Search (OLGA)

Gene: Slc47a2 (solute carrier family 47 member 2) Rattus norvegicus

Analyze

Symbol:

Slc47a2

Name:

solute carrier family 47 member 2

RGD ID:

1562382

Description:

Predicted to enable organic cation transmembrane transporter activity and polyspecific organic cation:proton antiporter activity. Predicted to be involved in organic cation transport. Predicted to be located in plasma membrane. Predicted to be active in membrane. Orthologous to human SLC47A2 (solute carrier family 47 member 2); PARTICIPATES IN metformin pharmacokinetics pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; Cuprizon.

Type:

protein-coding

RefSeq Status:

INFERRED

Previously known as:

LOC497921; multidrug and toxin extrusion protein 2; RGD1562382; similar to novel protein; solute carrier family 47 (multidrug and toxin extrusion), member 2; solute carrier family 47, member 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SLC47A2 (solute carrier family 47 member 2)	HGNC	OrthoDB
Mus musculus (house mouse):	Slc47a2 (solute carrier family 47, member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SLC47A2 (solute carrier family 47 member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SLC47A2 (solute carrier family 47 member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SLC47A2 (solute carrier family 47 member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SLC47A2 (solute carrier family 47 member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CSTA (cystatin A)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SLC47A2 (solute carrier family 47 member 2)	Alliance	DIOPT (HGNC)
Mus musculus (house mouse):	Slc47a2 (solute carrier family 47, member 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc47a1 (solute carrier family 47 member 1)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	ERC1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	slc47a3	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	slc47a4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	YDR338C	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	slc47a2.2	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	slc47a2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoInspector\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	46,490,262 - 46,532,954 (-)	NCBI		GRCr8
mRatBN7.2	10	45,990,806 - 46,033,937 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	45,991,095 - 46,033,904 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	50,694,459 - 50,736,754 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	50,184,983 - 50,227,281 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	45,688,403 - 45,730,701 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	47,587,909 - 47,631,373 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	47,588,497 - 47,630,799 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	47,363,337 - 47,404,085 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	47,464,182 - 47,512,360 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	45,244,241 - 45,286,221 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

Meckel Syndrome 9 (ISO)

Potocki-Lupski syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(R,R)-tramadol (ISO)

(S)-nicotine (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (ISO)

2-Ethyl-1,3-hexanediol (ISO)

2-palmitoylglycerol (ISO)

3-[[oxo(pyridin-4-yl)methyl]hydrazo]-N-(phenylmethyl)propanamide (ISO)

3-Amino-1-methyl-5H-pyrido[4,3-b]indole (ISO)

agmatine (ISO)

aldehydo-D-glucose (ISO)

amantadine (ISO)

amiloride (ISO)

amitriptyline (ISO)

atropine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

caffeine (ISO)

cannabidiol (ISO)

chloramphenicol (ISO)

cimetidine (ISO)

cinchonidine (ISO)

cinchonine (ISO)

clonidine (ISO)

clonidine (amino form) (ISO)

clonidine (imino form) (ISO)

clothianidin (ISO)

creatinine (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

D-glucose (ISO)

dextran sulfate (ISO)

epoxiconazole (ISO)

famotidine (ISO)

fructose (ISO)

fulvestrant (ISO)

genistein (ISO)

glucose (ISO)

Guanfacine (ISO)

guanidine (ISO)

histamine (ISO)

imiquimod (ISO)

ketoconazole (ISO)

lead(0) (ISO)

mercury dichloride (ISO)

metformin (ISO)

methylmercury chloride (ISO)

midodrine (ISO)

N-methyl-4-phenylpyridinium (ISO)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (ISO)

naloxone (ISO)

nickel atom (ISO)

nicotine (ISO)

NMN zwitterion (ISO)

Ondansetron (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

phenformin (ISO)

phentolamine (ISO)

procainamide (ISO)

proguanil (ISO)

propranolol (ISO)

pyrimethamine (ISO)

quinidine (ISO)

quinine (ISO)

ranitidine (ISO)

scopolamine (ISO)

serotonin (ISO)

silicon dioxide (ISO)

sotorasib (ISO)

sulfadimethoxine (ISO)

sulfamerazine (ISO)

tacrine (ISO)

tetraethylammonium (ISO)

thioacetamide (EXP)

ticlopidine (ISO)

titanium dioxide (ISO)

tramadol (ISO)

trametinib (ISO)

trichlormethiazide (ISO)

trimethoprim (ISO)

triptonide (ISO)

tropan-3alpha-yl 3-hydroxy-2-phenylpropanoate (ISO)

tyramine (ISO)

valproic acid (ISO)

verapamil (ISO)

zafirlukast (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

organic cation transport (ISO)

proton transmembrane transport (IEA)

xenobiotic detoxification by transmembrane export across the plasma membrane (IEA)

Cellular Component

membrane (IBA)

plasma membrane (ISO)

Molecular Function

antiporter activity (ISO)

organic cation transmembrane transporter activity (ISO)

polyspecific organic cation:proton antiporter activity (ISO)

transmembrane transporter activity (IBA)

xenobiotic transmembrane transporter activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

metformin pharmacokinetics pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Metformin pathways: pharmacokinetics and pharmacodynamics.	Gong L, etal., Pharmacogenet Genomics. 2012 Nov;22(11):820-7. doi: 10.1097/FPC.0b013e3283559b22.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Comprehensive gene review and curation	RGD comprehensive gene curation

Genomics

Comparative Map Data

Slc47a2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	46,490,262 - 46,532,954 (-)	NCBI		GRCr8
mRatBN7.2	10	45,990,806 - 46,033,937 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	45,991,095 - 46,033,904 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	50,694,459 - 50,736,754 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	50,184,983 - 50,227,281 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	45,688,403 - 45,730,701 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	47,587,909 - 47,631,373 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	47,588,497 - 47,630,799 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	47,363,337 - 47,404,085 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	47,464,182 - 47,512,360 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	10	45,244,241 - 45,286,221 (-)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

SLC47A2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	19,678,317 - 19,718,979 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	19,678,288 - 19,718,979 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	19,581,630 - 19,622,292 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	19,522,220 - 19,560,635 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	17	16,994,973 - 17,033,389 (-)	NCBI		Celera
Cytogenetic Map	17	p11.2	NCBI
HuRef	17	18,960,725 - 18,998,919 (-)	NCBI		HuRef
CHM1_1	17	19,590,477 - 19,628,892 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	17	19,626,936 - 19,667,598 (-)	NCBI		T2T-CHM13v2.0

Slc47a2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	61,192,453 - 61,233,686 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	61,192,457 - 61,233,686 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	61,301,627 - 61,342,860 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	61,301,631 - 61,342,860 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	61,115,133 - 61,156,362 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	61,117,826 - 61,159,055 (-)	NCBI		MGSCv36	mm8
MGSCv36	11	61,731,316 - 61,772,552 (-)	NCBI		MGSCv36	mm8
Cytogenetic Map	11	B2	NCBI
cM Map	11	37.96	NCBI

SLC47A2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	54,668,935 - 54,716,956 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	59,480,780 - 59,528,679 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	31,412,990 - 31,454,667 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	36,560,835 - 36,599,133 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	36,560,881 - 36,599,133 (+)	Ensembl	panpan1.1		panPan2

SLC47A2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	40,491,306 - 40,515,430 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	40,491,933 - 40,540,136 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	40,633,185 - 40,659,630 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	40,597,303 - 40,623,761 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	40,597,930 - 40,620,090 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	40,568,675 - 40,595,116 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	40,514,315 - 40,540,758 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	40,706,986 - 40,733,428 (+)	NCBI		UU_Cfam_GSD_1.0

SLC47A2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	59,920,770 - 59,935,894 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	59,919,553 - 59,935,895 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	62,609,846 - 62,627,746 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SLC47A2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	18,240,876 - 18,281,634 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	18,242,392 - 18,279,930 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	2,566,025 - 2,606,428 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Slc47a2
242 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	121
Count of miRNA genes:	101
Interacting mature miRNAs:	107
Transcripts:	ENSRNOT00000057907
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1354614	Hpcl1	Hepatic cholesterol level QTL 1	3.3		liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	35392267	51793994	Rat
631532	Cm50	Cardiac mass QTL 50	6.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	17907113	51786432	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1600371	Mcs21	Mammary carcinoma susceptibility QTL 21	3		mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	28875650	52200160	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat

Markers in Region

RH134186

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	46,034,403 - 46,034,594 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	47,631,710 - 47,631,900	NCBI	Rnor6.0
Rnor_5.0	10	47,404,996 - 47,405,186	UniSTS	Rnor5.0
RGSC_v3.4	10	47,513,271 - 47,513,461	UniSTS	RGSC3.4
Celera	10	45,287,132 - 45,287,322	UniSTS
RH 3.4 Map	10	528.19	UniSTS
Cytogenetic Map	10	q22	UniSTS
Cytogenetic Map	10	q22-q23	UniSTS

