Symbol:
Megf10
Name:
multiple EGF-like-domains 10
RGD ID:
1558549
MGI Page
MGI
Description:
Enables Notch binding activity. Involved in several processes, including myoblast development; positive regulation of myoblast proliferation; and skeletal muscle satellite cell proliferation. Acts upstream of or within apoptotic process involved in development; engulfment of apoptotic cell; and recognition of apoptotic cell. Located in phagocytic cup. Is expressed in several structures, including brain; heart; retina layer; skeletal muscle tissue; and testis. Human ortholog(s) of this gene implicated in congenital myopathy 10B and early-onset myopathy-areflexia-respiratory distress-dysphagia syndrome. Orthologous to human MEGF10 (multiple EGF like domains 10).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
3000002B06Rik; gene model 331, (NCBI); Gm331; multiple EGF-like domains protein 10; multiple epidermal growth factor-like domains protein 10
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
MEGF10 (multiple EGF like domains 10) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Megf10 (multiple EGF-like domains 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Megf10 (multiple EGF like domains 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
MEGF10 (multiple EGF like domains 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
MEGF10 (multiple EGF like domains 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Megf10 (multiple EGF like domains 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
MEGF10 (multiple EGF like domains 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
MEGF10 (multiple EGF like domains 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Megf10 (multiple EGF like domains 10) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
MEGF11 (multiple EGF like domains 11) HGNC
OrthoMCL
Homo sapiens (human):
PEAR1 (platelet endothelial aggregation receptor 1) HGNC
OrthoMCL
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Megf10 (multiple EGF-like domains 10)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
MEGF10 (multiple EGF like domains 10)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
megf10 (multiple EGF-like-domains 10)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
ced-1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER)
Drosophila melanogaster (fruit fly):
drpr
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
megf10
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 57,266,162 - 57,430,539 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 57,266,162 - 57,430,539 (+) Ensembl GRCm39 Ensembl GRCm38 18 57,133,090 - 57,297,467 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 57,133,090 - 57,297,467 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 57,292,744 - 57,457,121 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 57,258,844 - 57,422,835 (+) NCBI MGSCv36 mm8 Celera 18 58,443,454 - 58,608,465 (+) NCBI Celera Cytogenetic Map 18 D3 NCBI cM Map 18 31.5 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Megf10 Mouse 17beta-estradiol multiple interactions ISO MEGF10 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of MEGF10 mRNA CTD PMID:20660070 Megf10 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of MEGF10 mRNA CTD PMID:19933214 Megf10 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Megf10 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in increased expression of MEGF10 mRNA CTD PMID:32109520 and PMID:33387578 Megf10 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of MEGF10 mRNA CTD PMID:21570461 Megf10 Mouse 4,4'-sulfonyldiphenol increases methylation EXP 6480464 bisphenol S results in increased methylation of MEGF10 exon CTD PMID:33297965 Megf10 Mouse 4,4'-sulfonyldiphenol affects methylation EXP 6480464 bisphenol S affects the methylation of MEGF10 gene CTD PMID:31683443 Megf10 Mouse 6-propyl-2-thiouracil decreases expression ISO Megf10 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of MEGF10 mRNA CTD PMID:36843608 Megf10 Mouse acrylamide decreases expression ISO MEGF10 (Homo sapiens) 6480464 Acrylamide results in decreased expression of MEGF10 mRNA CTD PMID:32763439 Megf10 Mouse aflatoxin B1 decreases methylation ISO MEGF10 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of MEGF10 gene CTD PMID:27153756 Megf10 Mouse all-trans-retinoic acid increases expression ISO MEGF10 (Homo sapiens) 6480464 Tretinoin results in increased expression of MEGF10 mRNA CTD PMID:21934132 Megf10 Mouse ammonium chloride affects expression ISO Megf10 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of MEGF10 mRNA CTD PMID:16483693 Megf10 Mouse atrazine increases expression ISO MEGF10 (Homo sapiens) 6480464 Atrazine results in increased expression of MEGF10 mRNA CTD PMID:22378314 Megf10 Mouse atrazine affects methylation ISO Megf10 (Rattus norvegicus) 6480464 Atrazine affects the methylation of MEGF10 gene CTD PMID:28931070 and PMID:35440735 Megf10 Mouse benzo[a]pyrene affects methylation ISO MEGF10 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of MEGF10 5' UTR and Benzo(a)pyrene affects the methylation of MEGF10 promoter CTD PMID:27901495 Megf10 Mouse benzo[a]pyrene increases methylation ISO MEGF10 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of MEGF10 3' UTR CTD PMID:27901495 Megf10 Mouse bisphenol A decreases expression ISO Megf10 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of MEGF10 mRNA CTD PMID:25181051 Megf10 Mouse bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of MEGF10 mRNA CTD PMID:35479511 Megf10 Mouse bisphenol A multiple interactions ISO MEGF10 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of MEGF10 gene CTD PMID:31601247 Megf10 Mouse bisphenol A increases methylation ISO Megf10 (Rattus norvegicus) 6480464 bisphenol A results in increased methylation of MEGF10 gene CTD PMID:28505145 Megf10 Mouse carbamazepine affects expression ISO MEGF10 (Homo sapiens) 6480464 Carbamazepine affects the expression of MEGF10 mRNA CTD PMID:25979313 Megf10 Mouse cocaine increases expression ISO Megf10 (Rattus norvegicus) 6480464 Cocaine results in increased expression of MEGF10 mRNA CTD PMID:17898221 Megf10 Mouse Cuprizon increases expression ISO Megf10 (Rattus norvegicus) 6480464 Cuprizone results in increased expression of MEGF10 mRNA CTD PMID:26577399 Megf10 Mouse cytarabine increases expression ISO MEGF10 (Homo sapiens) 6480464 Cytarabine results in increased expression of MEGF10 mRNA CTD PMID:21198554 Megf10 Mouse dorsomorphin multiple interactions ISO MEGF10 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Megf10 Mouse entinostat increases expression ISO MEGF10 (Homo sapiens) 6480464 entinostat results in increased expression of MEGF10 mRNA CTD PMID:26272509 Megf10 Mouse entinostat multiple interactions ISO MEGF10 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of MEGF10 mRNA CTD PMID:27188386 Megf10 Mouse ethanol increases expression EXP 6480464 Ethanol results in increased expression of MEGF10 mRNA CTD PMID:30319688 Megf10 Mouse ethanol affects splicing EXP 6480464 Ethanol affects the splicing of MEGF10 mRNA CTD PMID:30319688 Megf10 Mouse fenvalerate increases expression ISO Megf10 (Rattus norvegicus) 6480464 fenvalerate results in increased expression of MEGF10 mRNA CTD PMID:30307764 Megf10 Mouse fonofos increases methylation ISO MEGF10 (Homo sapiens) 6480464 Fonofos results in increased methylation of MEGF10 promoter CTD PMID:22847954 Megf10 Mouse FR900359 increases phosphorylation ISO MEGF10 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of MEGF10 protein CTD PMID:37730182 Megf10 Mouse fulvestrant multiple interactions ISO MEGF10 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of MEGF10 gene CTD PMID:31601247 Megf10 Mouse glyphosate decreases methylation ISO Megf10 (Rattus norvegicus) 6480464 Glyphosate results in decreased methylation of MEGF10 gene CTD PMID:31011160 Megf10 Mouse isoflurane decreases methylation EXP 6480464 Isoflurane results in decreased methylation of MEGF10 mRNA CTD PMID:35249202 Megf10 Mouse lipopolysaccharide multiple interactions ISO MEGF10 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of MEGF10 mRNA CTD PMID:35811015 Megf10 Mouse mercury dibromide decreases expression ISO MEGF10 (Homo sapiens) 6480464 mercuric bromide results in decreased expression of MEGF10 mRNA CTD PMID:26272509 Megf10 Mouse mercury dibromide multiple interactions ISO MEGF10 (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MEGF10 mRNA CTD PMID:27188386 Megf10 Mouse methylmercury chloride increases expression ISO MEGF10 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of MEGF10 mRNA CTD PMID:23179753 Megf10 Mouse methylmercury chloride decreases expression ISO MEGF10 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of MEGF10 mRNA CTD PMID:28001369 Megf10 Mouse monosodium L-glutamate increases expression EXP 6480464 Sodium Glutamate results in increased expression of MEGF10 mRNA CTD PMID:22078008 Megf10 Mouse nickel atom decreases expression ISO MEGF10 (Homo sapiens) 6480464 Nickel results in decreased expression of MEGF10 mRNA CTD PMID:24768652 and PMID:25583101 Megf10 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of MEGF10 mRNA CTD PMID:27106289 Megf10 Mouse palytoxin increases expression EXP 6480464 palytoxin results in increased expression of MEGF10 mRNA CTD PMID:26436198 Megf10 Mouse paracetamol decreases expression ISO Megf10 (Rattus norvegicus) 6480464 Acetaminophen results in decreased expression of MEGF10 mRNA CTD PMID:33387578 Megf10 Mouse parathion increases methylation ISO MEGF10 (Homo sapiens) 6480464 Parathion results in increased methylation of MEGF10 promoter CTD PMID:22847954 Megf10 Mouse phenylmercury acetate decreases expression ISO MEGF10 (Homo sapiens) 6480464 Phenylmercuric Acetate results in decreased expression of MEGF10 mRNA CTD PMID:26272509 Megf10 Mouse phenylmercury acetate multiple interactions ISO MEGF10 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of MEGF10 mRNA CTD PMID:27188386 Megf10 Mouse potassium dichromate decreases expression EXP 6480464 Potassium Dichromate results in decreased expression of MEGF10 mRNA CTD PMID:23608068 Megf10 Mouse progesterone multiple interactions ISO MEGF10 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of MEGF10 mRNA CTD PMID:20660070 Megf10 Mouse S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO MEGF10 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of MEGF10 mRNA CTD PMID:35811015 Megf10 Mouse SB 431542 multiple interactions ISO MEGF10 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Megf10 Mouse silicon dioxide increases expression ISO MEGF10 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of MEGF10 mRNA CTD PMID:23806026 Megf10 Mouse silver atom decreases expression EXP 6480464 Silver results in decreased expression of MEGF10 mRNA CTD PMID:27131904 Megf10 Mouse silver(0) decreases expression EXP 6480464 Silver results in decreased expression of MEGF10 mRNA CTD PMID:27131904 Megf10 Mouse temozolomide decreases expression ISO MEGF10 (Homo sapiens) 6480464 Temozolomide results in decreased expression of MEGF10 mRNA CTD PMID:31758290 Megf10 Mouse terbufos increases methylation ISO MEGF10 (Homo sapiens) 6480464 terbufos results in increased methylation of MEGF10 promoter CTD PMID:22847954 Megf10 Mouse titanium dioxide decreases expression EXP 6480464 titanium dioxide results in decreased expression of MEGF10 mRNA CTD PMID:29264374 Megf10 Mouse titanium dioxide decreases methylation EXP 6480464 titanium dioxide results in decreased methylation of MEGF10 promoter CTD PMID:35295148 Megf10 Mouse trichostatin A decreases expression ISO MEGF10 (Homo sapiens) 6480464 trichostatin A results in decreased expression of MEGF10 mRNA CTD PMID:24935251 Megf10 Mouse triptonide decreases expression EXP 6480464 triptonide results in decreased expression of MEGF10 mRNA CTD PMID:33045310 Megf10 Mouse valproic acid affects expression ISO MEGF10 (Homo sapiens) 6480464 Valproic Acid affects the expression of MEGF10 mRNA CTD PMID:25979313 Megf10 Mouse valproic acid decreases expression ISO MEGF10 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of MEGF10 mRNA CTD PMID:23179753 more ... Megf10 Mouse valproic acid decreases expression ISO Megf10 (Rattus norvegicus) 6480464 Valproic Acid results in decreased expression of MEGF10 mRNA CTD PMID:29427782
Megf10 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 18 57,266,162 - 57,430,539 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 18 57,266,162 - 57,430,539 (+) Ensembl GRCm39 Ensembl GRCm38 18 57,133,090 - 57,297,467 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 18 57,133,090 - 57,297,467 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 18 57,292,744 - 57,457,121 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 18 57,258,844 - 57,422,835 (+) NCBI MGSCv36 mm8 Celera 18 58,443,454 - 58,608,465 (+) NCBI Celera Cytogenetic Map 18 D3 NCBI cM Map 18 31.5 NCBI
MEGF10 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 127,229,300 - 127,461,222 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 127,290,796 - 127,465,737 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 126,626,488 - 126,796,914 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 126,654,514 - 126,824,807 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 5 122,757,239 - 122,927,674 (+) NCBI Celera Cytogenetic Map 5 q23.2 NCBI HuRef 5 121,817,526 - 121,988,151 (+) NCBI HuRef CHM1_1 5 126,059,059 - 126,229,496 (+) NCBI CHM1_1 T2T-CHM13v2.0 5 127,749,142 - 127,981,009 (+) NCBI T2T-CHM13v2.0
Megf10 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 18 52,803,292 - 52,953,431 (+) NCBI GRCr8 mRatBN7.2 18 50,605,231 - 50,755,441 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 18 50,605,656 - 50,754,456 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 18 52,694,133 - 52,797,033 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 18 53,409,354 - 53,512,382 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 18 51,200,013 - 51,302,914 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 18 52,215,652 - 52,366,212 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 18 52,215,682 - 52,366,238 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 18 51,403,811 - 51,554,336 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 18 52,948,935 - 53,051,823 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 18 53,052,380 - 53,072,113 (+) NCBI Celera 18 48,786,696 - 48,889,249 (+) NCBI Celera Cytogenetic Map 18 q12.1 NCBI
Megf10 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955415 335,012 - 513,891 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955415 393,642 - 513,157 (+) NCBI ChiLan1.0 ChiLan1.0
MEGF10 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 122,534,832 - 122,770,730 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 120,674,719 - 120,910,289 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 122,639,155 - 122,877,324 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 128,466,095 - 128,657,845 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 128,466,095 - 128,641,043 (+) Ensembl panpan1.1 panPan2
MEGF10 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 16,359,648 - 16,574,882 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 16,378,669 - 16,617,335 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 15,047,444 - 15,360,462 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 16,981,258 - 17,301,745 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 16,940,314 - 17,349,743 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 15,711,146 - 16,024,958 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 15,557,940 - 15,871,023 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 16,155,094 - 16,474,941 (+) NCBI UU_Cfam_GSD_1.0
Megf10
MEGF10 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 130,189,556 - 130,401,077 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 130,226,222 - 130,403,960 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 135,524,848 - 135,686,689 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
MEGF10 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 30,028,154 - 30,405,033 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 30,234,489 - 30,404,996 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666034 47,643,480 - 48,026,869 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Megf10
.
