Advanced Search (OLGA)

Gene: Actrt3 (actin-related protein T3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Actrt3

Name:

actin-related protein T3

RGD ID:

1561457

Description:

Predicted to be located in male germ cell nucleus. Predicted to be active in actin cytoskeleton. Orthologous to human ACTRT3 (actin related protein T3); INTERACTS WITH 3,7-dihydropurine-6-thione; acetamide; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

actin related protein M1; Arpm1; LOC365763; RGD1561457; similar to Actin related protein M1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ACTRT3 (actin related protein T3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Actrt3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Actrt3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ACTRT3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ACTRT3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Actrt3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ACTRT3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ACTRT3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Actrt3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Actrt3 (actin related protein T3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ACTRT3 (actin related protein T3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Arp53D	Alliance	DIOPT (Ensembl Compara\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	114,727,534 - 114,729,561 (+)	NCBI		GRCr8
mRatBN7.2	2	112,799,038 - 112,801,065 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	112,799,011 - 112,801,075 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	119,450,402 - 119,452,350 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	117,562,964 - 117,564,912 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	112,279,989 - 112,281,964 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	116,416,561 - 116,418,521 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	116,416,507 - 116,418,582 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	136,110,360 - 136,112,320 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	117,217,836 - 117,219,796 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	107,977,947 - 107,979,907 (+)	NCBI		Celera
Cytogenetic Map	2	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Actrt3	Rat	autosomal dominant dyskeratosis congenita 1		ISO	RGD:1607001	8554872	ClinVar Annotator: match by term: Dyskeratosis congenita, autosomal dominant 1	ClinVar	PMID:28492532
Actrt3	Rat	Fanconi-Bickel syndrome		ISO	RGD:1607001	8554872	ClinVar Annotator: match by term: Fanconi-Bickel syndrome	ClinVar	PMID:28492532

