Symbol:
Degs1
Name:
delta 4-desaturase, sphingolipid 1
RGD ID:
1552689
MGI Page
MGI
Description:
Enables retinol isomerase activity and sphingolipid delta-4 desaturase activity. Acts upstream of or within ceramide biosynthetic process and positive regulation of apoptotic process. Predicted to be located in mitochondrion. Is expressed in several structures, including alimentary system; cardiovascular system; genitourinary system; nervous system; and sensory organ. Human ortholog(s) of this gene implicated in hypomyelinating leukodystrophy 18. Orthologous to human DEGS1 (delta 4-desaturase, sphingolipid 1).
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
AA536663; degenerative spermatocyte homolog 1; Degs; delta(4)-desaturase, sphingolipid 1; Des; Des1; dihydroceramide desaturase; dihydroceramide desaturase-1; Mde; Mdes; retinol isomerase; sphingolipid delta(4)-desaturase DES1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DEGS1 (delta 4-desaturase, sphingolipid 1) HGNC
EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):
Degs1 (delta(4)-desaturase, sphingolipid 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Degs1 (delta 4-desaturase, sphingolipid 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DEGS1 (delta 4-desaturase, sphingolipid 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DEGS1 (delta 4-desaturase, sphingolipid 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Degs1 (delta 4-desaturase, sphingolipid 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DEGS1 (delta 4-desaturase, sphingolipid 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DEGS1 (delta 4-desaturase, sphingolipid 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Degs1 (delta 4-desaturase, sphingolipid 1) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
DEGS2 (delta 4-desaturase, sphingolipid 2) HGNC
OrthoDB
Alliance orthologs 3
Rattus norvegicus (Norway rat):
Degs1 (delta(4)-desaturase, sphingolipid 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
DEGS1 (delta 4-desaturase, sphingolipid 1)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
degs1 (delta(4)-desaturase, sphingolipid 1)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid|ZFIN)
Caenorhabditis elegans (roundworm):
F33D4.4
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Drosophila melanogaster (fruit fly):
ifc
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
ttm-5
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
degs1
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Related Pseudogenes:
Gm6606
Latest Assembly:
GRCm39 - Mouse Genome Assembly GRCm39
Position:
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 182,103,529 - 182,110,366 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 182,103,337 - 182,110,369 (-) Ensembl GRCm39 Ensembl GRCm38 1 182,275,964 - 182,282,854 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 182,275,772 - 182,282,804 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 184,205,901 - 184,212,890 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 184,112,445 - 184,119,434 (-) NCBI MGSCv36 mm8 Celera 1 189,318,025 - 189,324,947 (-) NCBI Celera Cytogenetic Map 1 H5 NCBI cM Map 1 84.93 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Degs1 Mouse 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of DEGS1 mRNA CTD PMID:17942748 Degs1 Mouse 17alpha-ethynylestradiol multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DEGS1 mRNA CTD PMID:17942748 Degs1 Mouse 17beta-estradiol multiple interactions ISO Degs1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of DEGS1 mRNA CTD PMID:26496021 Degs1 Mouse 17beta-estradiol affects expression EXP 6480464 Estradiol affects the expression of DEGS1 mRNA CTD PMID:39298647 Degs1 Mouse 17beta-hydroxy-5alpha-androstan-3-one increases expression ISO DEGS1 (Homo sapiens) 6480464 Dihydrotestosterone results in increased expression of DEGS1 mRNA CTD PMID:29581250 Degs1 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO DEGS1 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of DEGS1 mRNA] CTD PMID:11007951 Degs1 Mouse 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of DEGS1 mRNA CTD PMID:21570461 and PMID:26377647 Degs1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO DEGS1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of DEGS1 mRNA CTD PMID:20106945 and PMID:21632981 Degs1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Degs1 (Rattus norvegicus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DEGS1 mRNA CTD PMID:21215274 and PMID:33387578 Degs1 Mouse 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DEGS1 mRNA CTD PMID:19465110 Degs1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DEGS1 mRNA CTD PMID:18796159 and PMID:28213091 Degs1 Mouse 2,3,7,8-tetrachlorodibenzodioxine multiple interactions EXP 6480464 [Tetrachlorodibenzodioxin binds to AHR protein] which results in decreased expression of DEGS1 mRNA and [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of DEGS1 mRNA CTD PMID:16214954 and PMID:17942748 Degs1 Mouse 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO DEGS1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DEGS1 mRNA CTD PMID:11007951 Degs1 Mouse 2,4-dinitrotoluene affects expression ISO Degs1 (Rattus norvegicus) 6480464 2 and 4-dinitrotoluene affects the expression of DEGS1 mRNA CTD PMID:21346803 Degs1 Mouse 2-hydroxypropanoic acid decreases expression ISO DEGS1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of DEGS1 mRNA CTD PMID:30851411 Degs1 Mouse 3-methylcholanthrene multiple interactions ISO DEGS1 (Homo sapiens) 6480464 Methylcholanthrene promotes the reaction [AHR protein binds to DEGS1 promoter] CTD PMID:20348232 Degs1 Mouse 4-hydroxyphenyl retinamide decreases expression EXP 6480464 Fenretinide results in decreased expression of DEGS1 mRNA CTD PMID:28973697 Degs1 Mouse 6-propyl-2-thiouracil decreases expression ISO Degs1 (Rattus norvegicus) 6480464 Propylthiouracil results in decreased expression of DEGS1 mRNA CTD PMID:24780913 Degs1 Mouse aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of DEGS1 mRNA CTD PMID:19770486 Degs1 Mouse Aflatoxin B2 alpha decreases methylation ISO DEGS1 (Homo sapiens) 6480464 aflatoxin B2 results in decreased methylation of DEGS1 intron CTD PMID:30157460 Degs1 Mouse all-trans-retinoic acid decreases expression ISO DEGS1 (Homo sapiens) 6480464 Tretinoin results in decreased expression of DEGS1 mRNA CTD PMID:16249480 Degs1 Mouse all-trans-retinoic acid increases expression ISO DEGS1 (Homo sapiens) 6480464 Tretinoin results in increased expression of DEGS1 mRNA CTD PMID:33167477 Degs1 Mouse all-trans-retinoic acid decreases expression EXP 6480464 Tretinoin results in decreased expression of DEGS1 mRNA CTD PMID:16604517 Degs1 Mouse ammonium chloride affects expression ISO Degs1 (Rattus norvegicus) 6480464 Ammonium Chloride affects the expression of DEGS1 mRNA CTD PMID:16483693 Degs1 Mouse Aroclor 1254 decreases expression EXP 6480464 Chlorodiphenyl (54% Chlorine) results in decreased expression of DEGS1 mRNA CTD PMID:23650126 Degs1 Mouse arsane multiple interactions ISO DEGS1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of DEGS1 mRNA CTD PMID:32525701 Degs1 Mouse arsenic atom multiple interactions ISO DEGS1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of DEGS1 mRNA CTD PMID:32525701 Degs1 Mouse atrazine decreases expression ISO DEGS1 (Homo sapiens) 6480464 Atrazine results in decreased expression of DEGS1 mRNA CTD PMID:22378314 Degs1 Mouse atrazine affects methylation ISO Degs1 (Rattus norvegicus) 6480464 Atrazine affects the methylation of DEGS1 gene CTD PMID:28931070 Degs1 Mouse benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of DEGS1 mRNA CTD PMID:22228805 Degs1 Mouse benzo[a]pyrene affects methylation ISO DEGS1 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of DEGS1 promoter CTD PMID:27901495 Degs1 Mouse benzo[a]pyrene increases expression ISO DEGS1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of DEGS1 mRNA CTD PMID:21632981 Degs1 Mouse bis(2-ethylhexyl) phthalate increases expression EXP 6480464 Diethylhexyl Phthalate results in increased expression of DEGS1 mRNA CTD PMID:33754040 Degs1 Mouse bisphenol A multiple interactions ISO Degs1 (Rattus norvegicus) 6480464 [bisphenol A co-treated with Estradiol] results in decreased expression of DEGS1 mRNA CTD PMID:26496021 Degs1 Mouse bisphenol A increases expression ISO Degs1 (Rattus norvegicus) 6480464 bisphenol A results in increased expression of DEGS1 mRNA CTD PMID:25181051 Degs1 Mouse bisphenol F increases expression EXP 6480464 bisphenol F results in increased expression of DEGS1 mRNA CTD PMID:38685157 Degs1 Mouse chlormequat chloride increases expression ISO Degs1 (Rattus norvegicus) 6480464 Chlormequat results in increased expression of DEGS1 protein CTD PMID:34958886 Degs1 Mouse clobetasol increases expression EXP 6480464 Clobetasol results in increased expression of DEGS1 mRNA CTD PMID:27462272 Degs1 Mouse clofibrate increases expression EXP 6480464 Clofibrate results in increased expression of DEGS1 mRNA CTD PMID:17585979 Degs1 Mouse cobalt dichloride decreases expression ISO DEGS1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of DEGS1 mRNA CTD PMID:19376846 Degs1 Mouse cycloheximide multiple interactions ISO DEGS1 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of DEGS1 mRNA] CTD PMID:11007951 Degs1 Mouse dexamethasone decreases expression ISO Degs1 (Rattus norvegicus) 6480464 Dexamethasone results in decreased expression of DEGS1 mRNA CTD PMID:20032058 Degs1 Mouse dexamethasone multiple interactions ISO Degs1 (Rattus norvegicus) 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of DEGS1 mRNA] CTD PMID:20032058 Degs1 Mouse elemental selenium decreases expression ISO DEGS1 (Homo sapiens) 6480464 Selenium results in decreased expression of DEGS1 mRNA CTD PMID:19244175 Degs1 Mouse entinostat increases expression ISO DEGS1 (Homo sapiens) 6480464 entinostat results in increased expression of DEGS1 mRNA CTD PMID:26272509 and PMID:27188386 Degs1 Mouse fenthion decreases expression EXP 6480464 Fenthion results in decreased expression of DEGS1 mRNA CTD PMID:34813904 Degs1 Mouse finasteride increases expression ISO Degs1 (Rattus norvegicus) 6480464 Finasteride results in increased expression of DEGS1 mRNA CTD PMID:24136188 Degs1 Mouse flutamide increases expression ISO Degs1 (Rattus norvegicus) 6480464 Flutamide results in increased expression of DEGS1 mRNA CTD PMID:24136188 Degs1 Mouse fumonisin B1 increases expression EXP 6480464 fumonisin B1 results in increased expression of DEGS1 mRNA CTD PMID:16221962 Degs1 Mouse gentamycin increases expression ISO Degs1 (Rattus norvegicus) 6480464 Gentamicins results in increased expression of DEGS1 mRNA CTD PMID:22061828 Degs1 Mouse lithocholic acid increases expression EXP 6480464 Lithocholic Acid results in increased expression of DEGS1 mRNA CTD PMID:21480330 Degs1 Mouse N-acylsphinganine multiple interactions ISO DEGS1 (Homo sapiens) 6480464 [N-((1R and 2S)-2-hydroxy-1-hydroxymethyl-2-(2-tridecyl-1-cyclopropenyl)ethyl)octanamide results in decreased activity of DEGS1 protein] which results in decreased reduction of dihydroceramide CTD PMID:27635674 Degs1 Mouse N-nitrosodiethylamine multiple interactions ISO Degs1 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of DEGS1 mRNA CTD PMID:20360939 Degs1 Mouse nefazodone increases expression ISO Degs1 (Rattus norvegicus) 6480464 nefazodone results in increased expression of DEGS1 mRNA CTD PMID:24136188 Degs1 Mouse nickel dichloride decreases expression ISO DEGS1 (Homo sapiens) 6480464 nickel chloride results in decreased expression of DEGS1 mRNA CTD PMID:17312168 Degs1 Mouse okadaic acid increases expression ISO DEGS1 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of DEGS1 mRNA CTD PMID:38832940 Degs1 Mouse paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of DEGS1 mRNA CTD PMID:17562736 Degs1 Mouse paracetamol increases expression ISO Degs1 (Rattus norvegicus) 6480464 Acetaminophen results in increased expression of DEGS1 mRNA CTD PMID:33387578 Degs1 Mouse paracetamol increases expression ISO DEGS1 (Homo sapiens) 6480464 Acetaminophen results in increased expression of DEGS1 mRNA CTD PMID:22230336 Degs1 Mouse parathion increases expression EXP 6480464 Parathion results in increased expression of DEGS1 mRNA CTD PMID:34813904 Degs1 Mouse pentachlorophenol increases expression EXP 6480464 Pentachlorophenol results in increased expression of DEGS1 mRNA CTD PMID:23892564 Degs1 Mouse phenethyl caffeate multiple interactions ISO Degs1 (Rattus norvegicus) 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in decreased expression of DEGS1 mRNA CTD PMID:20360939 Degs1 Mouse piroxicam increases expression ISO DEGS1 (Homo sapiens) 6480464 Piroxicam results in increased expression of DEGS1 mRNA CTD PMID:21858171 Degs1 Mouse rac-lactic acid decreases expression ISO DEGS1 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of DEGS1 mRNA CTD PMID:30851411 Degs1 Mouse resorcinol increases expression ISO DEGS1 (Homo sapiens) 6480464 resorcinol results in increased expression of DEGS1 mRNA CTD PMID:22623647 Degs1 Mouse resveratrol multiple interactions ISO DEGS1 (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in increased expression of DEGS1 mRNA CTD PMID:23557933 Degs1 Mouse rotenone increases expression ISO Degs1 (Rattus norvegicus) 6480464 Rotenone results in increased expression of DEGS1 mRNA CTD PMID:28374803 Degs1 Mouse selenium atom decreases expression ISO DEGS1 (Homo sapiens) 6480464 Selenium results in decreased expression of DEGS1 mRNA CTD PMID:19244175 Degs1 Mouse sodium arsenate multiple interactions ISO DEGS1 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of DEGS1 mRNA CTD PMID:32525701 Degs1 Mouse sodium arsenite decreases expression ISO DEGS1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DEGS1 protein CTD PMID:30528433 Degs1 Mouse sodium dodecyl sulfate decreases expression ISO DEGS1 (Homo sapiens) 6480464 Sodium Dodecyl Sulfate results in decreased expression of DEGS1 mRNA CTD PMID:31734321 Degs1 Mouse sulindac increases expression ISO Degs1 (Rattus norvegicus) 6480464 Sulindac results in increased expression of DEGS1 mRNA CTD PMID:24136188 Degs1 Mouse testosterone multiple interactions ISO Degs1 (Rattus norvegicus) 6480464 Testosterone inhibits the reaction [Dexamethasone results in decreased expression of DEGS1 mRNA] CTD PMID:20032058 Degs1 Mouse testosterone increases expression EXP 6480464 Testosterone deficiency results in increased expression of DEGS1 mRNA CTD PMID:33848595 Degs1 Mouse tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of DEGS1 mRNA CTD PMID:31919559 Degs1 Mouse thiram decreases expression ISO DEGS1 (Homo sapiens) 6480464 Thiram results in decreased expression of DEGS1 mRNA CTD PMID:38568856 Degs1 Mouse titanium dioxide increases methylation EXP 6480464 titanium dioxide results in increased methylation of DEGS1 gene and titanium dioxide results in increased methylation of DEGS1 promoter CTD PMID:35295148 Degs1 Mouse triphenyl phosphate affects expression ISO DEGS1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of DEGS1 mRNA CTD PMID:37042841 Degs1 Mouse urethane increases expression ISO DEGS1 (Homo sapiens) 6480464 Urethane results in increased expression of DEGS1 mRNA CTD PMID:28818685 Degs1 Mouse valproic acid increases expression ISO DEGS1 (Homo sapiens) 6480464 Valproic Acid results in increased expression of DEGS1 mRNA CTD PMID:23179753 and PMID:27188386
Imported Annotations - KEGG (archival)
17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dinitrotoluene (ISO) 2-hydroxypropanoic acid (ISO) 3-methylcholanthrene (ISO) 4-hydroxyphenyl retinamide (EXP) 6-propyl-2-thiouracil (ISO) aflatoxin B1 (EXP) Aflatoxin B2 alpha (ISO) all-trans-retinoic acid (EXP,ISO) ammonium chloride (ISO) Aroclor 1254 (EXP) arsane (ISO) arsenic atom (ISO) atrazine (ISO) benzo[a]pyrene (EXP,ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (ISO) bisphenol F (EXP) chlormequat chloride (ISO) clobetasol (EXP) clofibrate (EXP) cobalt dichloride (ISO) cycloheximide (ISO) dexamethasone (ISO) elemental selenium (ISO) entinostat (ISO) fenthion (EXP) finasteride (ISO) flutamide (ISO) fumonisin B1 (EXP) gentamycin (ISO) lithocholic acid (EXP) N-acylsphinganine (ISO) N-nitrosodiethylamine (ISO) nefazodone (ISO) nickel dichloride (ISO) okadaic acid (ISO) paracetamol (EXP,ISO) parathion (EXP) pentachlorophenol (EXP) phenethyl caffeate (ISO) piroxicam (ISO) rac-lactic acid (ISO) resorcinol (ISO) resveratrol (ISO) rotenone (ISO) selenium atom (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dodecyl sulfate (ISO) sulindac (ISO) testosterone (EXP,ISO) tetrachloromethane (EXP) thiram (ISO) titanium dioxide (EXP) triphenyl phosphate (ISO) urethane (ISO) valproic acid (ISO)
Degs1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 182,103,529 - 182,110,366 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 182,103,337 - 182,110,369 (-) Ensembl GRCm39 Ensembl GRCm38 1 182,275,964 - 182,282,854 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 182,275,772 - 182,282,804 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 184,205,901 - 184,212,890 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 184,112,445 - 184,119,434 (-) NCBI MGSCv36 mm8 Celera 1 189,318,025 - 189,324,947 (-) NCBI Celera Cytogenetic Map 1 H5 NCBI cM Map 1 84.93 NCBI
DEGS1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 224,183,240 - 224,193,441 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 224,175,756 - 224,193,441 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 224,370,942 - 224,381,143 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 222,437,551 - 222,447,766 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 1 197,561,861 - 197,572,073 (+) NCBI Celera Cytogenetic Map 1 q42.11 NCBI HuRef 1 194,891,445 - 194,901,670 (+) NCBI HuRef CHM1_1 1 225,643,571 - 225,653,792 (+) NCBI CHM1_1 T2T-CHM13v2.0 1 223,372,483 - 223,382,685 (+) NCBI T2T-CHM13v2.0
Degs1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 13 96,478,645 - 96,485,302 (-) NCBI GRCr8 mRatBN7.2 13 93,946,154 - 93,953,677 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 13 93,946,157 - 93,953,664 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 13 96,452,250 - 96,458,907 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 13 97,852,156 - 97,858,813 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 13 95,034,331 - 95,040,988 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 13 100,665,265 - 100,672,731 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 13 100,666,075 - 100,672,731 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 13 105,599,106 - 105,606,572 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 13 98,242,981 - 98,249,638 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 13 98,431,962 - 98,438,556 (-) NCBI Celera 13 93,480,467 - 93,487,120 (-) NCBI Celera Cytogenetic Map 13 q26 NCBI
Degs1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955520 1,135,563 - 1,143,192 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955520 1,139,568 - 1,143,149 (-) NCBI ChiLan1.0 ChiLan1.0
DEGS1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 25,334,511 - 25,344,806 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 25,285,430 - 25,295,619 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 199,651,712 - 199,661,848 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 204,659,389 - 204,683,171 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 204,659,389 - 204,668,901 (+) Ensembl panpan1.1 panPan2
DEGS1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 7 40,147,293 - 40,152,190 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 7 40,147,505 - 40,153,085 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 7 39,629,447 - 39,639,491 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 7 39,982,286 - 39,992,310 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 7 39,980,406 - 39,992,266 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 7 39,822,856 - 39,832,860 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 7 39,830,750 - 39,840,481 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 7 40,099,271 - 40,109,303 (-) NCBI UU_Cfam_GSD_1.0
Degs1
DEGS1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 12,557,767 - 12,568,978 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 12,529,021 - 12,568,447 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 14,976,597 - 15,053,245 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DEGS1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 25 5,589,530 - 5,603,261 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 25 5,589,383 - 5,603,227 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666055 5,771,384 - 5,781,608 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Degs1
.
Predicted Target Of
Count of predictions: 338 Count of miRNA genes: 285 Interacting mature miRNAs: 301 Transcripts: ENSMUST00000035295, ENSMUST00000132551, ENSMUST00000133052 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
11039528 Ccc3_m colitis susceptibility in the Collaborative Cross 3 (mouse) 1 3680142 195051546 Mouse 4141245 Cq2_m cholesterol QTL 2 (mouse) Not determined 1 157456299 191456436 Mouse 4141244 Bmd5c_m bone mineral density 5c (mouse) Not determined 155526796 189526897 Mouse 1558802 Skmw6_m skeletal muscle weight 6 (mouse) Not determined 1 167954584 195154279 Mouse 10412185 Hcs9_m hepatocarcinogenesis susceptibility 9 (mouse) Not determined 1 63854690 189303617 Mouse 13464138 Hdlq107_m HDL QTL 107 (mouse) 1 152132744 186132744 Mouse 1301652 Cpfd2_m cerebellum pattern fissures (mouse) Not determined 1 172303451 195154279 Mouse 12790987 Tgl5_m triglyceride 5 (mouse) 1 160097157 194097157 Mouse 13824984 Twq5_m testis weight QTL 5 (mouse) 1 3069992 184732197 Mouse 4142389 Scfr1_m stem cell frequency regulator 1 (mouse) Not determined 171632048 189303617 Mouse 1300888 Berr1_m berghei resistance locus 1 (mouse) Not determined 1 164143227 190534272 Mouse 12790988 Phdlc5_m plasma HDL cholesterol 5 (mouse) 9 160097157 194097157 Mouse 1301251 Scc3_m colon tumor susceptibility 3 (mouse) Not determined 1 168213823 195154279 Mouse 1301122 Cd8mts1_m CD8 T memory cell subset 1 (mouse) Not determined 1 155831765 189831892 Mouse 1301632 Bw8q1_m body weight at 8 weeks QTL 1 (mouse) Not determined 1 161201261 195154279 Mouse 4141483 Femwf7_m femur work to failure 7 (mouse) Not determined 167462514 195154279 Mouse 1302023 Orch4_m autoimmune orchitis resistance 4 (mouse) Not determined 1 175211318 195154279 Mouse 1301385 Radpf2_m radiation pulmonary fibrosis 2 (mouse) Not determined 1 147125258 182873798 Mouse 1300745 Gvhd1_m graft-versus-host disease 1 (mouse) Not determined 1 157456299 191456436 Mouse 10412162 Nobq3_m New Zealand obese QTL 3 (mouse) Not determined 1 103933405 191225397 Mouse 4141346 Skmw12_m skeletal muscle weight 12 (mouse) Not determined 150756737 184756922 Mouse 1301134 Bmd1_m bone mineral density 1 (mouse) Not determined 1 156602037 189303617 Mouse 1302158 Fembrs5_m femur breaking strength 5 (mouse) Not determined 1 167462514 195154279 Mouse 1301132 Mors1_m modifier of obesity related sterility 1 (mouse) Not determined 1 170379500 195154279 Mouse 1357620 Aaj1_m anxiety in A/J 1 (mouse) Not determined 1 180832317 191851043 Mouse 1357493 Lgaq3_m late growth adjusted QTL 3 (mouse) Not determined 1 150193673 188359312 Mouse 11251722 Ewc1_m ethanol withdrawal and consumption 1 (mouse) 1 152132744 186132744 Mouse 10043963 Obq25_m obesity QTL 25 (mouse) Not determined 1 154410512 188410512 Mouse 1301431 Pcho1_m plasma cholesterol 1 (mouse) Not determined 1 159262573 193262693 Mouse 1357618 Splq5_m spleen weight QTL 5 (mouse) Not determined 1 150193673 188359312 Mouse 1301301 Sle1_m systemic lupus erythmatosus susceptibility 1 (mouse) Not determined 1 152038741 186038913 Mouse 12904936 Edlmmq1_m extensor digitorum longus muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1301565 Mnotch_m modifier of Notch (mouse) Not determined 1 157456299 191456436 Mouse 1301309 Emo1_m emotionality 1 (mouse) Not determined 1 162977097 185994196 Mouse 1357732 Tbbmd1_m total body bone mineral density 1 (mouse) Not determined 1 171983110 195154279 Mouse 1301025 Lbw7_m lupus NZB x NZW 7 (mouse) Not determined 1 152038741 186038913 Mouse 10412074 Nhdlt1_m non-HDL cholesterol and triglyceride levels 1 (mouse) Not determined 1 153675990 187676105 Mouse 12904944 Tammq1_m tibialis anterior muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 1357485 Lgq4_m late growth QTL 4 (mouse) Not determined 1 150193673 188359312 Mouse 12904957 Gmmq1_m gastrocnemius muscle mass QTL 1 (mouse) 1 155002940 189002940 Mouse 11532690 Sluc37_m susceptibility to lung cancer 37 (mouse) 1 175468817 194111528 Mouse 1301932 Ssta2_m susceptibility to Salmonella typhimurium antigens 2 (mouse) Not determined 1 155716221 189716369 Mouse 1301202 Yaa4_m Y-linked autoimmune acceleration 4 (mouse) Not determined 1 158468817 192468938 Mouse 10054490 Opefa_m open field activity (mouse) Not determined 1 153712853 187712853 Mouse 1300823 Ath9_m atherosclerosis 9 (mouse) Not determined 1 160112768 194112883 Mouse 1301333 Mop3_m morphine preference 3 (mouse) Not determined 1 167756737 189303617 Mouse 1300948 Fglu2_m fasting glucose 2 (mouse) Not determined 1 157456299 191456436 Mouse 1301339 Hdlq15_m HDL QTL 15 (mouse) Not determined 1 165873675 195154279 Mouse 1301722 Cia9_m collagen induced arthritis QTL 9 (mouse) Not determined 1 45783900 189303617 Mouse 11059556 Lmr20b_m leishmaniasis resistance 20b (mouse) 1 158468817 192468938 Mouse 4141554 Cfmq1_m cystic fibrosis modifier QTL 1 (mouse) Not determined 1 152038741 186038913 Mouse 11059557 Lmr20a_m leishmaniasis resistance 20a (mouse) 1 158468817 192468938 Mouse 11059558 Lmr20c_m leishmaniasis resistance 20c (mouse) 1 158468817 192468938 Mouse 10043863 Swrl5_m SWR lupus locus 5 (mouse) Not determined 1 172303451 195154279 Mouse 1301596 Elnt_m escape latencies during navigation task (mouse) Not determined 1 162145207 194111528 Mouse 11049575 Lmr8b_m leishmaniasis resistance 8b (mouse) 1 172303451 195154279 Mouse 4141165 Bglu3_m blood glucose level 3 (mouse) Not determined 155831765 189831892 Mouse 12792983 Liq1_m limb inflammation QTL 1 (mouse) 1 167586086 191225397 Mouse 1357889 Lprq3_m lipoprotein QTL 3 (mouse) Not determined 1 152038741 186038913 Mouse 1301189 Lmr8_m leishmaniasis resistance 8 (mouse) Not determined 1 156602037 189303617 Mouse 4142182 Shali5_m survival time to hyperoxic acute lung injury 5 (mouse) Not determined 155582237 185994196 Mouse 10766456 Sle21_m systematic lupus erythematosus susceptibility 21 (mouse) 1 155831765 189831892 Mouse 10402498 Lmr20_m leishmaniasis resistance 20 (mouse) Not determined 1 158468817 192468938 Mouse 1301619 Cafq1_m caffeine metabolism QTL 1 (mouse) Not determined 1 155716221 189716369 Mouse 4141149 Hbnr4_m Heligmosomoides bakeri nematode resistance 4 (mouse) Not determined 147125258 188983224 Mouse 1300727 Mptp1_m MPTP sensitivity 1 (mouse) Not determined 1 171632048 192681050 Mouse 10054271 Nba9_m New Zealand Black autoimmunity 9 (mouse) Not determined 1 155525623 189527533 Mouse 11081167 Tir8_m trypanosome infection response 8 (mouse) 1 155716221 189716369 Mouse 10054270 Nba10_m New Zealand Black autoimmunity 10 (mouse) Not determined 1 152794822 186438620 Mouse 1302132 Pbw1_m pentobarbital withdrawal QTL 1 (mouse) Not determined 1 155831765 189831892 Mouse 1559024 Zit1_m zinc induced tolerance 1 (mouse) Not determined 1 167462514 195154279 Mouse 1357692 Axtq1_m anxiety QTL 1 (mouse) Not determined 1 180832317 191851043 Mouse 12880429 V25Dq1_m vitamin D inactive form serum level QTL 1 (mouse) 1 172632197 195154279 Mouse 4142291 Aec2_m autoimmune exocrinopathy 2 (mouse) Not determined 52457737 182250592 Mouse 12880426 V25Dq2_m vitamin D inactive form serum level QTL 2 (mouse) 1 172532197 195154279 Mouse 1300732 Melm2_m melanoma modifier 2 (mouse) Not determined 1 157456299 191456436 Mouse 4142159 Nba2_m New Zealand Black autoimmunity 2 (mouse) Not determined 151835111 185835280 Mouse 1301602 Bslm4_m basal locomotor activity 4 (mouse) Not determined 1 157456299 191456436 Mouse 1301216 Cbm1_m cerebellum weight 1 (mouse) Not determined 1 157456299 191456436 Mouse 1301866 Cplaq3_m circadian period of locomotor activity 3 (mouse) Not determined 1 155721528 189722608 Mouse 1300842 Sle9_m systematic lupus erythematosus susceptibility 9 (mouse) Not determined 1 158468817 192468938 Mouse 1300969 Sluc5_m susceptibility to lung cancer 5 (mouse) Not determined 1 151186243 185186402 Mouse 1301614 Cgnz1_m chronic glomerulonephritis in NZM 1 (mouse) Not determined 1 152038741 186038913 Mouse
RH124287
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 182,276,005 - 182,276,114 UniSTS GRCm38 MGSCv37 1 184,206,136 - 184,206,245 UniSTS GRCm37 Celera 1 189,318,260 - 189,318,369 UniSTS Cytogenetic Map 1 H5 UniSTS
AW822031
Mouse Assembly Chr Position (strand) Source JBrowse GRCm38 1 182,276,087 - 182,276,340 UniSTS GRCm38 MGSCv37 1 184,206,218 - 184,206,471 UniSTS GRCm37 Celera 1 189,318,342 - 189,318,595 UniSTS Cytogenetic Map 1 H5 UniSTS Whitehead/MRC_RH 1 2277.53 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
Ensembl Acc Id:
ENSMUST00000035295 ⟹ ENSMUSP00000048519
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 182,103,337 - 182,110,369 (-) Ensembl GRCm38.p6 Ensembl 1 182,275,772 - 182,282,804 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000132551
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 182,106,062 - 182,110,369 (-) Ensembl GRCm38.p6 Ensembl 1 182,278,497 - 182,282,804 (-) Ensembl
Ensembl Acc Id:
ENSMUST00000133052 ⟹ ENSMUSP00000119473
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 Ensembl 1 182,106,569 - 182,109,789 (-) Ensembl GRCm38.p6 Ensembl 1 182,279,004 - 182,282,224 (-) Ensembl
RefSeq Acc Id:
NM_001360783 ⟹ NP_001347712
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 182,103,529 - 182,109,760 (-) NCBI GRCm38 1 182,275,964 - 182,282,195 (-) NCBI
Sequence:
GGGTGACCCTAGGCTTCCCAGACCGGATGGCTCCTCAAAGTATCCAGAGATCAAGTCCTTGATGAAACCTGACCACAATCTGATCTGGATTGTAGCCATGATGCTTCTCGTCCAGCTGGCTTCATTTT
hide sequence
RefSeq Acc Id:
NM_007853 ⟹ NP_031879
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Mouse Assembly Chr Position (strand) Source GRCm39 1 182,103,529 - 182,110,366 (-) NCBI GRCm38 1 182,275,964 - 182,282,801 (-) NCBI MGSCv37 1 184,205,901 - 184,212,890 (-) RGD Celera 1 189,318,025 - 189,324,947 (-) RGD cM Map 1 ENTREZGENE
Sequence:
TCTGCCCGCGTCCCCGCGGCTTATCGACTAGAGCCGGGCCTCGAGCTGCCGCCGTCCGGACACG
hide sequence
RefSeq Acc Id:
NP_031879 ⟸ NM_007853
- Peptide Label:
isoform 1
- UniProtKB:
Q8R4H3 (UniProtKB/Swiss-Prot), O09005 (UniProtKB/Swiss-Prot)
- Sequence:
MGSRVSREEFEWVYTDQPHAARRKEILAKYPEIKSLMKPDHNLIWIVAMMLLVQLASFYLVKDLDWKWVIFWSYVFGSCLNHSMTLAIHEISHNFPFGHHKALWNRWFGMFANLSLGVPYSISFKRYH
hide sequence
RefSeq Acc Id:
NP_001347712 ⟸ NM_001360783
- Peptide Label:
isoform 2
Ensembl Acc Id:
ENSMUSP00000119473 ⟸ ENSMUST00000133052
Ensembl Acc Id:
ENSMUSP00000048519 ⟸ ENSMUST00000035295
RGD ID: 6875964 Promoter ID: EPDNEW_M1433 Type: initiation region Name: Degs1_1 Description: Mus musculus delta-desaturase, sphingolipid 1 , transcript variant1, mRNA. SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Mouse Assembly Chr Position (strand) Source GRCm38 1 182,282,772 - 182,282,832 EPDNEW
RGD ID: 6817593 Promoter ID: MM_KWN:3181 Type: CpG-Island SO ACC ID: SO:0000170 Source: MPROMDB Tissues & Cell Lines: 3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6, Spleen Transcripts: OTTMUST00000051340, OTTMUST00000051341, OTTMUST00000051342 Position: Mouse Assembly Chr Position (strand) Source MGSCv36 1 184,212,416 - 184,213,117 (-) MPROMDB
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2023-01-24
Degs1
delta 4-desaturase, sphingolipid 1
Degs1
delta(4)-desaturase, sphingolipid 1
Symbol and/or name change
5135510 APPROVED
2015-12-22
Degs1
delta(4)-desaturase, sphingolipid 1
degenerative spermatocyte homolog 1 (Drosophila)
Symbol and/or name change
5135510 APPROVED