Predicted Target Of
Count of predictions: 874 Count of miRNA genes: 571 Interacting mature miRNAs: 650 Transcripts: ENSMUST00000075770, ENSMUST00000139892 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
1302163 Bmd16_m bone mineral density 16 (mouse) Not determined 18 29667914 63668060 Mouse 1302099 Hdlq30_m HDL QTL 30 (mouse) Not determined 18 51668300 85668468 Mouse 11252137 Modvl5_m modifier of vacuolated lens 5 (mouse) 18 51052156 85052311 Mouse 10412184 Sstapa1_m Suseptibility to Staphylococus aureus infection 1 (mouse) Not determined 18 46541546 57590708 Mouse 4141431 Msmr2_m MSM lymphoma resistance 2 (mouse) Not determined 54975873 61238870 Mouse 25823171 Hrsq10_m host response to SARS QTL 10, D4% weight (mouse) 18 27241115 58827077 Mouse 10412183 Sstapa2_m Suseptibility to Staphylococus aureus infection 2 (mouse) Not determined 18 56794630 66952485 Mouse 11532709 Sluc41_m susceptibility to lung cancer 41 (mouse) 18 20953694 57590708 Mouse 10412244 Par5_m pulmonary adenoma resistance 5 (mouse) Not determined 18 51668300 85668468 Mouse 1301400 Lmr13_m leishmaniasis resistance 13 (mouse) Not determined 18 28109380 62109518 Mouse 25823174 Hrsq11_m host response to SARS QTL 11, log titer (mouse) 18 27241115 58827077 Mouse 1301215 Thcr_m T helper cell response (mouse) Not determined 18 45130604 68778777 Mouse 1301853 Heal9_m wound healing/regeneration 9 (mouse) Not determined 18 52805276 86805416 Mouse 25823173 Hrsq12_m host response to SARS QTL 12, hemorrhage (mouse) 18 24895881 78339555 Mouse 1357639 Obsty4_m obesity 4 (mouse) Not determined 18 39619914 84638778 Mouse 4142443 Pgis1_m proteoglycan induced spondylitis 1 (mouse) Not determined 18 53291022 76914293 Mouse 1558849 W3q15_m weight 3 weeks QTL 15 (mouse) Not determined 18 5041119 61272643 Mouse 12880412 V125Dq12_m vitamin D active form serum level QTL 12 (mouse) 18 30233067 64233067 Mouse 1301771 Pcyts6_m plasmacytoma susceptibility 6 (mouse) Not determined 18 35658632 69658851 Mouse 1301902 Hrtfm4_m heart failure modifier 4 (mouse) Not determined 18 43311120 77311343 Mouse 4141857 Mhysq5_m male hybrid sterility QTL 5 (mouse) Not determined 28130604 62130739 Mouse 1300685 Scc5_m colon tumor susceptibility 5 (mouse) Not determined 18 31988480 65988629 Mouse 12880410 V125Dq13_m vitamin D active form serum level QTL 13 (mouse) 18 56433071 90433071 Mouse 4142366 Chlq10_m circulating hormone level QTL 10 (mouse) Not determined 18 36291022 70291180 Mouse 12050070 Nabq2_m nasal bone morphology QTL 2 (mouse) 18 39103677 73103793 Mouse 1357630 Tgq1_m triglyceride QTL 1 (mouse) Not determined 18 51052156 85052311 Mouse 12880430 Fgf23lq4_m FGF23 serum level QTL 4 (mouse) 18 56433071 90433071 Mouse 12904745 Carcdq2_m cardiac collagen deposition QTL 2 (mouse) 18 46423287 80423287 Mouse 11039493 Ltpr8d_m Leishmania tropica response 8d (mouse) 18 46874903 80875042 Mouse 1357690 Vtbt19_m vertebral trabecular bone trait 19 (mouse) Not determined 18 33091043 67091221 Mouse 11039494 Ltpr8b_m Leishmania tropica response 8b (mouse) 18 46874903 80875042 Mouse 1301500 Szs4_m seizure susceptibility 4 (mouse) Not determined 18 54975873 85514143 Mouse 4142031 Moen1_m modifier of engrailed QTL 1 (mouse) Not determined 18 24115560 58115730 Mouse 15039381 Ltgq8_m liver triglyceride QTL 8 (mouse) 18 38206569 72206569 Mouse 1302050 Radpf4_m radiation pulmonary fibrosis 4 (mouse) Not determined 18 52966156 68778777 Mouse 12904950 Smmq3_m soleus muscle mass QTL 3 (mouse) 18 26056875 60056875 Mouse 15039383 Mvlq5_m microvesicular liver lesion QTL 5 (mouse) 18 38206569 72206569 Mouse 25823167 Hrsq5_m host response to SARS QTL 5, D3% weight (mouse) 18 27241115 58827077 Mouse 1357603 Mom3_m modifier of Min 3 (mouse) Not determined 18 14030023 67098962 Mouse 27226723 Tibw9_m tibia width 9, proximal, 16 week (mouse) 18 3200000 60933072 Mouse 15039384 Liviq1_m liver inflammation QTL 1 (mouse) 18 38206569 72206569 Mouse 15039386 Mvlq4_m macrovesicular liver lesion QTL 4 (mouse) 18 38206569 72206569 Mouse 27226720 Tibw5_m tibia width 5, proximal, 10 week (mouse) 18 50433067 62633071 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000075770 ⟹ ENSMUSP00000075174
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 18 57,266,162 - 57,430,539 (+) Ensembl GRCm38.p6 Ensembl 18 57,133,090 - 57,297,467 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000139892 ⟹ ENSMUSP00000116814
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 18 57,275,858 - 57,425,800 (+) Ensembl GRCm38.p6 Ensembl 18 57,142,786 - 57,292,728 (+) Ensembl
RefSeq Acc Id:
NM_001001979 ⟹ NP_001001979
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 18 57,266,162 - 57,430,539 (+) NCBI GRCm38 18 57,133,090 - 57,297,467 (+) ENTREZGENE MGSCv37 18 57,292,744 - 57,457,121 (+) RGD Celera 18 58,443,454 - 58,608,465 (+) RGD cM Map 18 ENTREZGENE
Sequence:
GTCCTGTCCGCCTGGCTGACGCTGGCCCTGTCCCCCAAATCCTTGTAGAGGGCCTAGACTCTTCTCCTGGGGTACTTTGAGGAGGGGTTAGCACTGGCACTGTGGGGCACAGCACTACTCTATCACTC
hide sequence
RefSeq Acc Id:
NP_001001979 ⟸ NM_001001979
- Peptide Label:
precursor
- UniProtKB:
Q6DIB5 (UniProtKB/Swiss-Prot), Q3UG73 (UniProtKB/Swiss-Prot), Q3TLU3 (UniProtKB/Swiss-Prot), A0A140T8S0 (UniProtKB/TrEMBL)
- Sequence:
MAISSSSCLGLICSLLCHWVGTASSLNLEDPNVCSHWESYSVTVQESYPHPFDQIYYTSCTDILNWFKCTRHRISYRTAYRHGEKTMYRRKSQCCPGFYESRDMCVPHCADKCVHGRCIAPNTCQCEP
hide sequence
Ensembl Acc Id:
ENSMUSP00000116814 ⟸ ENSMUST00000139892
Ensembl Acc Id:
ENSMUSP00000075174 ⟸ ENSMUST00000075770
RGD ID: 13677842 Promoter ID: EPDNEW_M23070 Type: initiation region Name: Megf10_2 Description: Mus musculus multiple EGF-like-domains 10 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M23071 EPDNEW_M23072 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 18 57,133,005 - 57,133,065 EPDNEW
RGD ID: 13677844 Promoter ID: EPDNEW_M23071 Type: initiation region Name: Megf10_3 Description: Mus musculus multiple EGF-like-domains 10 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M23070 EPDNEW_M23072 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 18 57,142,790 - 57,142,850 EPDNEW
RGD ID: 13677846 Promoter ID: EPDNEW_M23072 Type: single initiation site Name: Megf10_1 Description: Mus musculus multiple EGF-like-domains 10 , mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_M23070 EPDNEW_M23071 Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 18 57,159,339 - 57,159,399 EPDNEW
RGD ID: 6829364 Promoter ID: MM_KWN:25345 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Brain, Lung Transcripts: ENSMUST00000115370, NM_001001979 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 18 57,292,391 - 57,292,891 (+) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2024-08-21
Megf10
multiple EGF-like-domains 10
Gm331
gene model 331, (NCBI)
Symbol and/or name change
5135510 APPROVED
2024-08-21
Gm331
gene model 331, (NCBI)
Megf10
multiple EGF-like-domains 10
Symbol and/or name change
5135510 APPROVED