BI288337

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	46,033,689 - 46,033,779 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	47,630,996 - 47,631,085	NCBI	Rnor6.0
Rnor_5.0	10	47,404,282 - 47,404,371	UniSTS	Rnor5.0
RGSC_v3.4	10	47,512,557 - 47,512,646	UniSTS	RGSC3.4
Celera	10	45,286,418 - 45,286,507	UniSTS
RH 3.4 Map	10	530.09	UniSTS
Cytogenetic Map	10	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	7	49	113	80	79	54	19	54	6	203	91	93	45	60	25

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191920	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017597448	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086568	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039086569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000057907 ⟹ ENSRNOP00000054717

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	45,991,095 - 46,033,904 (-)	Ensembl
Rnor_6.0 Ensembl	10	47,588,497 - 47,630,799 (-)	Ensembl

RefSeq Acc Id:

NM_001191920 ⟹ NP_001178849

RefSeq Status:

INFERRED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	46,490,832 - 46,532,954 (-)	NCBI
mRatBN7.2	10	45,991,370 - 46,033,493 (-)	NCBI
Rnor_6.0	10	47,588,497 - 47,630,799 (-)	NCBI
Rnor_5.0	10	47,363,337 - 47,404,085 (-)	NCBI
Celera	10	45,244,241 - 45,286,221 (-)	NCBI

Sequence:

show sequence

ATGGAGCCGGCCGAGGACAGCCTGGGCGCCGCCATCCAGCCCCCGGAGCTGGCCCCGGTACCGG
AGCGCAGCCTGCGGATCCTGCTGGGCCTGCGAGAAGCGCTGTCCTCCGACGTGCGGCAGGAAGC
GGCGGCGCTGGCGGCGCTCGCGGGCCCGGTGTTCCTGGCGCAGCTGATGATCTTTCTCATCAGC
ATCGTCAGTTCCATCTTCTGCGGACACCTGGGCAAAGTCGAGCTGGACGCCGTGACACTCGCTG
TTTCCGTTGTGAATGTCACTGGAATTTCAGTCGGGACTGGCTTAGCCTCGGCTTGTGACACACT
GATGTCTCAGTCCTTTGGAGGCAAGAACTTGAAGCGCGTGGGGGTCATACTCCAAAGGGGCATC
CTCATCCTGCTGCTCTGCTGCTTCCCTTGCTGGGCCATCTTCCTCAACACCGAGCGCCTTCTGC
TGTTCCTAAGGCAGGATCCAGAAGTTGCCAGGCTAGCCCAGGTTTATGTGATGATTTGCATCCC
TGCCCTTCCTGCGGCATTCCTGTTCCAGCTACAGACGCGGTATTTACAGAGCCAGGGCATCATT
ATGCCCCAAGTTATCGTTGGGATCGCAGCAAATGTTGTCAACGTGGGCATGAATGCCTTCCTGC
TGTATGCCTTGGACCTCGGAGTGGTAGGGTCGGCCTGGGCCAACACCACCTCCCAGTTCTTCCT
GTCCGCCCTGCTTTTTCTCTACGTGTGGTGGAAGGGAATCCACATCCACACCTGGGGAGGGTGG
ACAAGGGAGTGCTTCCAGGAGTGGAGCTCCTACACCCGCCTGGCCATCCCCAGCATGTTCATGG
TGTGCATCGAGTGGTGGACCTTCGAGATTGGGACCTTCCTTGCAGGCCTTGTTAATGTGACAGA
ACTGGGAGCCCAGGCCGTCATCTATGAGCTAGCTTCTGTTGCCTACATGGTGCCCTTTGGCTTT
GGTGTGGCTGCCAGTGTCCGAGTGGGCAATGCTCTGGGGGCAGGGAATGCTGACCAGGCCCGGT
GTTCCTGTACCACTGTTCTCCTGTGTACTGGTGTCTGTGCGCTCCTGGTGGGAATTCTGCTTGC
AGCCTTGAAGGACGTGGTCGCCTACGTCTTCACCAATGACAAGGACATAATTTCCCTCGTGAGT
CAAGTGATGCCCATTTTTGCTCCCTTTCATCTCTTTGATGCACTTGCAGGCACCTGTGGCGGGG
TCCTGAGAGGTACAGGAAAACAAAAGATAGGTGCTGTCCTGAACGCCATTGGTTACTACGGGTT
TGGTTTTCCCATCGGTGTGTCACTGATGTTTGCTGCTAAACTTGGGATAATAGGCCTCTGGGCT
GGGCTGATAGTCTGTGTCTTCTTCCAAGCCCTCTCCTATCTAATCTACATCCTGAGGACAAACT
GGAACAGAGTCGCAGAGCAGGCACAGGTTCGAGCTGGGCTAAAAAGCAACAAGGAGATGATTCC
CACCCCAGCAGATCTGCCCATCTTGGAGAGAGAAGTTATCGACGGAGTGATTTTGCCTGATATC
ATCAGACCAGAGAGCCAGACTGGCCAGCTGGTGGTGGAAGAAAACAGCCAGTGCGTGGTGCCCA
CCGTCGGGGAGGTCTTGACCGGGAGGCAGCTGGTTGTCTACCGTGGGACGGCTCTGATTGTTTC
TATTGCTGTCCTCATAGCAGGGATTGTTGTGCGAGTTATCAATGACCGTGGCTGA

