Symbol:
Sumo3
Name:
small ubiquitin-like modifier 3
RGD ID:
1561022
Description:
Predicted to enable SUMO transferase activity; protein tag activity; and ubiquitin-like protein ligase binding activity. Predicted to be involved in protein sumoylation and regulation of protein localization to nucleus. Predicted to act upstream of or within positive regulation of ubiquitin-dependent protein catabolic process and protein localization to nucleus. Predicted to be located in PML body. Predicted to be active in several cellular components, including glutamatergic synapse; postsynaptic cytosol; and presynaptic cytosol. Orthologous to human SUMO3 (small ubiquitin like modifier 3); PARTICIPATES IN RNA transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol; ammonium chloride.
Type:
protein-coding (Ensembl: lncRNA)
RefSeq Status:
PROVISIONAL
Previously known as:
LOC499417; similar to Ubiquitin-like protein SMT3A precursor (Ubiquitin-related protein SUMO-2); small ubiquitin-related modifier 3; SMT3 suppressor of mif two 3 homolog 3; SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae); SUMO-3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 11,009,730 - 11,020,502 (-) NCBI GRCr8 mRatBN7.2 20 11,010,140 - 11,020,850 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 11,010,166 - 11,020,696 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 20 11,007,148 - 11,020,877 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 11,709,642 - 11,720,195 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 11,070,611 - 11,081,166 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 11,542,357 - 11,552,911 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 11,726,488 - 11,737,050 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 11,726,497 - 11,737,050 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 13,892,796 - 13,903,349 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 11,393,957 - 11,404,510 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 20 12,514,863 - 12,525,416 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Sumo3 Rat (+)-catechin multiple interactions ISO SUMO3 (Homo sapiens) 6480464 [Catechin co-treated with Grape Seed Proanthocyanidins] results in increased expression of SUMO3 mRNA CTD PMID:24763279 Sumo3 Rat 1,2-dimethylhydrazine multiple interactions ISO Sumo3 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of SUMO3 mRNA] CTD PMID:22206623 Sumo3 Rat 1,2-dimethylhydrazine increases expression ISO Sumo3 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of SUMO3 mRNA CTD PMID:22206623 Sumo3 Rat 17beta-estradiol increases expression ISO Sumo3 (Mus musculus) 6480464 Estradiol results in increased expression of SUMO3 mRNA CTD PMID:39298647 Sumo3 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Sumo3 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of SUMO3 mRNA CTD PMID:21570461 Sumo3 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of SUMO3 mRNA CTD PMID:34747641 Sumo3 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin analog results in decreased expression of SUMO3 protein CTD PMID:26072098 Sumo3 Rat 4,4'-sulfonyldiphenol increases expression ISO Sumo3 (Mus musculus) 6480464 bisphenol S results in increased expression of SUMO3 mRNA CTD PMID:39298647 Sumo3 Rat 4,4'-sulfonyldiphenol increases expression ISO SUMO3 (Homo sapiens) 6480464 bisphenol S results in increased expression of SUMO3 protein CTD PMID:34186270 Sumo3 Rat 4-hydroxynon-2-enal decreases expression ISO Sumo3 (Mus musculus) 6480464 4-hydroxy-2-nonenal results in decreased expression of SUMO3 mRNA CTD PMID:19191707 Sumo3 Rat 7,12-dimethyltetraphene affects expression ISO Sumo3 (Mus musculus) 6480464 9 more ... CTD PMID:21785161 Sumo3 Rat 7,12-dimethyltetraphene increases expression ISO Sumo3 (Mus musculus) 6480464 9 more ... CTD PMID:39910959 Sumo3 Rat acetylsalicylic acid increases expression ISO SUMO3 (Homo sapiens) 6480464 Aspirin results in increased expression of SUMO3 mRNA CTD PMID:11906190 Sumo3 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of SUMO3 mRNA CTD PMID:16483693 Sumo3 Rat antirheumatic drug decreases expression ISO SUMO3 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of SUMO3 mRNA CTD PMID:24449571 Sumo3 Rat arsane affects methylation ISO SUMO3 (Homo sapiens) 6480464 Arsenic affects the methylation of SUMO3 gene CTD PMID:25304211 Sumo3 Rat arsenic atom affects methylation ISO SUMO3 (Homo sapiens) 6480464 Arsenic affects the methylation of SUMO3 gene CTD PMID:25304211 Sumo3 Rat benzo[a]pyrene increases expression ISO Sumo3 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of SUMO3 mRNA CTD PMID:22228805 Sumo3 Rat benzo[a]pyrene increases methylation ISO SUMO3 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of SUMO3 promoter CTD PMID:27901495 Sumo3 Rat bis(2-ethylhexyl) phthalate increases expression ISO Sumo3 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of SUMO3 mRNA CTD PMID:33754040 Sumo3 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of SUMO3 mRNA CTD PMID:25181051 more ... Sumo3 Rat bisphenol A decreases expression ISO SUMO3 (Homo sapiens) 6480464 bisphenol A results in decreased expression of SUMO3 protein CTD PMID:34186270 Sumo3 Rat bisphenol A decreases expression ISO Sumo3 (Mus musculus) 6480464 bisphenol A results in decreased expression of SUMO3 mRNA CTD PMID:33221593 Sumo3 Rat bisphenol A affects expression ISO SUMO3 (Homo sapiens) 6480464 bisphenol A affects the expression of SUMO3 mRNA CTD PMID:30903817 Sumo3 Rat bisphenol A increases expression ISO SUMO3 (Homo sapiens) 6480464 bisphenol A results in increased expression of SUMO3 mRNA CTD PMID:30426790 Sumo3 Rat Bisphenol B increases expression ISO SUMO3 (Homo sapiens) 6480464 bisphenol B results in increased expression of SUMO3 protein CTD PMID:34186270 Sumo3 Rat bisphenol F increases expression ISO Sumo3 (Mus musculus) 6480464 bisphenol F results in increased expression of SUMO3 mRNA CTD PMID:38685157 Sumo3 Rat buspirone decreases expression EXP 6480464 Buspirone results in decreased expression of SUMO3 mRNA CTD PMID:24136188 Sumo3 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of SUMO3 mRNA CTD PMID:19167457 Sumo3 Rat cadmium dichloride decreases expression ISO SUMO3 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of SUMO3 mRNA CTD PMID:38568856 Sumo3 Rat carbon nanotube increases expression ISO Sumo3 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Sumo3 Rat cyclosporin A decreases expression ISO SUMO3 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of SUMO3 mRNA CTD PMID:20106945 and PMID:25562108 Sumo3 Rat cyclosporin A decreases methylation ISO SUMO3 (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of SUMO3 promoter CTD PMID:27989131 Sumo3 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of SUMO3 mRNA CTD PMID:21266533 Sumo3 Rat dibutyl phthalate decreases expression ISO Sumo3 (Mus musculus) 6480464 Dibutyl Phthalate results in decreased expression of SUMO3 mRNA CTD PMID:17361019 Sumo3 Rat dorsomorphin multiple interactions ISO SUMO3 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Sumo3 Rat endosulfan increases expression ISO SUMO3 (Homo sapiens) 6480464 Endosulfan results in increased expression of SUMO3 mRNA CTD PMID:30426790 Sumo3 Rat ethanol affects splicing ISO Sumo3 (Mus musculus) 6480464 Ethanol affects the splicing of SUMO3 mRNA CTD PMID:30319688 Sumo3 Rat folic acid multiple interactions ISO Sumo3 (Mus musculus) 6480464 Folic Acid inhibits the reaction [1 and 2-Dimethylhydrazine results in increased expression of SUMO3 mRNA] CTD PMID:22206623 Sumo3 Rat FR900359 affects phosphorylation ISO SUMO3 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of SUMO3 protein CTD PMID:37730182 Sumo3 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of SUMO3 mRNA CTD PMID:22061828 Sumo3 Rat GW 4064 multiple interactions ISO Sumo3 (Mus musculus) 6480464 GW 4064 promotes the reaction [NR1H4 protein binds to SUMO3 gene] CTD PMID:20091679 Sumo3 Rat hinokiflavone increases localization ISO SUMO3 (Homo sapiens) 6480464 hinokiflavone results in increased localization of SUMO3 protein CTD PMID:28884683 Sumo3 Rat hydralazine multiple interactions ISO SUMO3 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of SUMO3 mRNA CTD PMID:17183730 Sumo3 Rat Mesaconitine increases expression EXP 6480464 mesaconitine results in increased expression of SUMO3 protein CTD PMID:37182599 Sumo3 Rat methyl methanesulfonate decreases expression ISO SUMO3 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of SUMO3 mRNA CTD PMID:23649840 Sumo3 Rat nitrates multiple interactions ISO Sumo3 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of SUMO3 mRNA CTD PMID:35964746 Sumo3 Rat paracetamol affects response to substance ISO SUMO3 (Homo sapiens) 6480464 SUMO3 gene polymorphism affects the susceptibility to Acetaminophen CTD PMID:26104854 Sumo3 Rat perfluorohexanesulfonic acid increases expression ISO Sumo3 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of SUMO3 mRNA CTD PMID:37995155 Sumo3 Rat phenobarbital affects expression ISO SUMO3 (Homo sapiens) 6480464 Phenobarbital affects the expression of SUMO3 mRNA CTD PMID:19159669 Sumo3 Rat rifampicin multiple interactions ISO SUMO3 (Homo sapiens) 6480464 Rifampin inhibits the reaction [trichostatin A inhibits the reaction [[PIAS1 co-treated with SUMO3] inhibits the reaction [NCOR2 protein promotes the reaction [NR1I2 protein binds to HDAC3 protein]]]] CTD PMID:26883953 Sumo3 Rat SB 431542 multiple interactions ISO SUMO3 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Sumo3 Rat sodium arsenite increases expression ISO SUMO3 (Homo sapiens) 6480464 sodium arsenite results in increased expression of SUMO3 mRNA CTD PMID:28595984 and PMID:34032870 Sumo3 Rat Soman increases expression EXP 6480464 Soman results in increased expression of SUMO3 mRNA CTD PMID:19281266 Sumo3 Rat sulindac decreases expression ISO SUMO3 (Homo sapiens) 6480464 Sulindac results in decreased expression of SUMO3 mRNA CTD PMID:11906190 Sumo3 Rat tert-butyl hydroperoxide decreases expression ISO SUMO3 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of SUMO3 mRNA CTD PMID:29432895 Sumo3 Rat tetrachloromethane affects expression ISO Sumo3 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of SUMO3 mRNA CTD PMID:31919559 Sumo3 Rat thiram decreases expression ISO SUMO3 (Homo sapiens) 6480464 Thiram results in decreased expression of SUMO3 mRNA CTD PMID:38568856 Sumo3 Rat titanium dioxide decreases methylation ISO Sumo3 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of SUMO3 promoter CTD PMID:35295148 Sumo3 Rat trichostatin A decreases expression ISO SUMO3 (Homo sapiens) 6480464 trichostatin A results in decreased expression of SUMO3 mRNA CTD PMID:24935251 and PMID:26272509 Sumo3 Rat trichostatin A multiple interactions ISO SUMO3 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:26883953 and PMID:27188386 Sumo3 Rat triptonide affects expression ISO Sumo3 (Mus musculus) 6480464 triptonide affects the expression of SUMO3 mRNA CTD PMID:33045310 Sumo3 Rat tungsten increases expression ISO Sumo3 (Mus musculus) 6480464 Tungsten results in increased expression of SUMO3 mRNA CTD PMID:30912803 Sumo3 Rat valproic acid decreases expression ISO Sumo3 (Mus musculus) 6480464 Valproic Acid results in decreased expression of SUMO3 mRNA CTD PMID:20546886 and PMID:21427059 Sumo3 Rat valproic acid increases methylation ISO SUMO3 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of SUMO3 gene CTD PMID:29154799 Sumo3 Rat valproic acid affects expression ISO SUMO3 (Homo sapiens) 6480464 Valproic Acid affects the expression of SUMO3 mRNA CTD PMID:25979313 Sumo3 Rat valproic acid decreases expression ISO SUMO3 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of SUMO3 mRNA CTD PMID:19101580 more ... Sumo3 Rat valproic acid multiple interactions ISO SUMO3 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of SUMO3 mRNA more ... CTD PMID:17183730 and PMID:27188386
Imported Annotations - KEGG (archival)
(+)-catechin (ISO) 1,2-dimethylhydrazine (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxynon-2-enal (ISO) 7,12-dimethyltetraphene (ISO) acetylsalicylic acid (ISO) ammonium chloride (EXP) antirheumatic drug (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) Bisphenol B (ISO) bisphenol F (ISO) buspirone (EXP) C60 fullerene (EXP) cadmium dichloride (ISO) carbon nanotube (ISO) cyclosporin A (ISO) dibutyl phthalate (EXP,ISO) dorsomorphin (ISO) endosulfan (ISO) ethanol (ISO) folic acid (ISO) FR900359 (ISO) gentamycin (EXP) GW 4064 (ISO) hinokiflavone (ISO) hydralazine (ISO) Mesaconitine (EXP) methyl methanesulfonate (ISO) nitrates (ISO) paracetamol (ISO) perfluorohexanesulfonic acid (ISO) phenobarbital (ISO) rifampicin (ISO) SB 431542 (ISO) sodium arsenite (ISO) Soman (EXP) sulindac (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (ISO) thiram (ISO) titanium dioxide (ISO) trichostatin A (ISO) triptonide (ISO) tungsten (ISO) valproic acid (ISO)
Sumo3 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 11,009,730 - 11,020,502 (-) NCBI GRCr8 mRatBN7.2 20 11,010,140 - 11,020,850 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 11,010,166 - 11,020,696 (+) Ensembl mRatBN7.2 Ensembl mRatBN7.2 Ensembl 20 11,007,148 - 11,020,877 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 11,709,642 - 11,720,195 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 11,070,611 - 11,081,166 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 11,542,357 - 11,552,911 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 11,726,488 - 11,737,050 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 11,726,497 - 11,737,050 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 13,892,796 - 13,903,349 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 11,393,957 - 11,404,510 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 20 12,514,863 - 12,525,416 (-) NCBI Celera Cytogenetic Map 20 p12 NCBI
SUMO3 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 21 44,805,617 - 44,818,062 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 21 44,805,617 - 44,818,779 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 21 46,225,532 - 46,237,977 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 21 45,049,960 - 45,062,472 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 21 45,049,959 - 45,062,472 NCBI Celera 21 31,332,860 - 31,345,231 (-) NCBI Celera Cytogenetic Map 21 q22.3 NCBI HuRef 21 31,598,890 - 31,611,428 (-) NCBI HuRef CHM1_1 21 45,786,069 - 45,798,882 (-) NCBI CHM1_1 T2T-CHM13v2.0 21 43,165,885 - 43,178,512 (-) NCBI T2T-CHM13v2.0
Sumo3 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 77,441,931 - 77,454,165 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 77,441,931 - 77,454,165 (+) Ensembl GRCm39 Ensembl GRCm38 10 77,606,097 - 77,618,331 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 77,606,097 - 77,618,331 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 77,068,979 - 77,081,076 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 77,049,986 - 77,061,092 (+) NCBI MGSCv36 mm8 Celera 10 78,649,331 - 78,661,426 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Sumo3 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955407 41,727,181 - 41,732,692 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955407 41,725,992 - 41,732,692 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100970998 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 472,213 - 473,935 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 742,766 - 744,488 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 224,215,377 - 224,217,052 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 229,701,496 - 229,703,222 (+) NCBI panpan1.1 PanPan1.1 panPan2
SUMO3 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 31 38,472,076 - 38,484,358 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 31 37,669,343 - 37,682,430 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 31 38,073,632 - 38,088,790 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 31 38,074,740 - 38,087,270 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 31 37,936,323 - 37,951,319 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 31 37,897,194 - 37,911,794 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 31 38,412,554 - 38,425,676 (-) NCBI UU_Cfam_GSD_1.0
Sumo3
SUMO3 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 207,476,441 - 207,484,250 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 207,475,303 - 207,484,362 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 217,406,416 - 217,415,476 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
SUMO3
Sumo3
.
Predicted Target Of
Count of predictions: 146 Count of miRNA genes: 113 Interacting mature miRNAs: 131 Transcripts: ENSRNOT00000001637 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 4889870 Pur30 Proteinuria QTL 30 19 0.005 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 8042410 29322208 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 1558640 Prcs2 Prostate cancer susceptibility QTL 2 3.3 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 20 4606607 17617956 Rat 631265 Iresp1 Immunoglobin response QTL1 8.3 blood anti-double stranded DNA antibody amount (VT:0004762) serum anti-DNA antibody level (CMO:0001533) 20 9039719 13461775 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 4889857 Pur27 Proteinuria QTL 27 12.2 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 4606607 17617956 Rat 70154 Insul2 Insulin level QTL 2 3.75 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 6691706 17489458 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 1581577 Pur15 Proteinuria QTL 15 4.38 0.0002 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 20 8042410 17617956 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat
RH142469
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 11,012,829 - 11,012,936 (+) MAPPER mRatBN7.2 Rnor_6.0 20 11,833,533 - 11,833,639 NCBI Rnor6.0 Rnor_6.0 20 11,729,183 - 11,729,289 NCBI Rnor6.0 Rnor_5.0 20 13,997,414 - 13,997,520 UniSTS Rnor5.0 Rnor_5.0 20 13,895,482 - 13,895,588 UniSTS Rnor5.0 RGSC_v3.4 20 11,396,643 - 11,396,749 UniSTS RGSC3.4 Celera 20 12,517,549 - 12,517,655 UniSTS RH 3.4 Map 20 153.96 UniSTS Cytogenetic Map 20 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001637 ⟹ ENSRNOP00000001637
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 11,010,166 - 11,020,696 (+) Ensembl Rnor_6.0 Ensembl 20 11,726,497 - 11,737,050 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094434
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 11,007,148 - 11,020,877 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000094759
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 11,007,148 - 11,017,742 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000115542
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 11,007,220 - 11,013,658 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118151
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 11,007,148 - 11,012,579 (-) Ensembl
RefSeq Acc Id:
NM_001024295 ⟹ NP_001019466
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 11,009,734 - 11,020,287 (-) NCBI mRatBN7.2 20 11,010,144 - 11,020,697 (-) NCBI Rnor_6.0 20 11,726,497 - 11,737,050 (-) NCBI Rnor_5.0 20 13,892,796 - 13,903,349 (-) NCBI RGSC_v3.4 20 11,393,957 - 11,404,510 (-) RGD Celera 20 12,514,863 - 12,525,416 (-) RGD
Sequence:
GGGGCAGAGAGCGTGACTCGCCCGCTCCAGTGCCACCGGTTCCCGCTGCGCTTGCCGCCGCCGTCGCCGCGCAACCATGTCGGAAGAGAAGCCCAAGGAGGGTGTGAAGACAGAGAACGACCACATCA
hide sequence
RefSeq Acc Id:
XM_063279458 ⟹ XP_063135528
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 11,009,730 - 11,020,502 (-) NCBI
RefSeq Acc Id:
XR_005497327
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 11,010,868 - 11,020,502 (-) NCBI mRatBN7.2 20 11,010,140 - 11,020,850 (-) NCBI
RefSeq Acc Id:
NP_001019466 ⟸ NM_001024295
- UniProtKB:
Q5XIF4 (UniProtKB/Swiss-Prot), A6JK81 (UniProtKB/TrEMBL), A6JK80 (UniProtKB/TrEMBL)
- Sequence:
MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGTASRASVPTPSHFPDICY
hide sequence
Ensembl Acc Id:
ENSRNOP00000001637 ⟸ ENSRNOT00000001637
RefSeq Acc Id:
XP_063135528 ⟸ XM_063279458
- Peptide Label:
isoform X1
RGD ID: 13701503 Promoter ID: EPDNEW_R12027 Type: initiation region Name: Sumo3_1 Description: small ubiquitin-like modifier 3 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 11,737,070 - 11,737,130 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2022-06-02
Sumo3
small ubiquitin-like modifier 3
Sumo3
small ubiquitin-like modifier 3
Data merged from RGD:149736462
737654 PROVISIONAL
2021-08-09
Sumo3
small ubiquitin-like modifier 3
Symbol and Name status set to provisional
45752 PROVISIONAL
2013-06-14
Sumo3
small ubiquitin-like modifier 3
Sumo3
SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-05
Sumo3
SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae)
LOC499417
similar to Ubiquitin-like protein SMT3A precursor (Ubiquitin-related protein SUMO-2)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-02-09
LOC499417
similar to Ubiquitin-like protein SMT3A precursor (Ubiquitin-related protein SUMO-2)
Symbol and Name status set to provisional
70820 PROVISIONAL
