Advanced Search (OLGA)

Gene: Skp1 (S-phase kinase-associated protein 1) Mus musculus

Subscribe to Updates

Analyze

Symbol:

Skp1

Name:

S-phase kinase-associated protein 1

RGD ID:

1553334

MGI Page

MGI

Description:

Predicted to enable several functions, including F-box domain binding activity; beta-catenin binding activity; and cullin family protein binding activity. Predicted to contribute to ubiquitin-protein transferase activity. Involved in SCF-dependent proteasomal ubiquitin-dependent protein catabolic process. Acts upstream of or within protein K48-linked ubiquitination and protein monoubiquitination. Located in centrosome and cytosol. Part of Cul7-RING ubiquitin ligase complex and SCF ubiquitin ligase complex. Is expressed in several structures, including central nervous system; early conceptus; genitourinary system; notochord; and sensory organ. Orthologous to human SKP1 (S-phase kinase associated protein 1).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

15kDa; 2610043E24Rik; 2610206H23Rik; cyclin A/CDK2-associated protein p19; cyclin-A/CDK2-associated protein p19; EMC19; OCP-II; OCP2; p19A; p19S; p19Skp1; S-phase kinase-associated protein 1A; Sk; Skp1a; Tceb1; Tceb1l; transcription elongation factor B (SIII), polypeptide 1 (15 kDa),-like; transcription elongation factor B (SIII), polypeptide 1-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SKP1 (S-phase kinase associated protein 1)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Skp1 (S-phase kinase-associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Skp1 (S-phase kinase associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SKP1 (S-phase kinase associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SKP1 (S-phase kinase associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Skp1 (S-phase kinase associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SKP1 (S-phase kinase associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SKP1 (S-phase kinase associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Skp1 (S-phase kinase associated protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SKP1 (S-phase kinase associated protein 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Rattus norvegicus (Norway rat):	Skp1 (S-phase kinase-associated protein 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	skp1 (S-phase kinase-associated protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Caenorhabditis elegans (roundworm):	skr-10	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-13	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-14	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-15	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-16	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-17	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-18	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-19	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-20	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-21	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-7	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-8	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-9	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SKP1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	SkpA	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	SkpB	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	SkpC	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	SkpE	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	SkpF	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	skr-12	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	skr-3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	SkpD	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	skr-5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	skr-6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	skp1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Related Pseudogenes:

Gm12988

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	52,121,349 - 52,137,685 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	52,122,822 - 52,137,685 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	52,230,522 - 52,246,858 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	52,231,995 - 52,246,858 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	52,045,497 - 52,060,360 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	52,075,432 - 52,090,281 (+)	NCBI		MGSCv36	mm8
Celera	11	56,801,165 - 56,816,028 (+)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	31.86	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Skp1	Mouse	familial adenomatous polyposis 1		ISO	SKP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial adenomatous polyposis 1	ClinVar	PMID:17963004 more ...
Skp1	Mouse	Hereditary Neoplastic Syndromes		ISO	SKP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Hereditary cancer-predisposing syndrome	ClinVar	PMID:17963004 more ...
Skp1	Mouse	Keratoconus 1		ISO	SKP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Keratoconus 1	ClinVar
Skp1	Mouse	Neurodevelopmental Disorders		ISO	SKP1 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Neurodevelopmental disorder	ClinVar	PMID:25741868

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Skp1	Mouse	(1->4)-beta-D-glucan	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SKP1 mRNA	CTD	PMID:36331819
Skp1	Mouse	17alpha-ethynylestradiol	multiple interactions	EXP		6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SKP1 mRNA	CTD	PMID:17942748
Skp1	Mouse	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of SKP1 mRNA	CTD	PMID:17942748
Skp1	Mouse	2,2',4,4'-Tetrabromodiphenyl ether	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Skp1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of SKP1 mRNA	CTD	PMID:21570461
Skp1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Skp1 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of SKP1 mRNA	CTD	PMID:33387578
Skp1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	Skp1 (Rattus norvegicus)	6480464	Tetrachlorodibenzodioxin results in increased expression of SKP1 mRNA	CTD	PMID:34747641
Skp1	Mouse	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	EXP		6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of SKP1 mRNA	CTD	PMID:17942748
Skp1	Mouse	2,4,6-tribromophenol	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	2 more ...	CTD	PMID:31675489
Skp1	Mouse	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	tetrabromobisphenol A results in decreased expression of SKP1 protein	CTD	PMID:31675489
Skp1	Mouse	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	SKP1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SKP1 mRNA	CTD	PMID:28628672
Skp1	Mouse	4,4'-sulfonyldiphenol	increases expression	EXP		6480464	bisphenol S results in increased expression of SKP1 mRNA	CTD	PMID:39298647
Skp1	Mouse	4,4'-sulfonyldiphenol	multiple interactions	ISO	SKP1 (Homo sapiens)	6480464	[bisphenol S co-treated with Fulvestrant] results in increased methylation of SKP1 gene	CTD	PMID:31601247
Skp1	Mouse	5-aza-2'-deoxycytidine	decreases expression	EXP		6480464	Decitabine results in decreased expression of SKP1 mRNA	CTD	PMID:27915011
Skp1	Mouse	acrylamide	increases expression	ISO	Skp1 (Rattus norvegicus)	6480464	Acrylamide results in increased expression of SKP1 mRNA	CTD	PMID:28959563
Skp1	Mouse	actinomycin D	multiple interactions	ISO	SKP1 (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of SKP1 protein	CTD	PMID:38460933
Skp1	Mouse	arsane	increases expression	ISO	SKP1 (Homo sapiens)	6480464	Arsenic results in increased expression of SKP1 mRNA	CTD	PMID:19945496
Skp1	Mouse	arsenic atom	increases expression	ISO	SKP1 (Homo sapiens)	6480464	Arsenic results in increased expression of SKP1 mRNA	CTD	PMID:19945496
Skp1	Mouse	arsenite(3-)	multiple interactions	ISO	SKP1 (Homo sapiens)	6480464	arsenite promotes the reaction [G3BP1 protein binds to SKP1 mRNA]	CTD	PMID:32406909
Skp1	Mouse	benzo[a]pyrene	increases expression	EXP		6480464	Benzo(a)pyrene results in increased expression of SKP1 mRNA	CTD	PMID:22228805
Skp1	Mouse	bis(2-ethylhexyl) phthalate	increases expression	EXP		6480464	Diethylhexyl Phthalate results in increased expression of SKP1 mRNA	CTD	PMID:33754040
Skp1	Mouse	bisphenol A	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	bisphenol A results in decreased expression of SKP1 protein	CTD	PMID:31675489
Skp1	Mouse	bisphenol AF	increases expression	ISO	SKP1 (Homo sapiens)	6480464	bisphenol AF results in increased expression of SKP1 protein	CTD	PMID:34186270
Skp1	Mouse	Bisphenol B	increases expression	ISO	SKP1 (Homo sapiens)	6480464	bisphenol B results in increased expression of SKP1 protein	CTD	PMID:34186270
Skp1	Mouse	bisphenol F	multiple interactions	ISO	SKP1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SKP1 mRNA	CTD	PMID:28628672
Skp1	Mouse	Brodifacoum	increases expression	ISO	Skp1 (Rattus norvegicus)	6480464	bromfenacoum results in increased expression of SKP1 protein	CTD	PMID:28903499
Skp1	Mouse	calycosin	increases expression	ISO	SKP1 (Homo sapiens)	6480464	7 and 3'-dihydroxy-4'-methoxyisoflavone results in increased expression of SKP1 mRNA	CTD	PMID:24455688
Skp1	Mouse	cannabidiol	multiple interactions	ISO	SKP1 (Homo sapiens)	6480464	[Cuprizone co-treated with Cannabidiol] results in decreased expression of SKP1 protein	CTD	PMID:34122009
Skp1	Mouse	carbamazepine	affects expression	ISO	SKP1 (Homo sapiens)	6480464	Carbamazepine affects the expression of SKP1 mRNA	CTD	PMID:25979313
Skp1	Mouse	carbon nanotube	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	Nanotubes and Carbon results in decreased expression of SKP1 protein	CTD	PMID:22157353
Skp1	Mouse	carbon nanotube	decreases expression	EXP		6480464	Nanotubes and Carbon results in decreased expression of SKP1 mRNA	CTD	PMID:25620056
Skp1	Mouse	CGP 52608	multiple interactions	ISO	SKP1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to SKP1 gene]	CTD	PMID:28238834
Skp1	Mouse	clofibrate	multiple interactions	EXP		6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of SKP1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of SKP1 mRNA]	CTD	PMID:17585979
Skp1	Mouse	clofibrate	increases expression	EXP		6480464	Clofibrate results in increased expression of SKP1 mRNA	CTD	PMID:17585979
Skp1	Mouse	clozapine	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	Clozapine results in decreased expression of SKP1 protein	CTD	PMID:34122009
Skp1	Mouse	coumarin	decreases phosphorylation	ISO	SKP1 (Homo sapiens)	6480464	coumarin results in decreased phosphorylation of SKP1 protein	CTD	PMID:35688186
Skp1	Mouse	Cuprizon	multiple interactions	ISO	SKP1 (Homo sapiens)	6480464	[Cuprizone co-treated with Cannabidiol] results in decreased expression of SKP1 protein	CTD	PMID:34122009
Skp1	Mouse	cyclosporin A	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	Cyclosporine results in decreased expression of SKP1 mRNA	CTD	PMID:25562108
Skp1	Mouse	decabromodiphenyl ether	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	decabromobiphenyl ether results in decreased expression of SKP1 protein	CTD	PMID:31675489
Skp1	Mouse	deguelin	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	deguelin results in decreased expression of SKP1 mRNA	CTD	PMID:33512557
Skp1	Mouse	dexamethasone	multiple interactions	ISO	SKP1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SKP1 mRNA	CTD	PMID:28628672
Skp1	Mouse	Dibutyl phosphate	affects expression	ISO	SKP1 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of SKP1 mRNA	CTD	PMID:37042841
Skp1	Mouse	dicrotophos	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	dicrotophos results in decreased expression of SKP1 mRNA	CTD	PMID:28302478
Skp1	Mouse	dimethylarsinous acid	increases expression	ISO	SKP1 (Homo sapiens)	6480464	dimethylarsinous acid results in increased expression of SKP1 mRNA	CTD	PMID:20886546
Skp1	Mouse	disodium selenite	increases expression	ISO	SKP1 (Homo sapiens)	6480464	Sodium Selenite results in increased expression of SKP1 mRNA	CTD	PMID:18175754
Skp1	Mouse	endosulfan	affects expression	ISO	Skp1 (Rattus norvegicus)	6480464	Endosulfan affects the expression of SKP1 mRNA and Endosulfan affects the expression of SKP1 protein	CTD	PMID:31464424
Skp1	Mouse	ethanol	increases expression	EXP		6480464	Ethanol results in increased expression of SKP1 mRNA	CTD	PMID:30319688
Skp1	Mouse	ethanol	affects splicing	EXP		6480464	Ethanol affects the splicing of SKP1 mRNA	CTD	PMID:30319688
Skp1	Mouse	fipronil	increases expression	ISO	Skp1 (Rattus norvegicus)	6480464	fipronil results in increased expression of SKP1 mRNA	CTD	PMID:23962444
Skp1	Mouse	flutamide	increases expression	ISO	Skp1 (Rattus norvegicus)	6480464	Flutamide results in increased expression of SKP1 mRNA	CTD	PMID:24136188
Skp1	Mouse	folpet	increases expression	EXP		6480464	folpet results in increased expression of SKP1 mRNA	CTD	PMID:31558096
Skp1	Mouse	FR900359	increases phosphorylation	ISO	SKP1 (Homo sapiens)	6480464	FR900359 results in increased phosphorylation of SKP1 protein	CTD	PMID:37730182
Skp1	Mouse	fulvestrant	multiple interactions	ISO	SKP1 (Homo sapiens)	6480464	[bisphenol S co-treated with Fulvestrant] results in increased methylation of SKP1 gene	CTD	PMID:31601247
Skp1	Mouse	graphite	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	Graphite results in decreased expression of SKP1 protein	CTD	PMID:22157353
Skp1	Mouse	indometacin	multiple interactions	ISO	SKP1 (Homo sapiens)	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of SKP1 mRNA	CTD	PMID:28628672
Skp1	Mouse	inulin	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of SKP1 mRNA	CTD	PMID:36331819
Skp1	Mouse	ivermectin	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	Ivermectin results in decreased expression of SKP1 protein	CTD	PMID:32959892
Skp1	Mouse	methidathion	affects expression	EXP		6480464	methidathion affects the expression of SKP1 mRNA	CTD	PMID:34813904
Skp1	Mouse	methylisothiazolinone	increases expression	ISO	SKP1 (Homo sapiens)	6480464	2-methyl-4-isothiazolin-3-one results in increased expression of SKP1 mRNA	CTD	PMID:31629900
Skp1	Mouse	methylmercury chloride	increases expression	EXP		6480464	methylmercuric chloride results in increased expression of SKP1 mRNA	CTD	PMID:20061341
Skp1	Mouse	N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal	increases expression	EXP		6480464	benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of SKP1 mRNA	CTD	PMID:20061341
Skp1	Mouse	nefazodone	increases expression	ISO	Skp1 (Rattus norvegicus)	6480464	nefazodone results in increased expression of SKP1 mRNA	CTD	PMID:24136188
Skp1	Mouse	nimesulide	increases expression	ISO	Skp1 (Rattus norvegicus)	6480464	nimesulide results in increased expression of SKP1 mRNA	CTD	PMID:24136188
Skp1	Mouse	Nutlin-3	multiple interactions	ISO	SKP1 (Homo sapiens)	6480464	[Dactinomycin co-treated with nutlin 3] results in increased secretion of SKP1 protein	CTD	PMID:38460933
Skp1	Mouse	paracetamol	increases expression	ISO	SKP1 (Homo sapiens)	6480464	Acetaminophen results in increased expression of SKP1 mRNA	CTD	PMID:21420995
Skp1	Mouse	paracetamol	multiple interactions	EXP		6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of SKP1 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of SKP1 mRNA]	CTD	PMID:17585979
Skp1	Mouse	pentachlorophenol	increases expression	EXP		6480464	Pentachlorophenol results in increased expression of SKP1 mRNA	CTD	PMID:23892564
Skp1	Mouse	perfluorooctane-1-sulfonic acid	multiple interactions	EXP		6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of SKP1 mRNA more ...	CTD	PMID:36331819
Skp1	Mouse	pirinixic acid	increases expression	EXP		6480464	pirinixic acid results in increased expression of SKP1 mRNA	CTD	PMID:18301758 and PMID:23811191
Skp1	Mouse	piroxicam	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	Piroxicam results in decreased expression of SKP1 mRNA	CTD	PMID:21858171
Skp1	Mouse	sertraline	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	Sertraline results in decreased expression of SKP1 mRNA	CTD	PMID:24865413
Skp1	Mouse	sodium arsenite	increases expression	ISO	SKP1 (Homo sapiens)	6480464	sodium arsenite results in increased expression of SKP1 mRNA	CTD	PMID:28595984 and PMID:38568856
Skp1	Mouse	sodium arsenite	decreases expression	ISO	Skp1 (Rattus norvegicus)	6480464	sodium arsenite results in decreased expression of SKP1 protein	CTD	PMID:29459688
Skp1	Mouse	sodium arsenite	increases expression	ISO	Skp1 (Rattus norvegicus)	6480464	sodium arsenite results in increased expression of SKP1 mRNA	CTD	PMID:19072884
Skp1	Mouse	sodium fluoride	increases expression	EXP		6480464	Sodium Fluoride results in increased expression of SKP1 protein	CTD	PMID:28918527
Skp1	Mouse	T-2 toxin	affects expression	ISO	Skp1 (Rattus norvegicus)	6480464	T-2 Toxin affects the expression of SKP1 protein	CTD	PMID:26141394
Skp1	Mouse	thapsigargin	decreases expression	ISO	Skp1 (Rattus norvegicus)	6480464	Thapsigargin results in decreased expression of SKP1 protein	CTD	PMID:35544339
Skp1	Mouse	thiram	increases expression	ISO	SKP1 (Homo sapiens)	6480464	Thiram results in increased expression of SKP1 mRNA	CTD	PMID:38568856
Skp1	Mouse	titanium dioxide	increases methylation	EXP		6480464	titanium dioxide results in increased methylation of SKP1 gene	CTD	PMID:35295148
Skp1	Mouse	titanium dioxide	decreases methylation	EXP		6480464	titanium dioxide results in decreased methylation of SKP1 promoter	CTD	PMID:35295148
Skp1	Mouse	trichloroethene	decreases expression	ISO	Skp1 (Rattus norvegicus)	6480464	Trichloroethylene results in decreased expression of SKP1 mRNA	CTD	PMID:33387578
Skp1	Mouse	triphenyl phosphate	affects expression	ISO	SKP1 (Homo sapiens)	6480464	triphenyl phosphate affects the expression of SKP1 mRNA	CTD	PMID:37042841
Skp1	Mouse	triptonide	increases expression	EXP		6480464	triptonide results in increased expression of SKP1 mRNA	CTD	PMID:33045310
Skp1	Mouse	urethane	increases expression	ISO	SKP1 (Homo sapiens)	6480464	Urethane results in increased expression of SKP1 mRNA	CTD	PMID:28818685
Skp1	Mouse	valproic acid	increases methylation	ISO	SKP1 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of SKP1 gene	CTD	PMID:29154799
Skp1	Mouse	valproic acid	increases expression	ISO	SKP1 (Homo sapiens)	6480464	Valproic Acid results in increased expression of SKP1 mRNA	CTD	PMID:23179753
Skp1	Mouse	vitamin E	increases expression	ISO	SKP1 (Homo sapiens)	6480464	Vitamin E results in increased expression of SKP1 mRNA	CTD	PMID:19244175
Skp1	Mouse	zoledronic acid	decreases expression	ISO	SKP1 (Homo sapiens)	6480464	zoledronic acid results in decreased expression of SKP1 protein	CTD	PMID:28871336

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Skp1	Mouse	chromatin remodeling	involved_in	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	chromatin remodeling	involved_in	IEA	UniProtKB:P63208 and ensembl:ENSP00000231487	2290270		Ensembl	GO_REF:0000107
Skp1	Mouse	maintenance of protein location in nucleus	involved_in	IEA	UniProtKB:P63208 and ensembl:ENSP00000231487	2290270		Ensembl	GO_REF:0000107
Skp1	Mouse	maintenance of protein location in nucleus	involved_in	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	positive regulation of ubiquitin protein ligase activity	involved_in	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	proteasome-mediated ubiquitin-dependent protein catabolic process	involved_in	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	protein K48-linked ubiquitination	acts_upstream_of_or_within	IDA		2290270	PMID:29593216	MGI	PMID:29593216
Skp1	Mouse	protein K48-linked ubiquitination	involved_in	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	protein monoubiquitination	acts_upstream_of_or_within	IGI	MGI:1349658 more ...	2290270	PMID:21343341	MGI	PMID:21343341
Skp1	Mouse	protein polyubiquitination	involved_in	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	protein ubiquitination	involved_in	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	involved_in	IDA		2290270	PMID:12140560	UniProt	PMID:12140560
Skp1	Mouse	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	involved_in	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	involved_in	IBA	PANTHER:PTN000126179 more ...	2290270		GO_Central	GO_REF:0000033
Skp1	Mouse	ubiquitin-dependent protein catabolic process	acts_upstream_of_or_within	IC	GO:0019005	2290270	PMID:12665572	MGI	PMID:12665572

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Skp1	Mouse	centrosome	located_in	IDA		2290270	PMID:10485847	CACAO	PMID:10485847
Skp1	Mouse	Cul7-RING ubiquitin ligase complex	part_of	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	Cul7-RING ubiquitin ligase complex	part_of	IDA		2290270	PMID:21572988	UniProt	PMID:21572988
Skp1	Mouse	cytoplasm	is_active_in	IBA	PANTHER:PTN000126179 more ...	2290270		GO_Central	GO_REF:0000033
Skp1	Mouse	cytoplasm	located_in	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	cytosol	located_in	IDA		2290270	PMID:12140560	UniProt	PMID:12140560
Skp1	Mouse	gap junction		ISO	Skp1 (Rattus norvegicus)	9068941	MMO:0000538	RGD	PMID:12117534 and REF_RGD_ID:152177518
Skp1	Mouse	gap junction	located_in	ISO	Skp1 (Rattus norvegicus)	2290270		GO_Central	GO_REF:0000096
Skp1	Mouse	nucleus	located_in	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	nucleus	is_active_in	IBA	PANTHER:PTN000126179 more ...	2290270		GO_Central	GO_REF:0000033
Skp1	Mouse	PcG protein complex	part_of	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	PcG protein complex	part_of	IEA	UniProtKB:P63208 and ensembl:ENSP00000231487	2290270		Ensembl	GO_REF:0000107
Skp1	Mouse	SCF ubiquitin ligase complex	part_of	IDA		2290270	PMID:12140560 more ...	MGI	PMID:12140560 more ...
Skp1	Mouse	SCF ubiquitin ligase complex	part_of	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	SCF ubiquitin ligase complex	part_of	ISS	UniProtKB:P63208	2290270		UniProt	GO_REF:0000024

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Skp1	Mouse	beta-catenin binding	enables	IEA	UniProtKB:P63208 and ensembl:ENSP00000231487	2290270		Ensembl	GO_REF:0000107
Skp1	Mouse	beta-catenin binding	enables	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	cullin family protein binding	enables	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	cullin family protein binding	enables	IEA	UniProtKB:P63208 and ensembl:ENSP00000231487	2290270		Ensembl	GO_REF:0000107
Skp1	Mouse	cullin family protein binding	enables	IBA	PANTHER:PTN000126179 more ...	2290270		GO_Central	GO_REF:0000033
Skp1	Mouse	F-box domain binding	enables	IEA	UniProtKB:P63208 and ensembl:ENSP00000231487	2290270		Ensembl	GO_REF:0000107
Skp1	Mouse	F-box domain binding	enables	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	molecular function activator activity	enables	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	molecular function activator activity	enables	IEA	UniProtKB:P63208 and ensembl:ENSP00000231487	2290270		Ensembl	GO_REF:0000107
Skp1	Mouse	protein binding	enables	IPI	UniProtKB:P62137	2290270	PMID:17274640	IntAct	PMID:17274640
Skp1	Mouse	protein binding	enables	IPI	PR:Q8BIA4 and PR:Q9WTX6	2290270	PMID:16880526	MGI	PMID:16880526
Skp1	Mouse	protein binding	enables	IPI	UniProtKB:Q9UKT7	2290270	PMID:17463251 and PMID:23503662	IntAct	PMID:17463251 and PMID:23503662
Skp1	Mouse	protein binding	enables	IPI	PR:Q60584 more ...	2290270	PMID:19398581	MGI	PMID:19398581
Skp1	Mouse	protein binding	enables	IPI	UniProtKB:Q5SRY7	2290270	PMID:11896578	UniProt	PMID:11896578
Skp1	Mouse	protein binding	enables	IPI	UniProtKB:Q9D2Y6	2290270	PMID:16714087	UniProt	PMID:16714087
Skp1	Mouse	protein binding	enables	IPI	UniProtKB:Q9QXW2	2290270	PMID:23314863	IntAct	PMID:23314863
Skp1	Mouse	protein binding	enables	IPI	UniProtKB:Q9CQJ4	2290270	PMID:17296600	IntAct	PMID:17296600
Skp1	Mouse	protein domain specific binding	enables	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	ubiquitin ligase complex scaffold activity	enables	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	ubiquitin ligase complex scaffold activity	enables	IEA	UniProtKB:P63208 and ensembl:ENSP00000231487	2290270		Ensembl	GO_REF:0000107
Skp1	Mouse	ubiquitin-like ligase-substrate adaptor activity	enables	IEA	UniProtKB:P63208 and ensembl:ENSP00000231487	2290270		Ensembl	GO_REF:0000107
Skp1	Mouse	ubiquitin-like ligase-substrate adaptor activity	enables	ISO	UniProtKB:P63208	2290270		GO_Central	GO_REF:0000119
Skp1	Mouse	ubiquitin-protein transferase activity	contributes_to	IC	GO:0019005	2290270	PMID:12665572	MGI	PMID:12665572

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Skp1	Mouse	nuclear factor kappa B signaling pathway		ISO	SKP1 (Homo sapiens)	5490225		RGD
Skp1	Mouse	nuclear factor, erythroid 2 like 2 signaling pathway		ISO	SKP1 (Homo sapiens)	11535066		RGD

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Skp1	Mouse	cell cycle pathway, mitotic		IEA		6907045		KEGG	mmu:04110
Skp1	Mouse	Endoplasmic Reticulum-associated degradation pathway		IEA		6907045		KEGG	mmu:04141
Skp1	Mouse	transforming growth factor-beta superfamily mediated signaling pathway		IEA		6907045		KEGG	mmu:04350
Skp1	Mouse	ubiquitin/proteasome degradation pathway		IEA		6907045		KEGG	mmu:04120
Skp1	Mouse	Wnt signaling pathway		IEA		6907045		KEGG	mmu:04310

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Skp1	Mouse	Notch signaling pathway		ISO	SKP1 (Homo sapiens)	6484113		PID	PID:200015

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Skp1	Mouse	abnormal chromosomal synapsis		IAGP		5509061		MGI	PMID:32232159
Skp1	Mouse	abnormal double-strand DNA break repair		IAGP		5509061		MGI	PMID:32232159
Skp1	Mouse	abnormal female meiosis		IAGP		5509061		MGI	PMID:32232159
Skp1	Mouse	abnormal spermatogenesis		IAGP		5509061		MGI	PMID:32232159
Skp1	Mouse	absent germ cells		IAGP		5509061		MGI	PMID:32232159
Skp1	Mouse	arrest of male meiosis		IAGP		5509061		MGI	PMID:32232159
Skp1	Mouse	azoospermia		IAGP		5509061		MGI	PMID:32232159
Skp1	Mouse	decreased testis weight		IAGP		5509061		MGI	PMID:32232159
Skp1	Mouse	female infertility		IAGP		5509061		MGI	PMID:32232159
Skp1	Mouse	maternal effect		IAGP		5509061		MGI	PMID:32232159
Skp1	Mouse	oocyte degeneration		IAGP		5509061		MGI	PMID:32232159

#	Reference Title	Reference Citation
1.	Mouse brain organization revealed through direct genome-scale TF expression analysis.	Gray PA, etal., Science 2004 Dec 24;306(5705):2255-7.
2.	The Nrf2 regulatory network provides an interface between redox and intermediary metabolism.	Hayes JD and Dinkova-Kostova AT, Trends Biochem Sci. 2014 Apr;39(4):199-218. doi: 10.1016/j.tibs.2014.02.002. Epub 2014 Mar 16.
3.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
4.	Expanding role of ubiquitination in NF-kappaB signaling.	Liu S and Chen ZJ, Cell Res. 2011 Jan;21(1):6-21. Epub 2010 Dec 7.
5.	MGDs mouse GO annotations	MGD data from the GO Consortium
6.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	A novel cDNA with homology to an RNA polymerase II elongation factor maps to human chromosome 5q31 (TCEB1L) and to mouse chromosome 11 (Tceb1l).	Sowden J, etal., Genomics 1995 Sep 1;29(1):145-51.

PMID:1707031	PMID:8912791	PMID:9021147	PMID:10097128	PMID:10349636	PMID:10485847	PMID:10531037	PMID:10585767	PMID:11042159	PMID:11076861	PMID:11337588	PMID:11735228
PMID:11896578	PMID:12140560	PMID:12417738	PMID:12477932	PMID:12520002	PMID:12665572	PMID:12805289	PMID:12904583	PMID:14610273	PMID:14701835	PMID:15306695	PMID:15489334
PMID:15531760	PMID:15996101	PMID:16141072	PMID:16141073	PMID:16714087	PMID:16880526	PMID:17081987	PMID:17215248	PMID:17242400	PMID:17274640	PMID:17290223	PMID:17296600
PMID:17463251	PMID:17494702	PMID:17803915	PMID:18287559	PMID:18799693	PMID:18929646	PMID:19398581	PMID:19748892	PMID:20412781	PMID:21267068	PMID:21343341	PMID:21368834
PMID:21572988	PMID:21873635	PMID:22033112	PMID:22166427	PMID:22205987	PMID:22306998	PMID:22354994	PMID:22405651	PMID:22673621	PMID:22988430	PMID:23314863	PMID:23375831
PMID:23452856	PMID:23503662	PMID:23868976	PMID:23955342	PMID:24085301	PMID:24390425	PMID:24457600	PMID:25670854	PMID:26206133	PMID:26496610	PMID:27063938	PMID:27113764
PMID:27732853	PMID:28378742	PMID:28671696	PMID:29111324	PMID:29472293	PMID:29593216	PMID:30186101	PMID:30418981	PMID:31040226	PMID:31162944	PMID:31167929	PMID:32098917
PMID:32232159	PMID:32325033	PMID:32434143	PMID:32554809	PMID:32937135	PMID:34321999	PMID:35310947	PMID:35489071	PMID:36114006	PMID:36288084	PMID:36417873	PMID:36592647

Skp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	52,121,349 - 52,137,685 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	52,122,822 - 52,137,685 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	52,230,522 - 52,246,858 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	52,231,995 - 52,246,858 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	52,045,497 - 52,060,360 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	52,075,432 - 52,090,281 (+)	NCBI		MGSCv36	mm8
Celera	11	56,801,165 - 56,816,028 (+)	NCBI		Celera
Cytogenetic Map	11	B1.3	NCBI
cM Map	11	31.86	NCBI

SKP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	134,148,935 - 134,176,950 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	134,148,935 - 134,176,964 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	133,484,626 - 133,512,641 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	133,520,468 - 133,540,583 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	133,520,467 - 133,540,583	NCBI
Celera	5	129,615,775 - 129,636,409 (-)	NCBI		Celera
Cytogenetic Map	5	q31.1	NCBI
HuRef	5	128,677,052 - 128,697,683 (-)	NCBI		HuRef
CHM1_1	5	132,924,656 - 132,945,272 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	134,672,565 - 134,700,570 (-)	NCBI		T2T-CHM13v2.0

Skp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	36,898,670 - 36,917,828 (+)	NCBI		GRCr8
mRatBN7.2	10	36,401,987 - 36,417,066 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	36,402,153 - 36,417,388 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	41,096,029 - 41,110,942 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	40,585,994 - 40,600,907 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	36,089,722 - 36,104,635 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	37,594,578 - 37,609,498 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	37,594,578 - 37,609,498 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	37,368,051 - 37,383,130 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	37,665,417 - 37,680,338 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	37,671,846 - 37,686,768 (+)	NCBI
Celera	10	35,756,586 - 35,771,498 (+)	NCBI		Celera
Cytogenetic Map	10	q22	NCBI

Skp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	5,392,839 - 5,412,644 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	5,393,851 - 5,412,644 (-)	NCBI	ChiLan1.0	ChiLan1.0

SKP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	129,455,839 - 129,478,297 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	127,595,401 - 127,617,859 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	129,560,086 - 129,580,188 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	5	135,713,085 - 135,732,665 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	135,713,085 - 135,729,653 (-)	Ensembl	panpan1.1		panPan2

SKP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	22,352,735 - 22,366,599 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	22,352,439 - 22,364,024 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	21,098,642 - 21,112,489 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	23,152,831 - 23,168,252 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	23,152,162 - 23,164,892 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	21,853,772 - 21,867,627 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	21,718,806 - 21,732,658 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	22,361,395 - 22,375,242 (-)	NCBI		UU_Cfam_GSD_1.0

Skp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	114,070,872 - 114,088,084 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936647	1,072,855 - 1,094,139 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936647	1,073,647 - 1,090,841 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SKP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	136,458,949 - 136,476,005 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	136,458,772 - 136,476,364 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

SKP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	36,961,572 - 36,978,849 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	36,962,328 - 36,978,757 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	40,956,691 - 40,974,891 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Skp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624733	38,051,280 - 38,069,648 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Skp1
445 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	965
Count of miRNA genes:	428
Interacting mature miRNAs:	509
Transcripts:	ENSMUST00000037324, ENSMUST00000093121, ENSMUST00000109072, ENSMUST00000116595, ENSMUST00000147684, ENSMUST00000166537
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357844	Si5lq5_m	serum IGFBP-5 level QTL 5 (mouse)			Not determined		11	28165873	62165976	Mouse
4141367	Inf1_m	acute ozone induced inflammation (mouse)			Not determined			44630038	113058009	Mouse
1357720	Kidpq1_m	kidney weight percentage QTL 1 (mouse)			Not determined		11	12268637	68500330	Mouse
1300765	Bbaa4_m	B.burgdorferi-associated arthritis 4 (mouse)			Not determined		11	46185167	80185262	Mouse
1357851	Scfq3_m	subcutaneous fat pad weight QTL 3 (mouse)			Not determined		11	12268637	68500330	Mouse
1301788	Lbw8_m	lupus NZB x NZW 8 (mouse)			Not determined		11	36503287	70509492	Mouse
27226762	Feml21_m	femur length 21, 16 week (mouse)					11	11750000	65990826	Mouse
1302021	Nidd1n_m	non-insulin-dependent diabetes mellitus 1 in NSY (mouse)			Not determined		11	45165873	79978324	Mouse
1301896	Tria1_m	T-cell receptor induced activation 1 (mouse)			Not determined		11	36613565	70613855	Mouse
4141470	Egq4_m	early growth QTL 4 (mouse)			Not determined			12268637	68500330	Mouse
1301426	Desp2_m	despair 2 (mouse)			Not determined		11	28708581	62708700	Mouse
4142109	W10q2_m	weight 10 weeks QTL 2 (mouse)			Not determined			12268637	68500330	Mouse
4141853	Skmw17_m	skeletal muscle weight 17 (mouse)			Not determined		11	37080941	71081064	Mouse
1357878	Mastr_m	modifier of astrocytoma (mouse)			Not determined		11	45708581	89818733	Mouse
13208559	Wght10_m	weight 10 (mouse)					11	3950000	88890826	Mouse
13208558	Lgth12_m	body length 12 (mouse)					11	3950000	94890826	Mouse
26884401	Huml4_m	humerus length 4, 10 week (mouse)					11	11550000	68490826	Mouse
10053687	Eae6_m	susceptibility to experimental allergic encephalomyelitis 6 (mouse)			Not determined		11	17781966	68500330	Mouse
13208569	Bmiq10_m	body mass index QTL 10 (mouse)					11	35890827	84890826	Mouse
27226798	Scvln18_m	sacral vertebrae length 2, 16 week (mouse)					11	3250000	60690826	Mouse
4141582	Lgaq1_m	late growth adjusted QTL 1 (mouse)			Not determined			12268637	68500330	Mouse
4141966	Tailq1_m	tail length QTL 1 (mouse)			Not determined			12268637	68500330	Mouse
10053675	Eae44b_m	experimental allergic encephalomyelitis susceptibility 44b (mouse)			Not determined		11	39950728	54094448	Mouse
4142475	Ity2a_m	immunity to S. typhimurium 2a (mouse)			Not determined		11	37768580	60402716	Mouse
11532699	Sluc36b_m	susceptibility to lung cancer 36b (mouse)					11	42256617	76256730	Mouse
11532698	Sluc36a_m	susceptibility to lung cancer 36a (mouse)					11	42256617	76256730	Mouse
1558945	Orgwq8_m	organ weight QTL 8 (mouse)			Not determined		11	17056175	67078411	Mouse
4142216	Lgq1_m	late growth QTL 1 (mouse)			Not determined			12268637	68500330	Mouse
1300905	Scc6_m	colon tumor susceptibility 6 (mouse)			Not determined		11	6880277	89019734	Mouse
14746971	Manh70_m	mandible shape 70 (mouse)					11	19905890	53905890	Mouse
13524848	Ppiq7_m	prepulse inhibition QTL 7 (mouse)					11	28569147	62569147	Mouse
1357782	Char8_m	P. chabaudi malaria resistance QTL 8 (mouse)			Not determined		11	35578616	69684987	Mouse
39128214	Lwq20_m	liver weight QTL 20 (mouse)					11	12268637	118022724	Mouse
11059563	Lmr31_m	leishmaniasis resistance 31 (mouse)					11	32100577	66100694	Mouse
1301328	Mol4_m	modifier of LPS-response 4 (mouse)			Not determined		11	36282577	83481356	Mouse
26884446	Sklq10_m	skull length QTL 10, 10 week (mouse)					11	3250000	62890826	Mouse
10412246	Dfs2_m	dental fluorosis suseptibility 2 (mouse)			Not determined		11	21807364	95881231	Mouse
1559002	Lmrq4_m	Leishmania major resistance QTL 4 (mouse)			Not determined		11	12268637	69684947	Mouse
1301830	Ssta4_m	susceptibility to Salmonella typhimurium antigens 4 (mouse)			Not determined		11	50078191	84078411	Mouse
1300938	Bulb3_m	bulb size 3 (mouse)			Not determined		11	18578616	52578716	Mouse
4142308	W6q3_m	weight 6 weeks QTL 3 (mouse)			Not determined		11	12268637	68500330	Mouse
1357640	Orq2_m	ovulation rate QTL 2 (mouse)			Not determined		11	12268637	68500330	Mouse
10766457	Nwa3_m	New Zealand White autoimmunity 3 (mouse)					11	38016115	72016209	Mouse
4142300	Ctrq3_m	C. trachomatis resistance QTL 3 (mouse)			Not determined		11	44630038	76854757	Mouse
1357437	Epfq4_m	epididymal fat pad weight QTL 4 (mouse)			Not determined		11	12268637	68500330	Mouse
4141398	Tgq22_m	triglyceride QTL 22 (mouse)			Not determined			21163406	55163406	Mouse
27226738	Metcl11_m	metatarsal-calcaneal length 11, 10 week (mouse)					11	8850000	61390826	Mouse
11522752	Cocia18_m	cocaine-induced activity, QTL 18 (mouse)					11	31008209	65008209	Mouse
12801459	Leuf1_m	leukocyte filtration 1 (mouse)					11	18578616	52578716	Mouse
1300579	Thypr1_m	thymocyte proliferative response 1 (mouse)			Not determined		11	19282577	53282715	Mouse
12801457	Intmrm2_m	intima/media ratio modifier 2 (mouse)					11	18578616	52578716	Mouse
4141770	Tcpm1_m	T-cell phenotype modifier 1 (mouse)			Not determined			51452479	53615930	Mouse
12801460	Intim2_m	intima modifier 2 (mouse)					11	18578616	52578716	Mouse
1301988	Bmd11_m	bone mineral density 11 (mouse)			Not determined		11	46319407	80319522	Mouse
4141127	W3q4_m	weight 3 weeks QTL 4 (mouse)			Not determined			12268637	68500330	Mouse
4141894	Nidd6k_m	Nidd6 on KK-A (mouse)			Not determined			19124204	96897826	Mouse
1300713	Vmbic10_m	ventral midbrain iron content 10 (mouse)			Not determined		11	42772626	54081064	Mouse
26884453	Sklq16_m	skull length QTL 16, 16 week (mouse)					11	3250000	72690826	Mouse
10044006	Hbnr13_m	Heligmosomoides bakeri nematode resistance 13 (mouse)			Not determined		11	25772626	59772741	Mouse

D11Pjn4

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	52,236,615 - 52,236,770	UniSTS	GRCm38
MGSCv37	11	52,050,117 - 52,050,272	UniSTS	GRCm37
Celera	11	56,805,785 - 56,805,940	UniSTS
Cytogenetic Map	11	B1.3	UniSTS
cM Map	11	28.02	UniSTS

RH137096

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	11	52,246,397 - 52,246,615	UniSTS	GRCm38
MGSCv37	11	52,059,899 - 52,060,117	UniSTS	GRCm37
Celera	11	56,815,567 - 56,815,785	UniSTS
Cytogenetic Map	11	B1.3	UniSTS

Skp1a

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	11	B1.3	UniSTS

Tceb1l

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	11	B1.3	UniSTS
cM Map	11	31.0	UniSTS

Tceb1l-rs1

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	4	135,755,980 - 135,756,192	UniSTS	GRCm38
GRCm38	11	52,246,046 - 52,246,255	UniSTS	GRCm38
MGSCv37	11	52,059,548 - 52,059,757	UniSTS	GRCm37
MGSCv37	4	135,311,895 - 135,312,107	UniSTS	GRCm37
Celera	11	56,815,216 - 56,815,425	UniSTS
Celera	4	133,950,068 - 133,950,280	UniSTS
Cytogenetic Map	4	D3	UniSTS
Cytogenetic Map	11	B1.3	UniSTS
cM Map	4	65.5	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.


RefSeq Transcripts	NM_011543	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006532786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_036156505	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF083214	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK002983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK010628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK012498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK014245	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK027909	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK078330	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK088339	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK152609	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK158209	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK160198	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK166673	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL645862	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC002115	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BU841654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466575	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Z47088	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000037324 ⟹ ENSMUSP00000038744

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	52,122,836 - 52,137,685 (+)	Ensembl
GRCm38.p6 Ensembl	11	52,232,009 - 52,246,858 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000093121

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	52,122,864 - 52,129,251 (+)	Ensembl
GRCm38.p6 Ensembl	11	52,232,037 - 52,238,424 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000109072 ⟹ ENSMUSP00000104700

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	52,123,016 - 52,137,685 (+)	Ensembl
GRCm38.p6 Ensembl	11	52,232,189 - 52,246,858 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000116595 ⟹ ENSMUSP00000112294

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	52,127,691 - 52,136,879 (+)	Ensembl
GRCm38.p6 Ensembl	11	52,236,864 - 52,246,052 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000147684 ⟹ ENSMUSP00000129711

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	52,122,822 - 52,135,921 (+)	Ensembl
GRCm38.p6 Ensembl	11	52,231,995 - 52,245,094 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000166537 ⟹ ENSMUSP00000131833

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	11	52,122,864 - 52,135,924 (+)	Ensembl
GRCm38.p6 Ensembl	11	52,232,037 - 52,245,097 (+)	Ensembl

RefSeq Acc Id:

NM_011543 ⟹ NP_035673

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	11	52,122,822 - 52,137,685 (+)	NCBI
GRCm38	11	52,231,995 - 52,246,858 (+)	NCBI
MGSCv37	11	52,045,497 - 52,060,360 (+)	RGD
Celera	11	56,801,165 - 56,816,028 (+)	RGD
cM Map	11		ENTREZGENE

Sequence:

show sequence

GCGTCCCGCTGCTATAAAAGGCGACGCCGCGCGGCGCCGCTCGAGTGGCCTTGTTCTCGATACTTCGTTGTGGTTGTGAACTCTGTCCGGCAGCCTCGGGCCTGCGGTCTTGAGACGGAGCACCATGC
CTACGATAAAGTTGCAGAGTTCTGATGGAGAGATATTTGAAGTTGATGTAGAAATTGCCAAACAATCTGTGACTATCAAGACCATGCTGGAAGATTTGGGAATGGATGATGAAGGAGATGATGATCCT
GTTCCTTTACCAAATGTTAATGCAGCAATTCTAAAGAAGGTCATTCAGTGGTGCACCCACCACAAAGATGACCCTCCTCCTCCTGAGGATGATGAAAACAAAGAAAAGCGGACAGATGATATTCCTGT
TTGGGACCAAGAATTCCTGAAAGTTGACCAAGGAACACTTTTTGAACTTATTCTGGCTGCAAACTACTTAGACATCAAAGGTTTGCTTGATGTCACATGCAAGACTGTGGCCAATATGATTAAGGGGA
AAACTCCTGAGGAGATTCGTAAAACCTTCAATATCAAAAATGACTTTACTGAAGAGGAAGAGGCCCAGGTACGCAAAGAGAACCAATGGTGTGAAGAGAAGTGAACTGCTGTGCCTGTCACTGTAACA
CTAGAAGGGTTGTTCCAAATGCTAGTTGCACTGCTCTGTTTATAATTGTTAATATTAGAGATCAGTAGACAAACATCGCCTTGTCTTCACTGCATGTGTAGTTCCAGTCCAGATCAGACCTGTGGCTG
AGTTTCTTCTGTGAGCAGAAGTTTCCTTTTCCCCCCATTACTCTGAATAAAACCGAACTATGGGTTCTCTGCGGAAAGTGGCATTTTGGGCTTTCCCTTTCTGTAAAGTGATTTCTGCCTCTAGTTCA
TTGTCCAGTTAACTTCAGTGAGCCTTTCAAAGTTGACATTGTAAATAAAACAACTTAAGAAAAGTATGCTGAAATAGAATTAACAAAACATGATACTTGTTCATGAATCGGAAACTGGAATAGGGCAG
CTTGAAGTTAACCATGTGGGTGTCTTCCAACCTCTATGCTGCTGGTAAGCTTGAGTGCAGCTGGGCTCTCTTAATTGGATCTGAGGCCTTGTTTTTTCTTTTTTTTTTTCTTTTTTTTTTTTTTAATC
TTCTCAGCTTTGAATATGTTGCCTAGAGATTTAGTTTACTACCCAGTTTGTGGTTTTGGAGTGGGAACTGTAACTCAACAATTTGTTAGCTTTTCAATTAAAAAAGACACTTACTTCATGTGGTATGT
CATCTTTTTATCATCATTGTTCCCAGGTGGAGAAACACTACTTGCATGTAAAAATTAATTTAACCTTTTAACATTAAAGTGTATGGTAAAACTCAGAAAACAGCCATCCTAAGTGCAAGATGCTTTTC
AATAAAAAGTAGTACAATAGGTAGTAAACAGTTGCTTTTGTGGATG

hide sequence

RefSeq Acc Id:

XM_006532786 ⟹ XP_006532849

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	11	52,121,349 - 52,137,667 (+)	NCBI
GRCm38	11	52,230,522 - 52,246,840 (+)	NCBI

Sequence:

show sequence

CTGTCATCGACTCTGGCACCTGGCAGACATTGGATACCAGCAGACAAAGACCTGGCTTTTCCAG
GACTGGGGTCTTTCAAGCCGTTTAAGACAGCCCATGCCTGAAAGACCCTTCGGGTCGAGATGGTTTCCCAGCCGGTGCCGGAGTCCGCTTTGAAGGAGAGCATGGCGCTGTTTAGGCCAGCGGAGTAA
GGAGGACGTCCCTCTCTTGCCCAGCCACCCCTCCACCCGCCGCCGCTCAGCACCTCTCCAGGAGACCTCTGCGGCGCTCAGGGTCTGCCGCCTGTGTTTCGACTGCCGTCAGGCGATCTCAACGGCCA
GCCCGGCCGGCTGTGTGACGTCACGGGCTCGGGGTCCTCGGCGCCTGCGTCCCGCTGCTATAAAAGGCGACGCCGCGCGGCGCCGCTCGAGTGGCCTTGTTCTCGATACTTCGTTGTGGTTGTGAACT
CTGTCCGGCAGCCTCGGGCCTGCGGTCTTGAGACGGAGCACCATGCCTACGATAAAGTTGCAGAGTTCTGATGGAGAGATATTTGAAGTTGATGTAGAAATTGCCAAACAATCTGTGACTATCAAGAC
CATGCTGGAAGATTTGGGAATGGATGATGAAGGAGATGATGATCCTGTTCCTTTACCAAATGTTAATGCAGCAATTCTAAAGAAGGTCATTCAGTGGTGCACCCACCACAAAGATGACCCTCCTCCTC
CTGAGGATGATGAAAACAAAGAAAAGCGGACAGATGATATTCCTGTTTGGGACCAAGAATTCCTGAAAGTTGACCAAGGAACACTTTTTGAACTTATTCTGGCTGCAAACTACTTAGACATCAAAGGT
TTGCTTGATGTCACATGCAAGACTGTGGCCAATATGATTAAGGGGAAAACTCCTGAGGAGATTCGTAAAACCTTCAATATCAAAAATGACTTTACTGAAGAGGAAGAGGCCCAGGTACGCAAAGAGAA
CCAATGGTGTGAAGAGAAGTGAACTGCTGTGCCTGTCACTGTAACACTAGAAGGGTTGTTCCAAATGCTAGTTGCACTGCTCTGTTTATAATTGTTAATATTAGAGATCAGTAGACAAACATCGCCTT
GTCTTCACTGCATGTGTAGTTCCAGTCCAGATCAGACCTGTGGCTGAGTTTCTTCTGTGAGCAGAAGTTTCCTTTTCCCCCCATTACTCTGAATAAAACCGAACTATGGGTTCTCTGCGGAAAGTGGC
ATTTTGGGCTTTCCCTTTCTGTAAAGTGATTTCTGCCTCTAGTTCATTGTCCAGTTAACTTCAGTGAGCCTTTCAAAGTTGACATTGTAAATAAAACAACTTAAGAAAAGTATGCTGAAATAGAATTA
ACAAAACATGATACTTGTTCATGAATCGGAAACTGGAATAGGGCAGCTTGAAGTTAACCATGTGGGTGTCTTCCAACCTCTATGCTGCTGGTAAGCTTGAGTGCAGCTGGGCTCTCTTAATTGGATCT
GAGGCCTTGTTTTTTCTTTTTTTTTTTCTTTTTTTTTTTTTTAATCTTCTCAGCTTTGAATATGTTGCCTAGAGATTTAGTTTACTACCCAGTTTGTGGTTTTGGAGTGGGAACTGTAACTCAACAAT
TTGTTAGCTTTTCAATTAAAAAAGACACTTACTTCATGTGGTATGTCATCTTTTTATCATCATTGTTCCCAGGTGGAGAAACACTACTTGCATGTAAAAATTAATTTAACCTTTTAACATTAAAGTGT
ATGGTAAAACTCAGAAAACAGCCATCCTAAGTGCAAGATGCTTTTCAATAAAAAGTAGTACAATAGGTAGTAAA

hide sequence

RefSeq Acc Id:

XM_036156505 ⟹ XP_036012398

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	11	52,122,581 - 52,137,667 (+)	NCBI

Sequence:

show sequence

GGTTTCCCAGCCGGTGCCGGAGTCCGCTTTGAAGGAGAGCATGGCGCTGTTTAGGCCAGCGGAGTAAGGAGGACGTCCCTCTCTTGCCCAGCCACCCCTCCACCCGCCGCCGCTCAGCACCTCTCCAG
GAGACCTCTGCGGCGCTCAGGGTCTGCCGCCTGTGTTTCGACTGCCGTCAGGCGATCTCAACGGCCAGCCCGGCCGGCTGTGTGACGTCACGGGCTCGGGGTCCTCGGCGCCTGCGTCCCGCTGCTAT
AAAAGGCGACGCCGCGCGGCGCCGCTCGAGTGGCCTTGTTCTCGATACTTCGTTGTGGTTGTGAACTCTGTCCGGCAGCCTCGGGCCTGCGGTCTTGAGACGGAGCACCATTTGGGAATGGATGATGA
AGGAGATGATGATCCTGTTCCTTTACCAAATGTTAATGCAGCAATTCTAAAGAAGGTCATTCAGTGGTGCACCCACCACAAAGATGACCCTCCTCCTCCTGAGGATGATGAAAACAAAGAAAAGCGGA
CAGATGATATTCCTGTTTGGGACCAAGAATTCCTGAAAGTTGACCAAGGAACACTTTTTGAACTTATTCTGGCTGCAAACTACTTAGACATCAAAGGTTTGCTTGATGTCACATGCAAGACTGTGGCC
AATATGATTAAGGGGAAAACTCCTGAGGAGATTCGTAAAACCTTCAATATCAAAAATGACTTTACTGAAGAGGAAGAGGCCCAGGTACGCAAAGAGAACCAATGGTGTGAAGAGAAGTGAACTGCTGT
GCCTGTCACTGTAACACTAGAAGGGTTGTTCCAAATGCTAGTTGCACTGCTCTGTTTATAATTGTTAATATTAGAGATCAGTAGACAAACATCGCCTTGTCTTCACTGCATGTGTAGTTCCAGTCCAG
ATCAGACCTGTGGCTGAGTTTCTTCTGTGAGCAGAAGTTTCCTTTTCCCCCCATTACTCTGAATAAAACCGAACTATGGGTTCTCTGCGGAAAGTGGCATTTTGGGCTTTCCCTTTCTGTAAAGTGAT
TTCTGCCTCTAGTTCATTGTCCAGTTAACTTCAGTGAGCCTTTCAAAGTTGACATTGTAAATAAAACAACTTAAGAAAAGTATGCTGAAATAGAATTAACAAAACATGATACTTGTTCATGAATCGGA
AACTGGAATAGGGCAGCTTGAAGTTAACCATGTGGGTGTCTTCCAACCTCTATGCTGCTGGTAAGCTTGAGTGCAGCTGGGCTCTCTTAATTGGATCTGAGGCCTTGTTTTTTCTTTTTTTTTTTCTT
TTTTTTTTTTTTAATCTTCTCAGCTTTGAATATGTTGCCTAGAGATTTAGTTTACTACCCAGTTTGTGGTTTTGGAGTGGGAACTGTAACTCAACAATTTGTTAGCTTTTCAATTAAAAAAGACACTT
ACTTCATGTGGTATGTCATCTTTTTATCATCATTGTTCCCAGGTGGAGAAACACTACTTGCATGTAAAAATTAATTTAACCTTTTAACATTAAAGTGTATGGTAAAACTCAGAAAACAGCCATCCTAA
GTGCAAGATGCTTTTCAATAAAAAGTAGTACAATAGGTAGTAAA

hide sequence


Protein RefSeqs	NP_035673	(Get FASTA)	NCBI Sequence Viewer
	XP_006532849	(Get FASTA)	NCBI Sequence Viewer
	XP_036012398	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD16036	(Get FASTA)	NCBI Sequence Viewer
	AAH02115	(Get FASTA)	NCBI Sequence Viewer
	BAB22496	(Get FASTA)	NCBI Sequence Viewer
	BAB27074	(Get FASTA)	NCBI Sequence Viewer
	BAB28281	(Get FASTA)	NCBI Sequence Viewer
	BAB29222	(Get FASTA)	NCBI Sequence Viewer
	BAC25660	(Get FASTA)	NCBI Sequence Viewer
	BAC37220	(Get FASTA)	NCBI Sequence Viewer
	BAC40292	(Get FASTA)	NCBI Sequence Viewer
	BAE31355	(Get FASTA)	NCBI Sequence Viewer
	BAE35688	(Get FASTA)	NCBI Sequence Viewer
	BAE38934	(Get FASTA)	NCBI Sequence Viewer
	EDL33618	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000038744
	ENSMUSP00000038744.6
	ENSMUSP00000104700.2
GenBank Protein	Q9WTX5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_035673 ⟸ NM_011543
- UniProtKB:	Q8C5H6 (UniProtKB/Swiss-Prot), Q9WTX5 (UniProtKB/Swiss-Prot), Q5SUR3 (UniProtKB/TrEMBL), Q3TL58 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIK GKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK hide sequence

RefSeq Acc Id:	XP_006532849 ⟸ XM_006532786
- Peptide Label:	isoform X1
- UniProtKB:	Q8C5H6 (UniProtKB/Swiss-Prot), Q9WTX5 (UniProtKB/Swiss-Prot), Q5SUR3 (UniProtKB/TrEMBL), Q3TL58 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPTIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTH HKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK hide sequence

Ensembl Acc Id:

ENSMUSP00000129711 ⟸ ENSMUST00000147684

Ensembl Acc Id:

ENSMUSP00000131833 ⟸ ENSMUST00000166537

Ensembl Acc Id:

ENSMUSP00000038744 ⟸ ENSMUST00000037324

Protein Domains

SKP1 component dimerisation SKP1 component POZ

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9WTX5-F1-model_v2	AlphaFold	Q9WTX5	1-163	view protein structure

RGD ID:

6848602

Promoter ID:

MM_TRO:1485

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

ES_Cell, Kidney, Liver

Transcripts:

MTR000534.11.887.0

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	11	52,037,669 - 52,038,169 (+)	MPROMDB

RGD ID:

6822100

Promoter ID:

MM_KWN:7339

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen

Transcripts:

ENSMUST00000109072, NM_011543, OTTMUST00000012514, OTTMUST00000012515

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	11	52,045,111 - 52,045,611 (+)	MPROMDB

RGD ID:

8674578

Promoter ID:

EPDNEW_M15319

Type:

initiation region

Name:

Skp1a_1

Description:

Mus musculus S-phase kinase-associated protein 1A , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_M15320

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	11	52,232,037 - 52,232,097	EPDNEW

RGD ID:

8674580

Promoter ID:

EPDNEW_M15320

Type:

initiation region

Name:

Skp1a_2

Description:

Mus musculus S-phase kinase-associated protein 1A , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_M15319

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	11	52,232,249 - 52,232,309	EPDNEW

Database	Acc Id	Source(s)
Ensembl Genes	ENSMUSG00000036309	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000037324	ENTREZGENE
	ENSMUST00000037324.12	UniProtKB/Swiss-Prot
	ENSMUST00000109072.2	UniProtKB/Swiss-Prot
Gene3D-CATH	Potassium Channel Kv1.1, Chain A	UniProtKB/Swiss-Prot
InterPro	SKP1	UniProtKB/Swiss-Prot
	SKP1-like	UniProtKB/Swiss-Prot
	SKP1-like_dim_sf	UniProtKB/Swiss-Prot
	SKP1/BTB/POZ_sf	UniProtKB/Swiss-Prot
	Skp1_comp_dimer	UniProtKB/Swiss-Prot
	Skp1_comp_POZ	UniProtKB/Swiss-Prot
KEGG Report	mmu:21402	UniProtKB/Swiss-Prot
MGD	MGI:103575	ENTREZGENE
NCBI Gene	21402	ENTREZGENE
PANTHER	PTHR11165	UniProtKB/Swiss-Prot
Pfam	Skp1	UniProtKB/Swiss-Prot
	Skp1_POZ	UniProtKB/Swiss-Prot
PhenoGen	Skp1	PhenoGen
PIRSF	E3_ubiquit_lig_SCF_Skp	UniProtKB/Swiss-Prot
SMART	Skp1	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF54695	UniProtKB/Swiss-Prot
	SSF81382	UniProtKB/Swiss-Prot
UniProt	E9PUV4_MOUSE	UniProtKB/TrEMBL
	E9Q3Q7_MOUSE	UniProtKB/TrEMBL
	F6TGP8_MOUSE	UniProtKB/TrEMBL
	Q3TL58	ENTREZGENE, UniProtKB/TrEMBL
	Q5SUR3	ENTREZGENE, UniProtKB/TrEMBL
	Q8C5H6	ENTREZGENE
	Q9WTX5	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	Q8C5H6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2020-04-28	Skp1	S-phase kinase-associated protein 1	Skp1a	S-phase kinase-associated protein 1A	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Mammalian Phenotype