hide sequence

RefSeq Acc Id:

XM_039086568 ⟹ XP_038942496

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	46,490,262 - 46,532,954 (-)	NCBI
mRatBN7.2	10	45,990,806 - 46,033,937 (-)	NCBI

RefSeq Acc Id:

XM_039086569 ⟹ XP_038942497

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	46,490,262 - 46,532,954 (-)	NCBI
mRatBN7.2	10	45,991,409 - 46,033,937 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178849	(Get FASTA)	NCBI Sequence Viewer
	XP_038942496	(Get FASTA)	NCBI Sequence Viewer
	XP_038942497	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000054717.5

RefSeq Acc Id:

NP_001178849 ⟸ NM_001191920

- UniProtKB:

D4A4W2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MEPAEDSLGAAIQPPELAPVPERSLRILLGLREALSSDVRQEAAALAALAGPVFLAQLMIFLIS
IVSSIFCGHLGKVELDAVTLAVSVVNVTGISVGTGLASACDTLMSQSFGGKNLKRVGVILQRGI
LILLLCCFPCWAIFLNTERLLLFLRQDPEVARLAQVYVMICIPALPAAFLFQLQTRYLQSQGII
MPQVIVGIAANVVNVGMNAFLLYALDLGVVGSAWANTTSQFFLSALLFLYVWWKGIHIHTWGGW
TRECFQEWSSYTRLAIPSMFMVCIEWWTFEIGTFLAGLVNVTELGAQAVIYELASVAYMVPFGF
GVAASVRVGNALGAGNADQARCSCTTVLLCTGVCALLVGILLAALKDVVAYVFTNDKDIISLVS
QVMPIFAPFHLFDALAGTCGGVLRGTGKQKIGAVLNAIGYYGFGFPIGVSLMFAAKLGIIGLWA
GLIVCVFFQALSYLIYILRTNWNRVAEQAQVRAGLKSNKEMIPTPADLPILEREVIDGVILPDI
IRPESQTGQLVVEENSQCVVPTVGEVLTGRQLVVYRGTALIVSIAVLIAGIVVRVINDRG

hide sequence

Ensembl Acc Id:

ENSRNOP00000054717 ⟸ ENSRNOT00000057907

RefSeq Acc Id:	XP_038942496 ⟸ XM_039086568
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038942497 ⟸ XM_039086569
- Peptide Label:	isoform X2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A4W2-F1-model_v2	AlphaFold	D4A4W2	1-571	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1562382	AgrOrtholog
BioCyc Gene	G2FUF-24809	BioCyc
Ensembl Genes	ENSRNOG00000038055	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000057907.5	UniProtKB/TrEMBL
InterPro	MatE	UniProtKB/TrEMBL
	MATE_euk	UniProtKB/TrEMBL
KEGG Report	rno:497921	UniProtKB/TrEMBL
NCBI Gene	497921	ENTREZGENE
PANTHER	MULTIDRUG AND TOXIN EXTRUSION PROTEIN 2	UniProtKB/TrEMBL
	MULTIDRUG RESISTANCE PROTEIN	UniProtKB/TrEMBL
Pfam	MatE	UniProtKB/TrEMBL
PhenoGen	Slc47a2	PhenoGen
RatGTEx	ENSRNOG00000038055	RatGTEx
UniProt	D4A4W2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-24	Slc47a2	solute carrier family 47 member 2	Slc47a2	solute carrier family 47 (multidrug and toxin extrusion), member 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-08-02	Slc47a2	solute carrier family 47 (multidrug and toxin extrusion), member 2	Slc47a2	solute carrier family 47, member 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-29	Slc47a2	solute carrier family 47, member 2	RGD1562382_predicted	similar to novel protein (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1562382_predicted	similar to novel protein (predicted)	LOC497921	similar to novel protein	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC497921	similar to novel protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations