Symbol:
Gpihbp1
Name:
GPI-anchored HDL-binding protein 1
RGD ID:
1557418
MGI Page
MGI
Description:
Enables lipase binding activity; lipoprotein particle binding activity; and protein transporter activity. Involved in several processes, including cholesterol homeostasis; positive regulation of chylomicron remnant clearance; and protein transport. Acts upstream of or within lipid transport. Located in apical plasma membrane; basolateral plasma membrane; and external side of plasma membrane. Is expressed in lung vascular element. Human ortholog(s) of this gene implicated in familial GPIHBP1 deficiency. Orthologous to human GPIHBP1 (glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
1110002J19Rik; glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; GPI-H; GPI-HBP1; high density lipoprotein-binding protein 1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 75,468,479 - 75,470,062 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 75,468,477 - 75,471,330 (+) Ensembl GRCm39 Ensembl GRCm38 15 75,596,630 - 75,598,213 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 75,596,628 - 75,599,481 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 75,427,088 - 75,428,643 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 75,423,913 - 75,425,468 (+) NCBI MGSCv36 mm8 Celera 15 77,096,812 - 77,098,367 (+) NCBI Celera Cytogenetic Map 15 D3 NCBI cM Map 15 34.59 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Gpihbp1 Mouse (1->4)-beta-D-glucan multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GPIHBP1 mRNA CTD PMID:36331819 Gpihbp1 Mouse 1,1-dichloroethene increases expression EXP 6480464 vinylidene chloride results in increased expression of GPIHBP1 mRNA CTD PMID:26682919 Gpihbp1 Mouse 1,2-dimethylhydrazine decreases expression EXP 6480464 1 and 2-Dimethylhydrazine results in decreased expression of GPIHBP1 mRNA CTD PMID:22206623 Gpihbp1 Mouse 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Gpihbp1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of GPIHBP1 mRNA CTD PMID:21570461 Gpihbp1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Gpihbp1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin affects the expression of GPIHBP1 mRNA CTD PMID:34747641 Gpihbp1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Gpihbp1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of GPIHBP1 mRNA CTD PMID:32109520 Gpihbp1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of GPIHBP1 mRNA CTD PMID:28238261 Gpihbp1 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Gpihbp1 Mouse 4,4'-sulfonyldiphenol increases expression EXP 6480464 bisphenol S results in increased expression of GPIHBP1 mRNA CTD PMID:30951980 and PMID:39298647 Gpihbp1 Mouse 4,4'-sulfonyldiphenol decreases methylation EXP 6480464 bisphenol S results in decreased methylation of GPIHBP1 gene CTD PMID:31683443 Gpihbp1 Mouse 6-propyl-2-thiouracil decreases expression ISO Gpihbp1 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of GPIHBP1 mRNA CTD PMID:25825206 Gpihbp1 Mouse 6-propyl-2-thiouracil increases expression ISO Gpihbp1 (Rattus norvegicus) 6480464 Propylthiouracil results in increased expression of GPIHBP1 mRNA CTD PMID:30047161 Gpihbp1 Mouse alpha-Zearalanol multiple interactions ISO Gpihbp1 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of GPIHBP1 mRNA CTD PMID:35163327 Gpihbp1 Mouse amitrole increases expression ISO Gpihbp1 (Rattus norvegicus) 6480464 Amitrole results in increased expression of GPIHBP1 mRNA CTD PMID:30047161 Gpihbp1 Mouse amphetamine increases expression ISO Gpihbp1 (Rattus norvegicus) 6480464 Amphetamine results in increased expression of GPIHBP1 mRNA CTD PMID:30779732 Gpihbp1 Mouse antirheumatic drug increases expression ISO GPIHBP1 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of GPIHBP1 mRNA CTD PMID:24449571 Gpihbp1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of GPIHBP1 mRNA CTD PMID:21964900 Gpihbp1 Mouse benzo[a]pyrene decreases methylation ISO GPIHBP1 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of GPIHBP1 3' UTR CTD PMID:27901495 Gpihbp1 Mouse benzo[a]pyrene affects methylation ISO GPIHBP1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of GPIHBP1 promoter CTD PMID:27901495 Gpihbp1 Mouse benzo[a]pyrene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of GPIHBP1 mRNA CTD PMID:27858113 Gpihbp1 Mouse benzo[a]pyrene decreases expression EXP 6480464 Benzo(a)pyrene results in decreased expression of GPIHBP1 mRNA CTD PMID:21569818 more ... Gpihbp1 Mouse benzo[b]fluoranthene decreases expression EXP 6480464 benzo(b)fluoranthene results in decreased expression of GPIHBP1 mRNA CTD PMID:26377693 Gpihbp1 Mouse benzo[b]fluoranthene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of GPIHBP1 mRNA CTD PMID:27858113 Gpihbp1 Mouse bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Gpihbp1 Mouse bis(2-ethylhexyl) phthalate decreases expression EXP 6480464 Diethylhexyl Phthalate results in decreased expression of GPIHBP1 mRNA CTD PMID:28085963 Gpihbp1 Mouse bisphenol A decreases expression ISO Gpihbp1 (Rattus norvegicus) 6480464 bisphenol A results in decreased expression of GPIHBP1 mRNA CTD PMID:25181051 more ... Gpihbp1 Mouse bisphenol A multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with 2 more ... CTD PMID:28433925 Gpihbp1 Mouse C60 fullerene affects expression ISO Gpihbp1 (Rattus norvegicus) 6480464 fullerene C60 affects the expression of GPIHBP1 mRNA CTD PMID:19167457 Gpihbp1 Mouse cadmium dichloride increases expression ISO GPIHBP1 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of GPIHBP1 mRNA CTD PMID:38568856 Gpihbp1 Mouse cantharidin decreases expression EXP 6480464 Cantharidin results in decreased expression of GPIHBP1 mRNA CTD PMID:36907384 Gpihbp1 Mouse chrysene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of GPIHBP1 mRNA CTD PMID:27858113 Gpihbp1 Mouse clothianidin increases expression ISO GPIHBP1 (Homo sapiens) 6480464 clothianidin results in increased expression of GPIHBP1 mRNA CTD PMID:31626844 Gpihbp1 Mouse copper(II) sulfate increases expression ISO GPIHBP1 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of GPIHBP1 mRNA CTD PMID:19549813 Gpihbp1 Mouse cyclosporin A decreases methylation ISO GPIHBP1 (Homo sapiens) 6480464 Cyclosporine results in decreased methylation of GPIHBP1 promoter CTD PMID:27989131 Gpihbp1 Mouse dibenz[a,h]anthracene decreases expression EXP 6480464 1 more ... CTD PMID:26377693 Gpihbp1 Mouse diethyl maleate decreases expression EXP 6480464 diethyl maleate results in decreased expression of GPIHBP1 mRNA CTD PMID:25270620 Gpihbp1 Mouse dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of GPIHBP1 mRNA CTD PMID:20880076 Gpihbp1 Mouse etoposide decreases expression EXP 6480464 Etoposide results in decreased expression of GPIHBP1 mRNA CTD PMID:25270620 Gpihbp1 Mouse furan increases expression ISO Gpihbp1 (Rattus norvegicus) 6480464 furan results in increased expression of GPIHBP1 mRNA CTD PMID:27387713 Gpihbp1 Mouse genistein decreases expression EXP 6480464 Genistein results in decreased expression of GPIHBP1 mRNA CTD PMID:32186404 Gpihbp1 Mouse isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of GPIHBP1 mRNA CTD PMID:20003209 Gpihbp1 Mouse metformin increases expression ISO Gpihbp1 (Rattus norvegicus) 6480464 Metformin results in increased expression of GPIHBP1 mRNA CTD PMID:31324951 Gpihbp1 Mouse methimazole increases expression ISO Gpihbp1 (Rattus norvegicus) 6480464 Methimazole results in increased expression of GPIHBP1 mRNA CTD PMID:30047161 Gpihbp1 Mouse mitomycin C decreases expression EXP 6480464 Mitomycin results in decreased expression of GPIHBP1 mRNA CTD PMID:25270620 Gpihbp1 Mouse nickel atom decreases expression ISO GPIHBP1 (Homo sapiens) 6480464 Nickel results in decreased expression of GPIHBP1 mRNA CTD PMID:24768652 and PMID:25583101 Gpihbp1 Mouse oxaliplatin increases expression ISO Gpihbp1 (Rattus norvegicus) 6480464 oxaliplatin results in increased expression of GPIHBP1 mRNA CTD PMID:25729387 Gpihbp1 Mouse oxaliplatin multiple interactions ISO Gpihbp1 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of GPIHBP1 mRNA CTD PMID:25729387 Gpihbp1 Mouse ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of GPIHBP1 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of GPIHBP1 mRNA CTD PMID:27106289 and PMID:34911549 Gpihbp1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of GPIHBP1 mRNA CTD PMID:17562736 Gpihbp1 Mouse perfluorooctane-1-sulfonic acid multiple interactions EXP 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of GPIHBP1 mRNA CTD PMID:36331819 Gpihbp1 Mouse perfluorooctanoic acid multiple interactions ISO Gpihbp1 (Rattus norvegicus) 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in increased expression of GPIHBP1 mRNA CTD PMID:35163327 Gpihbp1 Mouse phenobarbital multiple interactions EXP 6480464 NR1I3 protein affects the reaction [Phenobarbital results in decreased expression of GPIHBP1 mRNA] CTD PMID:19482888 Gpihbp1 Mouse phenobarbital decreases expression EXP 6480464 Phenobarbital results in decreased expression of GPIHBP1 mRNA CTD PMID:19482888 and PMID:25270620 Gpihbp1 Mouse pioglitazone multiple interactions EXP 6480464 [N-nitroso-tris-chloroethylurea co-treated with pioglitazone] results in decreased expression of GPIHBP1 mRNA CTD PMID:27935865 Gpihbp1 Mouse resveratrol multiple interactions ISO GPIHBP1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of GPIHBP1 mRNA CTD PMID:23557933 Gpihbp1 Mouse rotenone increases expression ISO Gpihbp1 (Rattus norvegicus) 6480464 Rotenone results in increased expression of GPIHBP1 mRNA CTD PMID:28374803 Gpihbp1 Mouse sodium arsenite affects expression EXP 6480464 sodium arsenite affects the expression of GPIHBP1 CTD PMID:25367288 Gpihbp1 Mouse sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of GPIHBP1 mRNA CTD PMID:37682722 Gpihbp1 Mouse sulfadimethoxine increases expression ISO Gpihbp1 (Rattus norvegicus) 6480464 Sulfadimethoxine results in increased expression of GPIHBP1 mRNA CTD PMID:30047161 Gpihbp1 Mouse tacrolimus hydrate decreases expression EXP 6480464 Tacrolimus results in decreased expression of GPIHBP1 mRNA CTD PMID:29362864 Gpihbp1 Mouse tetraphene multiple interactions EXP 6480464 [Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in decreased expression of GPIHBP1 mRNA CTD PMID:27858113 Gpihbp1 Mouse titanium dioxide decreases expression ISO Gpihbp1 (Rattus norvegicus) 6480464 titanium dioxide results in decreased expression of GPIHBP1 mRNA CTD PMID:30012374 Gpihbp1 Mouse topotecan multiple interactions ISO Gpihbp1 (Rattus norvegicus) 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of GPIHBP1 mRNA CTD PMID:25729387 Gpihbp1 Mouse topotecan increases expression ISO Gpihbp1 (Rattus norvegicus) 6480464 Topotecan results in increased expression of GPIHBP1 mRNA CTD PMID:25729387 Gpihbp1 Mouse tremolite asbestos decreases expression EXP 6480464 tremolite results in decreased expression of GPIHBP1 mRNA CTD PMID:29279043 Gpihbp1 Mouse valproic acid increases methylation ISO GPIHBP1 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of GPIHBP1 gene CTD PMID:29154799
(1->4)-beta-D-glucan (EXP) 1,1-dichloroethene (EXP) 1,2-dimethylhydrazine (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 4,4'-sulfonyldiphenol (EXP) 6-propyl-2-thiouracil (ISO) alpha-Zearalanol (ISO) amitrole (ISO) amphetamine (ISO) antirheumatic drug (ISO) benzo[a]pyrene (EXP,ISO) benzo[b]fluoranthene (EXP) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) C60 fullerene (ISO) cadmium dichloride (ISO) cantharidin (EXP) chrysene (EXP) clothianidin (ISO) copper(II) sulfate (ISO) cyclosporin A (ISO) dibenz[a,h]anthracene (EXP) diethyl maleate (EXP) dioxygen (EXP) etoposide (EXP) furan (ISO) genistein (EXP) isoprenaline (EXP) metformin (ISO) methimazole (ISO) mitomycin C (EXP) nickel atom (ISO) oxaliplatin (ISO) ozone (EXP) paracetamol (EXP) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (ISO) phenobarbital (EXP) pioglitazone (EXP) resveratrol (ISO) rotenone (ISO) sodium arsenite (EXP) sulfadimethoxine (ISO) tacrolimus hydrate (EXP) tetraphene (EXP) titanium dioxide (ISO) topotecan (ISO) tremolite asbestos (EXP) valproic acid (ISO)
Gpihbp1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 15 75,468,479 - 75,470,062 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 15 75,468,477 - 75,471,330 (+) Ensembl GRCm39 Ensembl GRCm38 15 75,596,630 - 75,598,213 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 15 75,596,628 - 75,599,481 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 15 75,427,088 - 75,428,643 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 15 75,423,913 - 75,425,468 (+) NCBI MGSCv36 mm8 Celera 15 77,096,812 - 77,098,367 (+) NCBI Celera Cytogenetic Map 15 D3 NCBI cM Map 15 34.59 NCBI
GPIHBP1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 8 143,213,218 - 143,217,170 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 8 143,213,218 - 143,217,170 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 8 144,295,093 - 144,299,044 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 8 144,366,443 - 144,370,418 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 8 140,603,655 - 140,607,614 (+) NCBI Celera Cytogenetic Map 8 q24.3 NCBI HuRef 8 139,547,646 - 139,551,566 (+) NCBI HuRef CHM1_1 8 144,335,309 - 144,339,286 (+) NCBI CHM1_1 T2T-CHM13v2.0 8 144,358,507 - 144,362,402 (+) NCBI T2T-CHM13v2.0
Gpihbp1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 109,166,334 - 109,169,448 (+) NCBI GRCr8 mRatBN7.2 7 107,285,584 - 107,288,702 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 107,285,654 - 107,288,702 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 109,020,613 - 109,023,660 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 111,244,277 - 111,247,324 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 111,190,206 - 111,193,253 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 116,632,496 - 116,635,543 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 116,632,506 - 116,634,293 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 116,525,703 - 116,528,750 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 113,538,424 - 113,541,471 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 7 103,648,499 - 103,651,546 (+) NCBI Celera Cytogenetic Map 7 q34 NCBI
Gpihbp1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955454 1,970,626 - 1,973,743 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955454 1,965,627 - 1,972,479 (+) NCBI ChiLan1.0 ChiLan1.0
GPIHBP1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 7 160,690,170 - 160,694,121 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 8 136,207,643 - 136,211,594 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 8 139,960,255 - 139,964,189 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 8 142,980,151 - 142,984,629 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 8 142,980,151 - 142,985,429 (+) Ensembl panpan1.1 panPan2
GPIHBP1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 13 37,005,499 - 37,007,214 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 13 37,005,512 - 37,007,074 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 13 36,958,242 - 36,959,971 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 13 37,477,245 - 37,478,977 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 13 37,477,270 - 37,478,835 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 13 37,149,764 - 37,151,494 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 13 37,268,265 - 37,270,004 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 13 37,745,112 - 37,746,841 (+) NCBI UU_Cfam_GSD_1.0
Gpihbp1
GPIHBP1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 4 1,254,565 - 1,256,577 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 4 1,253,401 - 1,256,921 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 4 1,344,593 - 1,347,007 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
GPIHBP1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 8 137,433,669 - 137,440,681 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 8 137,436,997 - 137,440,909 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666039 2,499,974 - 2,506,432 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Gpihbp1
.
Predicted Target Of
Count of predictions: 197 Count of miRNA genes: 190 Interacting mature miRNAs: 196 Transcripts: ENSMUST00000023243 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1301779 Dpml_m dopamine loss (mouse) Not determined 15 51004694 76794493 Mouse 38501067 Tip3_m tuberculosis immunophenotype 3, IFN-g level (mouse) 15 53563396 89584203 Mouse 1300627 Sluc26_m susceptibility to lung cancer 26 (mouse) Not determined 15 70345653 104073951 Mouse 27226777 Tibl8_m tibia length 8, 5 week (mouse) 15 6929481 84584201 Mouse 15092079 Igly6_m IgG glycosylation 6, GP6 (mouse) 15 74100540 82674156 Mouse 27226773 Tibl16_m tibia length 16, 10 week (mouse) 15 6929481 75871849 Mouse 4142252 Tailaq4_m tail length adjusted QTL 4 (mouse) Not determined 3489694 78601286 Mouse 1357703 Vtbt17_m vertebral trabecular bone trait 17 (mouse) Not determined 15 44553313 78553437 Mouse 13504731 Cath5_m carotid atherosclerosis 5 (mouse) 15 54789129 88789129 Mouse 1558786 Msq1_m MAV-1 susceptibility QTL 1 (mouse) Not determined 15 63389646 81086436 Mouse 12791003 Aath8_m aortic arch atherosclerosis 8 (mouse) 15 73430144 104073951 Mouse 1301006 Hfib1_m hepatic fibrogenesis 1 (mouse) Not determined 15 47306334 81306479 Mouse 27095936 Ulnl4_m ulna length 4, 5 week (mouse) 15 56763396 87684201 Mouse 10755515 Amzn3_m anatomical modifier of Zfp423 3 (mouse) 15 46389646 80389845 Mouse 1301171 Brm2_m brachyury modifier 2 (mouse) Not determined 15 65525376 99525499 Mouse 1301429 Pcir3_m periosteal circumference 3 (mouse) Not determined 15 48465362 82465496 Mouse 1302197 Bhr2_m bronchial hyperresponsiveness 2 (mouse) Not determined 15 64306334 103425899 Mouse 26884402 Cvht9_m cranial vault height 9, 16 week (mouse) 15 42163396 95497881 Mouse 1357756 Alaa4_m alopecia areata 4 (mouse) Not determined 15 46389646 80389845 Mouse 1302074 Bmd4_m bone mineral density 4 (mouse) Not determined 15 56186708 103425899 Mouse 1301433 Rapop5_m radiation-induced apoptosis 5 (mouse) Not determined 15 9273022 79474762 Mouse 26884392 Humsd8_m humerus midshaft diameter 8, 16 week (mouse) 15 29300146 76084200 Mouse 26884399 Humsd1_m humerus midshaft diameter 1, 5 week (mouse) 15 48363396 101708435 Mouse 26884397 Humsd5_m humerus midshaft diameter 5, 10 week (mouse) 15 48363396 98397881 Mouse 1300648 Dbsty4_m diabesity 4 (mouse) Not determined 15 70349271 104073951 Mouse 27226786 Feml11_m femur length 11, 5 week (mouse) 15 6129481 75871849 Mouse 10412067 Pain2_m pain 2 (mouse) Not determined 15 51645339 85645626 Mouse 4141952 W3q7_m weight 3 weeks QTL 7 (mouse) Not determined 3489694 78601286 Mouse 26884442 Sklq6_m skull length QTL 6, 5 week (mouse) 15 6129481 100797881 Mouse 27226717 Tibw4_m tibia width 4, proximal, 10 week (mouse) 15 6129481 78684200 Mouse 1357526 Hyplip2_m hyperlipidemia 2 (mouse) Not determined 15 12402203 102896555 Mouse 4142198 Hbtq_m habituation QTL (mouse) Not determined 15 51160708 85160833 Mouse 1357407 Pfat4_m predicted fat percentage 4 (mouse) 8.6 Body fat amount predicted fat percentage 15 57117005 91117153 Mouse 4142448 Tailq6_m tail length QTL 6 (mouse) Not determined 3489694 78601286 Mouse 1357659 Epfpq4_m epididymal fat percentage QTL 4 (mouse) Not determined 15 3489694 78601286 Mouse 25671381 Hrsq3_m host response to SARS QTL 3, eosinophilia (mouse) 15 72144539 75844833 Mouse 26884425 Cvht2_m cranial vault height 2, 5 week (mouse) 15 28800146 102008435 Mouse 1301568 Tria2_m T-cell receptor induced activation 2 (mouse) Not determined 15 44859141 78859281 Mouse 1302080 Szs13_m seizure susceptibility 13 (mouse) Not determined 15 51685832 85694449 Mouse 1300800 Ses3_m salmonella enteritidis susceptibility 3 (mouse) Not determined 15 57117005 91117153 Mouse 10045637 Heal27_m wound healing/regeneration 29 (mouse) Not determined 15 51418361 85418511 Mouse 1558985 Eae32_m experimental allergic encephalomyelitis susceptibility 32 (mouse) Not determined 15 32578416 103425899 Mouse 4141921 Pstc3_m periosteal circumference 3 (mouse) Not determined 15 67270698 101270847 Mouse 1301708 Cocrb14_m cocaine related behavior 14 (mouse) Not determined 15 51806515 85806651 Mouse 12880420 V25Dq8_m vitamin D inactive form serum level QTL 8 (mouse) 15 61584200 95584200 Mouse 27095932 Ulnl11_m ulna length 11, 16 week (mouse) 15 6129481 76384200 Mouse 1302002 Cocia2_m cocaine induced activation 2 (mouse) Not determined 15 72372459 79899178 Mouse 14747011 Mancz13_m mandible centroid size 13 (mouse) 15 72382669 104073951 Mouse 1357559 Scfq2_m subcutaneous fat pad weight QTL 2 (mouse) Not determined 15 3489694 78601286 Mouse 1300726 Pitm4_m prion incubation time 4 (mouse) Not determined 15 70349271 104073951 Mouse 1301119 Drb7_m dopamine receptor binding 7 (mouse) Not determined 15 65336578 99341028 Mouse 4141135 Cia35_m collagen induced arthritis 35 (mouse) Not determined 15 64811826 98811946 Mouse 27226734 Tibmd5_m tibia midshaft diameter 5, 10 week (mouse) 15 6129481 86684201 Mouse 13442492 Mecth2_m mechanosensation threshold 2 (mouse) 15 74662849 79387201 Mouse 1301601 Faq9_m fluctuating asymmetry QTL 9 (mouse) Not determined 15 63163903 97163995 Mouse 1301472 Pain1_m pain 1 (mouse) Not determined 15 75320846 90813185 Mouse 27226729 Tibmd2_m tibia midshaft diameter 2, 5 week (mouse) 15 38000244 86684201 Mouse 1301860 Gct3_m granulosa cell tumorigenesis 3 (mouse) Not determined 15 47409596 81409691 Mouse 27226721 Tibw8_m tibia width 8, proximal, 16 week (mouse) 15 6929481 75871849 Mouse 1300844 Emo2_m emotionality 2 (mouse) Not determined 15 72372459 76794493 Mouse
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000023243 ⟹ ENSMUSP00000023243
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 15 75,468,479 - 75,470,062 (+) Ensembl GRCm38.p6 Ensembl 15 75,596,630 - 75,598,213 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000186934
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 15 75,468,517 - 75,470,037 (+) Ensembl GRCm38.p6 Ensembl 15 75,596,668 - 75,598,188 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000189874 ⟹ ENSMUSP00000139792
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 15 75,468,503 - 75,471,330 (+) Ensembl GRCm38.p6 Ensembl 15 75,596,654 - 75,599,481 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000189944 ⟹ ENSMUSP00000139511
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 15 75,468,477 - 75,470,062 (+) Ensembl GRCm38.p6 Ensembl 15 75,596,628 - 75,598,213 (+) Ensembl
Ensembl Acc Id:
ENSMUST00000190119
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 15 75,468,517 - 75,469,793 (+) Ensembl GRCm38.p6 Ensembl 15 75,596,668 - 75,597,944 (+) Ensembl
RefSeq Acc Id:
NM_001347039 ⟹ NP_001333968
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 15 75,468,479 - 75,470,062 (+) NCBI GRCm38 15 75,596,630 - 75,598,213 (+) NCBI
Sequence:
AGAACCCCGAGTGAGGACTGCGCCAGTAGACAGAACAGCCTGAGCCAGGATGAAGGCTCTCAGGGCTGTCCTCCTGATCTTGCTACTAAGTGGACAGCCAGGGAGTGGCTGGGCACAAGAAGATGGTG
hide sequence
RefSeq Acc Id:
NM_001361294 ⟹ NP_001348223
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 15 75,468,479 - 75,470,062 (+) NCBI GRCm38 15 75,596,630 - 75,598,213 (+) NCBI
Sequence:
AGAACCCCGAGTGAGGACTGCGCCAGTAGACAGAACAGCCTGAGCCAGGATGAAGGCTCTCAGGGCTGTCCTCCTGATCTTGCTACTAAGTGGACAGCCAGGGAGTGGCTGGGCACAAGAAGATGGTG
hide sequence
RefSeq Acc Id:
NM_026730 ⟹ NP_081006
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 15 75,468,479 - 75,470,062 (+) NCBI GRCm38 15 75,596,630 - 75,598,213 (+) NCBI MGSCv37 15 75,427,088 - 75,428,643 (+) RGD Celera 15 77,096,812 - 77,098,367 (+) RGD cM Map 15 ENTREZGENE
Sequence:
AGAACCCCGAGTGAGGACTGCGCCAGTAGACAGAACAGCCTGAGCCAGGATGAAGGCTCTCAGG
hide sequence
RefSeq Acc Id:
NP_081006 ⟸ NM_026730
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q9D1N2 (UniProtKB/Swiss-Prot)
- Sequence:
MKALRAVLLILLLSGQPGSGWAQEDGDADPEPENYNYDDDDDEEEEEETNMIPGSRDRAPLQCYFCQVLHSGESCNQTQSCSSSKPFCITLVSHSGTDKGYLTTYSMWCTDTCQPIIKTVGGTQMTQT
hide sequence
RefSeq Acc Id:
NP_001333968 ⟸ NM_001347039
- Peptide Label:
isoform 2 precursor
- UniProtKB:
A0A087WNV7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
NP_001348223 ⟸ NM_001361294
- Peptide Label:
isoform 3 precursor
- UniProtKB:
A0A087WPI6 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSMUSP00000023243 ⟸ ENSMUST00000023243
Ensembl Acc Id:
ENSMUSP00000139792 ⟸ ENSMUST00000189874
Ensembl Acc Id:
ENSMUSP00000139511 ⟸ ENSMUST00000189944
RGD ID: 6826073 Promoter ID: MM_KWN:18800 Type: Non-CpG SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: Lung Transcripts: NM_026730 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 15 75,427,221 - 75,427,721 (+) MPROMDB
RGD ID: 8684012 Promoter ID: EPDNEW_M20037 Type: multiple initiation site Name: Gpihbp1_1 Description: Mus musculus GPI-anchored HDL-binding protein 1 , transcriptvariant 1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 15 75,596,654 - 75,596,714 EPDNEW