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Actrt3	Rat	1,2-dichloroethane	decreases expression	ISO	RGD:1557481	6480464	ethylene dichloride results in decreased expression of ACTRT3 mRNA	CTD	PMID:28960355
Actrt3	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:1557481	6480464	1,2-Dimethylhydrazine results in decreased expression of ACTRT3 mRNA	CTD	PMID:22206623
Actrt3	Rat	3,7-dihydropurine-6-thione	increases expression	EXP		6480464	Mercaptopurine results in increased expression of ACTRT3 mRNA	CTD	PMID:23358152
Actrt3	Rat	5-aza-2'-deoxycytidine	multiple interactions	ISO	RGD:1607001	6480464	Decitabine inhibits the reaction [Smoke results in decreased expression of ACTRT3 mRNA]	CTD	PMID:21095227
Actrt3	Rat	acetamide	increases expression	EXP		6480464	acetamide results in increased expression of ACTRT3 mRNA	CTD	PMID:31881176
Actrt3	Rat	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of ACTRT3 mRNA	CTD	PMID:23630614
Actrt3	Rat	arsenite(3-)	multiple interactions	ISO	RGD:1607001	6480464	arsenite promotes the reaction [G3BP1 protein binds to ACTRT3 mRNA]	CTD	PMID:32406909
Actrt3	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:1607001	6480464	Benzo(a)pyrene results in increased methylation of ACTRT3 exon	CTD	PMID:27901495
Actrt3	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:1557481	6480464	Diethylhexyl Phthalate results in decreased expression of ACTRT3 mRNA	CTD	PMID:34319233
Actrt3	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of ACTRT3 mRNA	CTD	PMID:25181051\|PMID:30816183\|PMID:32528016
Actrt3	Rat	cadmium atom	multiple interactions	ISO	RGD:1607001	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ACTRT3 more ...	CTD	PMID:35301059
Actrt3	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1607001	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of ACTRT3 more ...	CTD	PMID:35301059
Actrt3	Rat	cannabidiol	decreases expression	ISO	RGD:1607001	6480464	Cannabidiol results in decreased expression of ACTRT3 mRNA	CTD	PMID:33244087
Actrt3	Rat	CGP 52608	multiple interactions	ISO	RGD:1607001	6480464	CGP 52608 promotes the reaction [RORA protein binds to ACTRT3 gene]	CTD	PMID:28238834
Actrt3	Rat	cisplatin	decreases expression	ISO	RGD:1607001	6480464	Cisplatin results in decreased expression of ACTRT3 mRNA	CTD	PMID:27392435
Actrt3	Rat	genistein	decreases expression	ISO	RGD:1607001	6480464	Genistein results in decreased expression of ACTRT3 mRNA	CTD	PMID:26865667
Actrt3	Rat	glyphosate	decreases expression	EXP		6480464	Glyphosate results in decreased expression of ACTRT3 mRNA	CTD	PMID:38314887
Actrt3	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1607001	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of ACTRT3 mRNA	CTD	PMID:35811015
Actrt3	Rat	mercaptopurine	increases expression	EXP		6480464	Mercaptopurine results in increased expression of ACTRT3 mRNA	CTD	PMID:23358152
Actrt3	Rat	methylmercury chloride	decreases expression	ISO	RGD:1607001	6480464	methylmercuric chloride results in decreased expression of ACTRT3 mRNA	CTD	PMID:28001369
Actrt3	Rat	methylparaben	decreases expression	ISO	RGD:1607001	6480464	methylparaben results in decreased expression of ACTRT3 mRNA	CTD	PMID:31745603
Actrt3	Rat	paracetamol	increases expression	ISO	RGD:1607001	6480464	Acetaminophen results in increased expression of ACTRT3 mRNA	CTD	PMID:21420995
Actrt3	Rat	paracetamol	decreases expression	ISO	RGD:1607001	6480464	Acetaminophen results in decreased expression of ACTRT3 mRNA	CTD	PMID:26690555
Actrt3	Rat	purine-6-thiol	increases expression	EXP		6480464	Mercaptopurine results in increased expression of ACTRT3 mRNA	CTD	PMID:23358152
Actrt3	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1607001	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of ACTRT3 mRNA	CTD	PMID:35811015
Actrt3	Rat	sodium fluoride	increases expression	ISO	RGD:1557481	6480464	Sodium Fluoride results in increased expression of ACTRT3 protein	CTD	PMID:28918527
Actrt3	Rat	sunitinib	decreases expression	ISO	RGD:1607001	6480464	Sunitinib results in decreased expression of ACTRT3 mRNA	CTD	PMID:31533062
Actrt3	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of ACTRT3 mRNA	CTD	PMID:23411599
Actrt3	Rat	titanium dioxide	decreases methylation	ISO	RGD:1557481	6480464	titanium dioxide results in decreased methylation of ACTRT3 enhancer; titanium dioxide results in decreased methylation more ...	CTD	PMID:35295148
Actrt3	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of ACTRT3 mRNA	CTD	PMID:33387578
Actrt3	Rat	valproic acid	decreases expression	ISO	RGD:1607001	6480464	Valproic Acid results in decreased expression of ACTRT3 mRNA	CTD	PMID:29154799
Actrt3	Rat	valproic acid	affects expression	ISO	RGD:1607001	6480464	Valproic Acid affects the expression of ACTRT3 mRNA	CTD	PMID:25979313
Actrt3	Rat	valproic acid	decreases expression	EXP		6480464	Valproic Acid results in decreased expression of ACTRT3 mRNA	CTD	PMID:35594946

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Actrt3	Rat	actin cytoskeleton	is_active_in	IBA	CGD:CAL0000191211\|FB:FBgn0011743\|MGI:87906\|MGI:87909\|PANTHER:PTN002631484\|PomBase:SPBC32H8.12c\|RGD:1304556\|RGD:621676\|RGD:628837\|SGD:S000001855\|UniProtKB:P60709\|UniProtKB:P63261\|UniProtKB:P68032\|UniProtKB:P68133\|UniProtKB:Q8I4X0\|UniProtKB:Q8ILW9\|WB:WBGene00000063\|WB:WBGene00000064\|WB:WBGene00000066\|WB:WBGene00000067\|dictyBase:DDB_G0269234\|dictyBase:DDB_G0275023\|dictyBase:DDB_G0289487\|dictyBase:DDB_G0289811	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Actrt3	Rat	male germ cell nucleus	located_in	ISO	RGD:1557481	1624291	PMID:18692047	RGD	PMID:18692047
Actrt3	Rat	male germ cell nucleus	located_in	IEA	UniProtKB:Q8BXF8\|ensembl:ENSMUSP00000048360	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Actrt3	Rat	protein binding	enables	ISO	RGD:1607001	1624291	UniProtKB:Q9H2J4 PMID:33961781	RGD	PMID:33961781
Actrt3	Rat	protein binding	enables	ISO	RGD:1557481	1624291	UniProtKB:Q9DAD6 PMID:18692047	RGD	PMID:18692047

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:18692047

Actrt3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	114,727,534 - 114,729,561 (+)	NCBI		GRCr8
mRatBN7.2	2	112,799,038 - 112,801,065 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	112,799,011 - 112,801,075 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	119,450,402 - 119,452,350 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	117,562,964 - 117,564,912 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	112,279,989 - 112,281,964 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	116,416,561 - 116,418,521 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	116,416,507 - 116,418,582 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	136,110,360 - 136,112,320 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	117,217,836 - 117,219,796 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	107,977,947 - 107,979,907 (+)	NCBI		Celera
Cytogenetic Map	2	q24	NCBI

ACTRT3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	169,766,921 - 169,769,561 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	169,766,921 - 169,769,561 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	169,484,709 - 169,487,349 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	170,967,407 - 170,970,377 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	167,883,851 - 167,885,293 (-)	NCBI		Celera
Cytogenetic Map	3	q26.2	NCBI
HuRef	3	166,856,974 - 166,857,553 (-)	NCBI		HuRef
CHM1_1	3	169,447,787 - 169,450,725 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	172,550,873 - 172,553,662 (-)	NCBI		T2T-CHM13v2.0

Actrt3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	30,651,221 - 30,654,021 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	30,651,222 - 30,654,088 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	30,597,073 - 30,599,870 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	30,597,073 - 30,599,939 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	30,495,995 - 30,498,792 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	30,787,911 - 30,790,708 (-)	NCBI		MGSCv36	mm8
Celera	3	30,509,748 - 30,511,432 (-)	NCBI		Celera
Cytogenetic Map	3	A3	NCBI
cM Map	3	14.27	NCBI

Actrt3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	27,024 - 30,182 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955420	28,183 - 30,207 (-)	NCBI	ChiLan1.0	ChiLan1.0

ACTRT3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	167,660,545 - 167,663,668 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	167,653,941 - 167,668,143 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	166,780,316 - 166,783,758 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	174,834,118 - 174,837,345 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	174,834,118 - 174,837,345 (-)	Ensembl	panpan1.1		panPan2

ACTRT3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	34,372,244 - 34,374,702 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	34,370,536 - 34,375,174 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	43,448,521 - 43,450,975 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	34,450,890 - 34,453,352 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	34,450,091 - 34,453,299 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	34,397,365 - 34,399,805 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	34,364,425 - 34,366,880 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	34,629,087 - 34,631,547 (-)	NCBI		UU_Cfam_GSD_1.0

Actrt3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	100,972,398 - 100,974,155 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936593	2,647,841 - 2,650,347 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936593	2,647,740 - 2,649,658 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ACTRT3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	108,428,986 - 108,435,383 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	108,429,745 - 108,434,366 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	117,156,398 - 117,158,708 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ACTRT3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	19,621,332 - 19,629,179 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	19,622,376 - 19,629,592 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666063	28,432,472 - 28,436,503 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Actrt3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	47,809,519 - 47,822,172 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	47,819,435 - 47,823,471 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Actrt3
8 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	167
Count of miRNA genes:	131
Interacting mature miRNAs:	142
Transcripts:	ENSRNOT00000030700
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	43162366	148478373	Rat
631566	Bp90	Blood pressure QTL 90		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	102803808	147803808	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	81018907	126018907	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	82345893	130923501	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
10755499	Bp389	Blood pressure QTL 389	2.61		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	18960362	228801039	Rat
152025242	Bw191	Body weight QTL 191	3.62		body mass (VT:0001259)		2	38573329	122609194	Rat
1598862	Glom9	Glomerulus QTL 9	3.5		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	2	92337601	137337601	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	76539322	150540526	Rat
1598863	Cm65	Cardiac mass QTL 65	2.3		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	92337601	137337601	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	25413423	143657569	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
2300165	Bmd49	Bone mineral density QTL 49	4.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	bone mineral density (CMO:0001226)	2	88862519	133862519	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
2300170	Bmd45	Bone mineral density QTL 45	12.1	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	157142209	Rat
7411551	Bw131	Body weight QTL 131	29.6	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	67942638	112942638	Rat
8662836	Vetf8	Vascular elastic tissue fragility QTL 8	0.66		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	104559726	149559726	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	25413652	157142078	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	26917817	136917119	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	78665616	143657569	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	25413423	157142209	Rat
2300185	Bmd46	Bone mineral density QTL 46	8.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	2	88862519	133862519	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	80270434	125270434	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	157142209	Rat
1581552	Pur12	Proteinuria QTL 12	5.19	0.0009	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	2	112103657	148076632	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	72532993	157142209	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
7207808	Bmd89	Bone mineral density QTL 89	4.1		femur strength trait (VT:0010010)	femoral neck ultimate force (CMO:0001703)	2	88862519	133862519	Rat
1558648	Smcn1	Smooth muscle cell number QTL 1		0.039	blood vessel smooth muscle cell quantity (VT:0010525)	aorta smooth muscle cell count per unit vessel length (CMO:0001646)	2	59134147	127460910	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
152025206	Hrtrt23	Heart rate QTL 23	5.98		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
152025204	Hrtrt22	Heart rate QTL 22	5.6		heart pumping trait (VT:2000009)		2	28484589	169504100	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	59324377	141596857	Rat
1354603	Bp243	Blood pressure QTL 243	3.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	26917817	127469484	Rat

BF394048

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	112,800,826 - 112,800,959 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	116,418,327 - 116,418,459	NCBI	Rnor6.0
Rnor_5.0	2	136,112,126 - 136,112,258	UniSTS	Rnor5.0
RGSC_v3.4	2	117,219,602 - 117,219,734	UniSTS	RGSC3.4
Celera	2	107,979,713 - 107,979,845	UniSTS
RH 3.4 Map	2	714.4	UniSTS
Cytogenetic Map	2	q24	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	5	32	107	78	82	51	25	51	5	172	71	93	39	59	31


RefSeq Transcripts	NM_001108942	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000030700 ⟹ ENSRNOP00000038451

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	112,799,011 - 112,801,075 (+)	Ensembl
Rnor_6.0 Ensembl	2	116,416,507 - 116,418,582 (+)	Ensembl

RefSeq Acc Id:

NM_001108942 ⟹ NP_001102412

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	114,727,534 - 114,729,561 (+)	NCBI
mRatBN7.2	2	112,799,038 - 112,801,065 (+)	NCBI
Rnor_6.0	2	116,416,561 - 116,418,521 (+)	NCBI
Rnor_5.0	2	136,110,360 - 136,112,320 (+)	NCBI
RGSC_v3.4	2	117,217,836 - 117,219,796 (+)	RGD
Celera	2	107,977,947 - 107,979,907 (+)	RGD

Sequence:

show sequence

ATGAGCAGCTACCAGCCACCAGTGGTGATCGACAACGGCTCGGGAATGATCAAGGCGGGCCTGGCTGGGGCCCGGGAGCCCCAGTTCGTCTACCCGAATATTCTGGGCCGGACCAAGAACCACAGCCC
TGCGGCTGACAGCAAGCAGGAGCTGCGTGTGGGTGATCAAGCGCAGGAGCGCAGGAGCTTCCTGTCCATCAGCTATCCAGTGGAACGGGGTCTCATTTCTTCCTGGGGAGACATGGAGATCATGTGGA
AACATATCTATGACTACAACCTGAACCTGAACCCCAGCGATGGCCCGGTCTTGGTTACAGAACCGGCTCTCAACCCATTGGCAGACCGGCAGCACATCTCCGAAGTGTTTTTTGAAAATCTGGGAGTC
CCTGCCTTCTATATGTCTGTCCAGGCTGTGTTGGCTCTGTTTGCTGCTGGTTTTACCACTGGCCTTGTGCTGAACTCAGGTGCTGGGATTACTCAGTGTGTGCCCATCTTTGAGGGTTACTGCCTATC
ACATGGTGTAAAACAGCTAAACGTGGCAGGAATTGACCTCACCAACTACCTCATGATGTTGCTGAAGGATGATGGTATCATGCTGCTTAGAACTGGGGACAGAAAAACTGTCACAGACATTAAGGAGA
ATGCTTGCTATGTGGCAATGAACTATGATGAGGAAATGGTCAAGGAATCTAACGTAGAGAAAATGTACACCCTCCCTGACGGGAAGACTGTAAAACTCCGTAAGCAGGTATTCCGCTGCCCGGAGGCC
CTCTTCTCTCCGTATCTTGTGAATGTGGATGCTCCTGGCATCGACAGGATATGCTTCAGCAGTATAATGAAGTGTGATGCAGATCTCAGGAACTCCTTCTTCTCCAACATCATCCTTTCCGGAGGATC
GACCTCTTTTCCTGGTTTAGATAAGCGACTCATTAAGGATGTGGCAAAGTTGGCACCTGCCAATACCACCGTGCAGGTTGTAGCTCCTCCTGAAAGGAAAATTTCGGTGTGGATGGGGGGATCTATTC
TTGCATCCTTGTCTGCCTTCCAAGACATGTGGATCACGGCTGCAGAATTCGAAGAAGTGGGACCCAACATTGTACACCAGAGGTGCTTCTGA

hide sequence


Protein RefSeqs	NP_001102412	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM01170	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000038451
	ENSRNOP00000038451.3

RefSeq Acc Id:

NP_001102412 ⟸ NM_001108942

- UniProtKB:

D4ABA6 (UniProtKB/TrEMBL), A6IHM2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSSYQPPVVIDNGSGMIKAGLAGAREPQFVYPNILGRTKNHSPAADSKQELRVGDQAQERRSFLSISYPVERGLISSWGDMEIMWKHIYDYNLNLNPSDGPVLVTEPALNPLADRQHISEVFFENLGV
PAFYMSVQAVLALFAAGFTTGLVLNSGAGITQCVPIFEGYCLSHGVKQLNVAGIDLTNYLMMLLKDDGIMLLRTGDRKTVTDIKENACYVAMNYDEEMVKESNVEKMYTLPDGKTVKLRKQVFRCPEA
LFSPYLVNVDAPGIDRICFSSIMKCDADLRNSFFSNIILSGGSTSFPGLDKRLIKDVAKLAPANTTVQVVAPPERKISVWMGGSILASLSAFQDMWITAAEFEEVGPNIVHQRCF

hide sequence

Ensembl Acc Id:

ENSRNOP00000038451 ⟸ ENSRNOT00000030700

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4ABA6-F1-model_v2	AlphaFold	D4ABA6	1-371	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13691278

Promoter ID:

EPDNEW_R1803

Type:

single initiation site

Name:

Actrt3_1

Description:

actin-related protein T3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	116,416,538 - 116,416,598	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-53450	BioCyc
Ensembl Genes	ENSRNOG00000027908	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000030700	ENTREZGENE
	ENSRNOT00000030700.5	UniProtKB/TrEMBL
Gene3D-CATH	3.30.420.40	UniProtKB/TrEMBL
	Actin, Chain A, domain 4	UniProtKB/TrEMBL
InterPro	Actin-like	UniProtKB/TrEMBL
	ATPase_NBD	UniProtKB/TrEMBL
KEGG Report	rno:365763	UniProtKB/TrEMBL
NCBI Gene	365763	ENTREZGENE
PANTHER	Actin_like	UniProtKB/TrEMBL
Pfam	Actin	UniProtKB/TrEMBL
PhenoGen	Actrt3	PhenoGen
PRINTS	ACTIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000027908	RatGTEx
SMART	ACTIN	UniProtKB/TrEMBL
Superfamily-SCOP	SSF53067	UniProtKB/TrEMBL
UniProt	A6IHM2	ENTREZGENE, UniProtKB/TrEMBL
	D4ABA6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-07-13	Actrt3	actin-related protein T3	Arpm1	actin related protein M1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-29	Arpm1	actin related protein M1	RGD1561457_predicted	similar to Actin related protein M1 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1561457_predicted	similar to Actin related protein M1 (predicted)	LOC365763	similar to Actin related protein M1	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC365763	similar to Actin related protein M1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar