Advanced Search (OLGA)

Gene: Actrt3 (actin-related protein T3) Rattus norvegicus

Analyze

Symbol:

Actrt3

Name:

actin-related protein T3

RGD ID:

1561457

Description:

Predicted to be located in male germ cell nucleus. Predicted to be active in actin cytoskeleton. Orthologous to human ACTRT3 (actin related protein T3); INTERACTS WITH 3,7-dihydropurine-6-thione; acetamide; aflatoxin B1.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

actin related protein M1; Arpm1; LOC365763; RGD1561457; similar to Actin related protein M1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ACTRT3 (actin related protein T3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Actrt3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Actrt3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ACTRT3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ACTRT3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Actrt3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ACTRT3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ACTRT3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Actrt3 (actin related protein T3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Actrt3 (actin related protein T3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	ACTRT3 (actin related protein T3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Arp53D	Alliance	DIOPT (Ensembl Compara\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	114,727,534 - 114,729,561 (+)	NCBI		GRCr8
mRatBN7.2	2	112,799,038 - 112,801,065 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	112,799,011 - 112,801,075 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	119,450,402 - 119,452,350 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	117,562,964 - 117,564,912 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	112,279,989 - 112,281,964 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	116,416,561 - 116,418,521 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	116,416,507 - 116,418,582 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	136,110,360 - 136,112,320 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	117,217,836 - 117,219,796 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	107,977,947 - 107,979,907 (+)	NCBI		Celera
Cytogenetic Map	2	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant dyskeratosis congenita 1 (ISO)

Fanconi-Bickel syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

3,7-dihydropurine-6-thione (EXP)

5-aza-2'-deoxycytidine (ISO)

acetamide (EXP)

aflatoxin B1 (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

cannabidiol (ISO)

CGP 52608 (ISO)

cisplatin (ISO)

genistein (ISO)

glyphosate (EXP)

lipopolysaccharide (ISO)

mercaptopurine (EXP)

methylmercury chloride (ISO)

methylparaben (ISO)

paracetamol (ISO)

purine-6-thiol (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium fluoride (ISO)

sunitinib (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

actin cytoskeleton (IBA)

male germ cell nucleus (ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:18692047

Genomics

Comparative Map Data

Actrt3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	114,727,534 - 114,729,561 (+)	NCBI		GRCr8
mRatBN7.2	2	112,799,038 - 112,801,065 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	112,799,011 - 112,801,075 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	119,450,402 - 119,452,350 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	117,562,964 - 117,564,912 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	112,279,989 - 112,281,964 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	116,416,561 - 116,418,521 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	116,416,507 - 116,418,582 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	136,110,360 - 136,112,320 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	117,217,836 - 117,219,796 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	2	107,977,947 - 107,979,907 (+)	NCBI		Celera
Cytogenetic Map	2	q24	NCBI

ACTRT3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	169,766,921 - 169,769,561 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	169,766,921 - 169,769,561 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	169,484,709 - 169,487,349 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	170,967,407 - 170,970,377 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	3	167,883,851 - 167,885,293 (-)	NCBI		Celera
Cytogenetic Map	3	q26.2	NCBI
HuRef	3	166,856,974 - 166,857,553 (-)	NCBI		HuRef
CHM1_1	3	169,447,787 - 169,450,725 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	172,550,873 - 172,553,662 (-)	NCBI		T2T-CHM13v2.0

Actrt3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	30,651,221 - 30,654,021 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	30,651,222 - 30,654,088 (-)	Ensembl		GRCm39 Ensembl
GRCm38	3	30,597,073 - 30,599,870 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	30,597,073 - 30,599,939 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	30,495,995 - 30,498,792 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	30,787,911 - 30,790,708 (-)	NCBI		MGSCv36	mm8
Celera	3	30,509,748 - 30,511,432 (-)	NCBI		Celera
Cytogenetic Map	3	A3	NCBI
cM Map	3	14.27	NCBI

Actrt3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	27,024 - 30,182 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955420	28,183 - 30,207 (-)	NCBI	ChiLan1.0	ChiLan1.0

ACTRT3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	167,660,545 - 167,663,668 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	167,653,941 - 167,668,143 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	166,780,316 - 166,783,758 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	174,834,118 - 174,837,345 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	174,834,118 - 174,837,345 (-)	Ensembl	panpan1.1		panPan2

ACTRT3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	34	34,372,244 - 34,374,702 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	34	34,370,536 - 34,375,174 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	34	43,448,521 - 43,450,975 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	34	34,450,890 - 34,453,352 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	34	34,450,091 - 34,453,299 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	34	34,397,365 - 34,399,805 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	34	34,364,425 - 34,366,880 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	34	34,629,087 - 34,631,547 (-)	NCBI		UU_Cfam_GSD_1.0

Actrt3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	100,972,398 - 100,974,155 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936593	2,647,841 - 2,650,347 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936593	2,647,740 - 2,649,658 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ACTRT3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	108,428,986 - 108,435,383 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	108,429,745 - 108,434,366 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	117,156,398 - 117,158,708 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ACTRT3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	19,621,332 - 19,629,179 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	19,622,376 - 19,629,592 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666063	28,432,472 - 28,436,503 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Actrt3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	47,809,519 - 47,822,172 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	47,819,435 - 47,823,471 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	167
Count of miRNA genes:	131
Interacting mature miRNAs:	142
Transcripts:	ENSRNOT00000030700
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2293671	Bss44	Bone structure and strength QTL 44	10.97	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	2	105628029	150628029	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
1598865	Bp296	Blood pressure QTL 296	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	82947902	127947902	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845370	229470703	Rat
1578772	Stresp14	Stress response QTL 14	5	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	2	84056790	132859658	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	83465462	229820014	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	114384617	215381366	Rat
1581576	Pur7	Proteinuria QTL 7		0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	2	80396178	220931218	Rat
61392	Bp6	Blood pressure QTL 6	7		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	82214549	127214549	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	206613235	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	113746222	205135428	Rat
631198	Cm22	Cardiac mass QTL 22	4.3	0.0008	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	78269809	208420281	Rat
7488933	Bp368	Blood pressure QTL 368		0.004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	104957381	149957381	Rat
1302794	Stl27	Serum triglyceride level QTL 27	4.4	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	2	27148328	145807373	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	80396178	220931218	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	114384617	215381366	Rat
2317886	Alcrsp23	Alcohol response QTL 23	2.4	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	95142371	140142371	Rat
1358901	Cm38	Cardiac mass QTL 38	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
2317058	Aia13	Adjuvant induced arthritis QTL 13	2.9		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	2	78269809	123269809	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	4265106	205135428	Rat
1358899	Kidm23	Kidney mass QTL 23	3.88		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1358908	Bw49	Body weight QTL 49	3.36		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
2293835	Kiddil5	Kidney dilation QTL 5	3.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	159440891	Rat
1581552	Pur12	Proteinuria QTL 12	5.19	0.0009	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	2	114032149	150226270	Rat
1358910	Kidm27	Kidney mass QTL 27	5.77		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	83465462	225110681	Rat
1558653	Prcr1	Prostate cancer resistance QTL 1	5		prostate integrity trait (VT:0010571)	area of ventral prostate occupied by tumorous lesions to total ventral prostate area ratio (CMO:0000899)	2	114440891	159440891	Rat
1358911	Kidm28	Kidney mass QTL 28	5.42		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	47856345	205135428	Rat
1358904	Cm39	Cardiac mass QTL 39	2.26		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	27148328	159440891	Rat
1359035	Bp276	Blood pressure QTL 276			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	100807373	145807373	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	44537979	184731399	Rat
8662836	Vetf8	Vascular elastic tissue fragility QTL 8	0.66		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	106869825	151869825	Rat
1358887	Bw50	Body weight QTL 50	2.39		body mass (VT:0001259)	body weight (CMO:0000012)	2	27148557	159440760	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	67845182	205135428	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	83400752	223709938	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	44537979	205135428	Rat
2290453	Scl55	Serum cholesterol level QTL 55	2.83		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	28652666	139067443	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	76328396	209350714	Rat
2299162	Iddm32	Insulin dependent diabetes mellitus QTL 32	2.36		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	93602631	145807373	Rat
1358894	Kidm24	Kidney mass QTL 24	4.03		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	27148328	159440891	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	80396034	220931416	Rat
61438	Cia7	Collagen induced arthritis QTL 7	4.6	0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	2	61051541	143746880	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	78269809	205135428	Rat

Markers in Region

BF394048

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	112,800,826 - 112,800,959 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	116,418,327 - 116,418,459	NCBI	Rnor6.0
Rnor_5.0	2	136,112,126 - 136,112,258	UniSTS	Rnor5.0
RGSC_v3.4	2	117,219,602 - 117,219,734	UniSTS	RGSC3.4
Celera	2	107,979,713 - 107,979,845	UniSTS
RH 3.4 Map	2	714.4	UniSTS
Cytogenetic Map	2	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
7	5	32	107	78	82	51	25	51	5	172	71	93	39	59	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108942	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473961	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000030700 ⟹ ENSRNOP00000038451

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	112,799,011 - 112,801,075 (+)	Ensembl
Rnor_6.0 Ensembl	2	116,416,507 - 116,418,582 (+)	Ensembl

RefSeq Acc Id:

NM_001108942 ⟹ NP_001102412

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	114,727,534 - 114,729,561 (+)	NCBI
mRatBN7.2	2	112,799,038 - 112,801,065 (+)	NCBI
Rnor_6.0	2	116,416,561 - 116,418,521 (+)	NCBI
Rnor_5.0	2	136,110,360 - 136,112,320 (+)	NCBI
RGSC_v3.4	2	117,217,836 - 117,219,796 (+)	RGD
Celera	2	107,977,947 - 107,979,907 (+)	RGD

Sequence:

show sequence

ATGAGCAGCTACCAGCCACCAGTGGTGATCGACAACGGCTCGGGAATGATCAAGGCGGGCCTGG
CTGGGGCCCGGGAGCCCCAGTTCGTCTACCCGAATATTCTGGGCCGGACCAAGAACCACAGCCC
TGCGGCTGACAGCAAGCAGGAGCTGCGTGTGGGTGATCAAGCGCAGGAGCGCAGGAGCTTCCTG
TCCATCAGCTATCCAGTGGAACGGGGTCTCATTTCTTCCTGGGGAGACATGGAGATCATGTGGA
AACATATCTATGACTACAACCTGAACCTGAACCCCAGCGATGGCCCGGTCTTGGTTACAGAACC
GGCTCTCAACCCATTGGCAGACCGGCAGCACATCTCCGAAGTGTTTTTTGAAAATCTGGGAGTC
CCTGCCTTCTATATGTCTGTCCAGGCTGTGTTGGCTCTGTTTGCTGCTGGTTTTACCACTGGCC
TTGTGCTGAACTCAGGTGCTGGGATTACTCAGTGTGTGCCCATCTTTGAGGGTTACTGCCTATC
ACATGGTGTAAAACAGCTAAACGTGGCAGGAATTGACCTCACCAACTACCTCATGATGTTGCTG
AAGGATGATGGTATCATGCTGCTTAGAACTGGGGACAGAAAAACTGTCACAGACATTAAGGAGA
ATGCTTGCTATGTGGCAATGAACTATGATGAGGAAATGGTCAAGGAATCTAACGTAGAGAAAAT
GTACACCCTCCCTGACGGGAAGACTGTAAAACTCCGTAAGCAGGTATTCCGCTGCCCGGAGGCC
CTCTTCTCTCCGTATCTTGTGAATGTGGATGCTCCTGGCATCGACAGGATATGCTTCAGCAGTA
TAATGAAGTGTGATGCAGATCTCAGGAACTCCTTCTTCTCCAACATCATCCTTTCCGGAGGATC
GACCTCTTTTCCTGGTTTAGATAAGCGACTCATTAAGGATGTGGCAAAGTTGGCACCTGCCAAT
ACCACCGTGCAGGTTGTAGCTCCTCCTGAAAGGAAAATTTCGGTGTGGATGGGGGGATCTATTC
TTGCATCCTTGTCTGCCTTCCAAGACATGTGGATCACGGCTGCAGAATTCGAAGAAGTGGGACC
CAACATTGTACACCAGAGGTGCTTCTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102412	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM01170	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000038451.3

RefSeq Acc Id:

NP_001102412 ⟸ NM_001108942

- UniProtKB:

D4ABA6 (UniProtKB/TrEMBL), A6IHM2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSSYQPPVVIDNGSGMIKAGLAGAREPQFVYPNILGRTKNHSPAADSKQELRVGDQAQERRSFL
SISYPVERGLISSWGDMEIMWKHIYDYNLNLNPSDGPVLVTEPALNPLADRQHISEVFFENLGV
PAFYMSVQAVLALFAAGFTTGLVLNSGAGITQCVPIFEGYCLSHGVKQLNVAGIDLTNYLMMLL
KDDGIMLLRTGDRKTVTDIKENACYVAMNYDEEMVKESNVEKMYTLPDGKTVKLRKQVFRCPEA
LFSPYLVNVDAPGIDRICFSSIMKCDADLRNSFFSNIILSGGSTSFPGLDKRLIKDVAKLAPAN
TTVQVVAPPERKISVWMGGSILASLSAFQDMWITAAEFEEVGPNIVHQRCF

hide sequence

Ensembl Acc Id:

ENSRNOP00000038451 ⟸ ENSRNOT00000030700

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4ABA6-F1-model_v2	AlphaFold	D4ABA6	1-371	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13691278

Promoter ID:

EPDNEW_R1803

Type:

single initiation site

Name:

Actrt3_1

Description:

actin-related protein T3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	2	116,416,538 - 116,416,598	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1561457	AgrOrtholog
BioCyc Gene	G2FUF-53450	BioCyc
Ensembl Genes	ENSRNOG00000027908	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000030700.5	UniProtKB/TrEMBL
Gene3D-CATH	3.30.420.40	UniProtKB/TrEMBL
InterPro	Actin-like	UniProtKB/TrEMBL
	ATPase_NBD	UniProtKB/TrEMBL
KEGG Report	rno:365763	UniProtKB/TrEMBL
NCBI Gene	365763	ENTREZGENE
PANTHER	Actin_like	UniProtKB/TrEMBL
	PTHR11937:SF159	UniProtKB/TrEMBL
Pfam	Actin	UniProtKB/TrEMBL
PhenoGen	Actrt3	PhenoGen
PRINTS	ACTIN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000027908	RatGTEx
SMART	ACTIN	UniProtKB/TrEMBL
Superfamily-SCOP	SSF53067	UniProtKB/TrEMBL
UniProt	A6IHM2	ENTREZGENE, UniProtKB/TrEMBL
	D4ABA6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-07-13	Actrt3	actin-related protein T3	Arpm1	actin related protein M1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-29	Arpm1	actin related protein M1	RGD1561457_predicted	similar to Actin related protein M1 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-07	RGD1561457_predicted	similar to Actin related protein M1 (predicted)	LOC365763	similar to Actin related protein M1	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC365763	similar to Actin related protein M1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar